id	sid	tid	token	lemma	pos
abc-4026	1	1	256	256	NUM
abc-4026	1	2	acta	acta	PROPN
abc-4026	1	3	bot	bot	PROPN
abc-4026	1	4	.	.	PUNCT
abc-4026	2	1	croat	croat	PROPN
abc-4026	2	2	.	.	PUNCT
abc-4026	3	1	84	84	NUM
abc-4026	3	2	(	(	PUNCT
abc-4026	3	3	2	2	NUM
abc-4026	3	4	)	)	PUNCT
abc-4026	3	5	,	,	PUNCT
abc-4026	3	6	2025	2025	NUM
abc-4026	3	7	acta	acta	PROPN
abc-4026	3	8	bot	bot	PROPN
abc-4026	3	9	.	.	PUNCT
abc-4026	4	1	croat	croat	PROPN
abc-4026	4	2	.	.	PUNCT
abc-4026	5	1	84	84	NUM
abc-4026	5	2	(	(	PUNCT
abc-4026	5	3	2	2	NUM
abc-4026	5	4	)	)	PUNCT
abc-4026	5	5	,	,	PUNCT
abc-4026	5	6	256–265	256–265	NUM
abc-4026	5	7	,	,	PUNCT
abc-4026	5	8	2025	2025	NUM
abc-4026	5	9	coden	coden	NOUN
abc-4026	5	10	:	:	PUNCT
abc-4026	5	11	abcra	abcra	NOUN
abc-4026	5	12	25	25	NUM
abc-4026	5	13	doi	doi	NOUN
abc-4026	5	14	10.37427	10.37427	NUM
abc-4026	5	15	/	/	SYM
abc-4026	5	16	botcro-2025	botcro-2025	ADJ
abc-4026	5	17	-	-	PUNCT
abc-4026	5	18	006	006	NUM
abc-4026	5	19	issn	issn	PROPN
abc-4026	5	20	0365	0365	NUM
abc-4026	5	21	-	-	PUNCT
abc-4026	5	22	0588	0588	NUM
abc-4026	5	23	eissn	eissn	PROPN
abc-4026	5	24	1847	1847	NUM
abc-4026	5	25	-	-	SYM
abc-4026	5	26	8476	8476	NUM
abc-4026	5	27	construction	construction	NOUN
abc-4026	5	28	of	of	ADP
abc-4026	5	29	the	the	DET
abc-4026	5	30	arabidopsis	arabidopsis	NOUN
abc-4026	5	31	isogenic	isogenic	ADJ
abc-4026	5	32	lines	line	NOUN
abc-4026	5	33	containing	contain	VERB
abc-4026	5	34	dually	dually	ADV
abc-4026	5	35	localized	localize	VERB
abc-4026	5	36	protein	protein	NOUN
abc-4026	5	37	trol	trol	NOUN
abc-4026	5	38	only	only	ADV
abc-4026	5	39	in	in	ADP
abc-4026	5	40	the	the	DET
abc-4026	5	41	inner	inner	ADJ
abc-4026	5	42	chloroplast	chloroplast	NOUN
abc-4026	5	43	envelope	envelope	NOUN
abc-4026	5	44	membrane	membrane	NOUN
abc-4026	5	45	lea	lea	PROPN
abc-4026	5	46	vojta	vojta	PROPN
abc-4026	5	47	*	*	NOUN
abc-4026	5	48	,	,	PUNCT
abc-4026	5	49	hrvoje	hrvoje	NOUN
abc-4026	5	50	fulgosi	fulgosi	PROPN
abc-4026	5	51	,	,	PUNCT
abc-4026	5	52	ana	ana	PROPN
abc-4026	5	53	tomašić	tomašić	PROPN
abc-4026	5	54	paić	paić	PROPN
abc-4026	5	55	,	,	PUNCT
abc-4026	5	56	ena	ena	PROPN
abc-4026	5	57	dumančić	dumančić	PROPN
abc-4026	5	58	ruđer	ruđer	PROPN
abc-4026	5	59	bošković	bošković	PROPN
abc-4026	5	60	institute	institute	PROPN
abc-4026	5	61	,	,	PUNCT
abc-4026	5	62	division	division	NOUN
abc-4026	5	63	of	of	ADP
abc-4026	5	64	molecular	molecular	ADJ
abc-4026	5	65	biology	biology	NOUN
abc-4026	5	66	,	,	PUNCT
abc-4026	5	67	laboratory	laboratory	NOUN
abc-4026	5	68	for	for	ADP
abc-4026	5	69	molecular	molecular	ADJ
abc-4026	5	70	plant	plant	NOUN
abc-4026	5	71	biology	biology	NOUN
abc-4026	5	72	and	and	CCONJ
abc-4026	5	73	biotechnology	biotechnology	NOUN
abc-4026	5	74	,	,	PUNCT
abc-4026	5	75	bijenička	bijenička	NOUN
abc-4026	5	76	cesta	cesta	PROPN
abc-4026	5	77	54	54	NUM
abc-4026	5	78	,	,	PUNCT
abc-4026	5	79	hr-10000	hr-10000	PROPN
abc-4026	5	80	zagreb	zagreb	PROPN
abc-4026	5	81	,	,	PUNCT
abc-4026	5	82	croatia	croatia	PROPN
abc-4026	5	83	abstract	abstract	NOUN
abc-4026	5	84	–	–	PUNCT
abc-4026	5	85	the	the	DET
abc-4026	5	86	thylakoid	thylakoid	ADJ
abc-4026	5	87	rhodanese	rhodanese	ADJ
abc-4026	5	88	-	-	PUNCT
abc-4026	5	89	like	like	ADJ
abc-4026	5	90	protein	protein	NOUN
abc-4026	5	91	(	(	PUNCT
abc-4026	5	92	trol	trol	NOUN
abc-4026	5	93	)	)	PUNCT
abc-4026	5	94	is	be	AUX
abc-4026	5	95	located	locate	VERB
abc-4026	5	96	at	at	ADP
abc-4026	5	97	the	the	DET
abc-4026	5	98	end	end	NOUN
abc-4026	5	99	of	of	ADP
abc-4026	5	100	the	the	DET
abc-4026	5	101	photosynthetic	photosynthetic	ADJ
abc-4026	5	102	electron	electron	NOUN
abc-4026	5	103	transport	transport	NOUN
abc-4026	5	104	chain	chain	NOUN
abc-4026	5	105	,	,	PUNCT
abc-4026	5	106	at	at	ADP
abc-4026	5	107	the	the	DET
abc-4026	5	108	vicinity	vicinity	NOUN
abc-4026	5	109	of	of	ADP
abc-4026	5	110	photosystem	photosystem	NOUN
abc-4026	5	111	i	i	PRON
abc-4026	5	112	,	,	PUNCT
abc-4026	5	113	where	where	SCONJ
abc-4026	5	114	it	it	PRON
abc-4026	5	115	dynamically	dynamically	ADV
abc-4026	5	116	interacts	interact	VERB
abc-4026	5	117	with	with	ADP
abc-4026	5	118	the	the	DET
abc-4026	5	119	ferredoxin	ferredoxin	NOUN
abc-4026	5	120	:	:	PUNCT
abc-4026	5	121	nadp+	nadp+	X
abc-4026	5	122	oxidoreductase	oxidoreductase	PROPN
abc-4026	5	123	(	(	PUNCT
abc-4026	5	124	fnr	fnr	PROPN
abc-4026	5	125	)	)	PUNCT
abc-4026	5	126	and	and	CCONJ
abc-4026	5	127	is	be	AUX
abc-4026	5	128	postulated	postulate	VERB
abc-4026	5	129	to	to	PART
abc-4026	5	130	facilitate	facilitate	VERB
abc-4026	5	131	the	the	DET
abc-4026	5	132	transfer	transfer	NOUN
abc-4026	5	133	of	of	ADP
abc-4026	5	134	electrons	electron	NOUN
abc-4026	5	135	from	from	ADP
abc-4026	5	136	reduced	reduce	VERB
abc-4026	5	137	ferredoxin	ferredoxin	ADJ
abc-4026	5	138	(	(	PUNCT
abc-4026	5	139	fd	fd	PROPN
abc-4026	5	140	)	)	PUNCT
abc-4026	5	141	to	to	ADP
abc-4026	5	142	nadp+	nadp+	PROPN
abc-4026	5	143	.	.	PUNCT
abc-4026	6	1	trol	trol	PROPN
abc-4026	6	2	is	be	AUX
abc-4026	6	3	one	one	NUM
abc-4026	6	4	of	of	ADP
abc-4026	6	5	the	the	DET
abc-4026	6	6	few	few	ADJ
abc-4026	6	7	so	so	ADV
abc-4026	6	8	far	far	ADV
abc-4026	6	9	known	know	VERB
abc-4026	6	10	dually	dually	ADV
abc-4026	6	11	localized	localize	VERB
abc-4026	6	12	chloroplast	chloroplast	ADJ
abc-4026	6	13	proteins	protein	NOUN
abc-4026	6	14	.	.	PUNCT
abc-4026	7	1	besides	besides	SCONJ
abc-4026	7	2	being	be	AUX
abc-4026	7	3	localized	localize	VERB
abc-4026	7	4	in	in	ADP
abc-4026	7	5	the	the	DET
abc-4026	7	6	thylakoid	thylakoid	ADJ
abc-4026	7	7	membranes	membrane	NOUN
abc-4026	7	8	as	as	ADP
abc-4026	7	9	the	the	DET
abc-4026	7	10	66	66	NUM
abc-4026	7	11	kda	kda	NOUN
abc-4026	7	12	mature	mature	PROPN
abc-4026	7	13	form	form	NOUN
abc-4026	7	14	,	,	PUNCT
abc-4026	7	15	it	it	PRON
abc-4026	7	16	has	have	AUX
abc-4026	7	17	also	also	ADV
abc-4026	7	18	been	be	AUX
abc-4026	7	19	found	find	VERB
abc-4026	7	20	in	in	ADP
abc-4026	7	21	the	the	DET
abc-4026	7	22	inner	inner	ADJ
abc-4026	7	23	envelope	envelope	NOUN
abc-4026	7	24	membrane	membrane	NOUN
abc-4026	7	25	of	of	ADP
abc-4026	7	26	chloroplasts	chloroplast	NOUN
abc-4026	7	27	as	as	ADP
abc-4026	7	28	the	the	DET
abc-4026	7	29	70	70	NUM
abc-4026	7	30	kda	kda	NOUN
abc-4026	7	31	precursor	precursor	NOUN
abc-4026	7	32	.	.	PUNCT
abc-4026	8	1	in	in	ADP
abc-4026	8	2	thylakoids	thylakoid	NOUN
abc-4026	8	3	,	,	PUNCT
abc-4026	8	4	the	the	DET
abc-4026	8	5	interaction	interaction	NOUN
abc-4026	8	6	between	between	ADP
abc-4026	8	7	trol	trol	NOUN
abc-4026	8	8	and	and	CCONJ
abc-4026	8	9	fnr	fnr	PROPN
abc-4026	8	10	acts	act	VERB
abc-4026	8	11	like	like	ADP
abc-4026	8	12	a	a	DET
abc-4026	8	13	switch	switch	NOUN
abc-4026	8	14	,	,	PUNCT
abc-4026	8	15	prioritizing	prioritize	VERB
abc-4026	8	16	the	the	DET
abc-4026	8	17	photosynthetic	photosynthetic	ADJ
abc-4026	8	18	electron	electron	NOUN
abc-4026	8	19	destination	destination	NOUN
abc-4026	8	20	sinks	sink	NOUN
abc-4026	8	21	according	accord	VERB
abc-4026	8	22	to	to	ADP
abc-4026	8	23	the	the	DET
abc-4026	8	24	organellar	organellar	ADJ
abc-4026	8	25	needs	need	NOUN
abc-4026	8	26	.	.	PUNCT
abc-4026	9	1	the	the	DET
abc-4026	9	2	role	role	NOUN
abc-4026	9	3	of	of	ADP
abc-4026	9	4	trol	trol	NOUN
abc-4026	9	5	in	in	ADP
abc-4026	9	6	the	the	DET
abc-4026	9	7	chloroplast	chloroplast	ADJ
abc-4026	9	8	inner	inner	ADJ
abc-4026	9	9	envelope	envelope	NOUN
abc-4026	9	10	membrane	membrane	NOUN
abc-4026	9	11	is	be	AUX
abc-4026	9	12	,	,	PUNCT
abc-4026	9	13	however	however	ADV
abc-4026	9	14	,	,	PUNCT
abc-4026	9	15	presently	presently	ADV
abc-4026	9	16	unknown	unknown	ADJ
abc-4026	9	17	.	.	PUNCT
abc-4026	10	1	by	by	ADP
abc-4026	10	2	engineering	engineer	VERB
abc-4026	10	3	the	the	DET
abc-4026	10	4	presequence	presequence	NOUN
abc-4026	10	5	protease	protease	NOUN
abc-4026	10	6	processing	processing	NOUN
abc-4026	10	7	site	site	NOUN
abc-4026	10	8	,	,	PUNCT
abc-4026	10	9	a	a	DET
abc-4026	10	10	single	single	ADJ
abc-4026	10	11	amino	amino	NOUN
abc-4026	10	12	acid	acid	NOUN
abc-4026	10	13	exchange	exchange	NOUN
abc-4026	10	14	of	of	ADP
abc-4026	10	15	ala67	ala67	NOUN
abc-4026	10	16	to	to	ADP
abc-4026	10	17	ile67	ile67	PROPN
abc-4026	10	18	has	have	AUX
abc-4026	10	19	been	be	AUX
abc-4026	10	20	introduced	introduce	VERB
abc-4026	10	21	to	to	ADP
abc-4026	10	22	trol	trol	NOUN
abc-4026	10	23	,	,	PUNCT
abc-4026	10	24	leading	lead	VERB
abc-4026	10	25	to	to	ADP
abc-4026	10	26	inhibited	inhibit	VERB
abc-4026	10	27	cleavage	cleavage	NOUN
abc-4026	10	28	of	of	ADP
abc-4026	10	29	the	the	DET
abc-4026	10	30	presequence	presequence	NOUN
abc-4026	10	31	and	and	CCONJ
abc-4026	10	32	resulting	result	VERB
abc-4026	10	33	in	in	ADP
abc-4026	10	34	protein	protein	NOUN
abc-4026	10	35	incorporation	incorporation	NOUN
abc-4026	10	36	at	at	ADP
abc-4026	10	37	the	the	DET
abc-4026	10	38	inner	inner	ADJ
abc-4026	10	39	envelope	envelope	NOUN
abc-4026	10	40	membrane	membrane	NOUN
abc-4026	10	41	.	.	PUNCT
abc-4026	11	1	in	in	ADP
abc-4026	11	2	this	this	DET
abc-4026	11	3	work	work	NOUN
abc-4026	11	4	,	,	PUNCT
abc-4026	11	5	we	we	PRON
abc-4026	11	6	engineered	engineer	VERB
abc-4026	11	7	the	the	DET
abc-4026	11	8	arabidopsis	arabidopsis	NOUN
abc-4026	11	9	mutant	mutant	ADJ
abc-4026	11	10	plants	plant	NOUN
abc-4026	11	11	that	that	PRON
abc-4026	11	12	contain	contain	VERB
abc-4026	11	13	trol	trol	NOUN
abc-4026	11	14	almost	almost	ADV
abc-4026	11	15	exclusively	exclusively	ADV
abc-4026	11	16	in	in	ADP
abc-4026	11	17	the	the	DET
abc-4026	11	18	inner	inner	ADJ
abc-4026	11	19	envelope	envelope	NOUN
abc-4026	11	20	membrane	membrane	NOUN
abc-4026	11	21	(	(	PUNCT
abc-4026	11	22	trol	trol	NOUN
abc-4026	11	23	-	-	PUNCT
abc-4026	11	24	ie	ie	X
abc-4026	11	25	)	)	PUNCT
abc-4026	11	26	.	.	PUNCT
abc-4026	12	1	to	to	PART
abc-4026	12	2	facilitate	facilitate	VERB
abc-4026	12	3	studying	study	VERB
abc-4026	12	4	the	the	DET
abc-4026	12	5	role	role	NOUN
abc-4026	12	6	of	of	ADP
abc-4026	12	7	this	this	DET
abc-4026	12	8	protein	protein	NOUN
abc-4026	12	9	in	in	ADP
abc-4026	12	10	this	this	DET
abc-4026	12	11	chloroplast	chloroplast	NOUN
abc-4026	12	12	compartment	compartment	NOUN
abc-4026	12	13	,	,	PUNCT
abc-4026	12	14	we	we	PRON
abc-4026	12	15	also	also	ADV
abc-4026	12	16	produced	produce	VERB
abc-4026	12	17	the	the	DET
abc-4026	12	18	antiserum	antiserum	NOUN
abc-4026	12	19	specific	specific	NOUN
abc-4026	12	20	for	for	ADP
abc-4026	12	21	the	the	DET
abc-4026	12	22	ie	ie	ADJ
abc-4026	12	23	form	form	NOUN
abc-4026	12	24	of	of	ADP
abc-4026	12	25	the	the	DET
abc-4026	12	26	trol	trol	NOUN
abc-4026	12	27	.	.	PUNCT
abc-4026	13	1	keywords	keyword	NOUN
abc-4026	13	2	:	:	PUNCT
abc-4026	13	3	dual	dual	ADJ
abc-4026	13	4	localization	localization	NOUN
abc-4026	13	5	,	,	PUNCT
abc-4026	13	6	inner	inner	ADJ
abc-4026	13	7	envelope	envelope	NOUN
abc-4026	13	8	membrane	membrane	NOUN
abc-4026	13	9	,	,	PUNCT
abc-4026	13	10	mutagenesis	mutagenesis	NOUN
abc-4026	13	11	,	,	PUNCT
abc-4026	13	12	photosynthesis	photosynthesis	NOUN
abc-4026	13	13	,	,	PUNCT
abc-4026	13	14	presequence	presequence	NOUN
abc-4026	13	15	processing	processing	NOUN
abc-4026	13	16	,	,	PUNCT
abc-4026	13	17	thylakoids	thylakoid	NOUN
abc-4026	13	18	introduction	introduction	NOUN
abc-4026	13	19	photosynthesis	photosynthesis	NOUN
abc-4026	13	20	is	be	AUX
abc-4026	13	21	an	an	DET
abc-4026	13	22	essential	essential	ADJ
abc-4026	13	23	energy	energy	NOUN
abc-4026	13	24	-	-	PUNCT
abc-4026	13	25	converting	convert	VERB
abc-4026	13	26	process	process	NOUN
abc-4026	13	27	for	for	ADP
abc-4026	13	28	producing	produce	VERB
abc-4026	13	29	complex	complex	ADJ
abc-4026	13	30	carbohydrates	carbohydrate	NOUN
abc-4026	13	31	and	and	CCONJ
abc-4026	13	32	sustaining	sustain	VERB
abc-4026	13	33	oxygenic	oxygenic	ADJ
abc-4026	13	34	life	life	NOUN
abc-4026	13	35	on	on	ADP
abc-4026	13	36	earth	earth	NOUN
abc-4026	13	37	by	by	ADP
abc-4026	13	38	releasing	release	VERB
abc-4026	13	39	molecular	molecular	ADJ
abc-4026	13	40	oxygen	oxygen	NOUN
abc-4026	13	41	.	.	PUNCT
abc-4026	14	1	it	it	PRON
abc-4026	14	2	involves	involve	VERB
abc-4026	14	3	light	light	ADJ
abc-4026	14	4	reactions	reaction	NOUN
abc-4026	14	5	taking	take	VERB
abc-4026	14	6	place	place	NOUN
abc-4026	14	7	in	in	ADP
abc-4026	14	8	the	the	DET
abc-4026	14	9	thylakoid	thylakoid	ADJ
abc-4026	14	10	membranes	membrane	NOUN
abc-4026	14	11	,	,	PUNCT
abc-4026	14	12	and	and	CCONJ
abc-4026	14	13	carbon	carbon	NOUN
abc-4026	14	14	fixation	fixation	NOUN
abc-4026	14	15	reactions	reaction	NOUN
abc-4026	14	16	in	in	ADP
abc-4026	14	17	chloroplast	chloroplast	ADJ
abc-4026	14	18	stroma	stroma	NOUN
abc-4026	14	19	.	.	PUNCT
abc-4026	15	1	photosynthetic	photosynthetic	ADJ
abc-4026	15	2	charge	charge	NOUN
abc-4026	15	3	separation	separation	NOUN
abc-4026	15	4	,	,	PUNCT
abc-4026	15	5	electron	electron	NOUN
abc-4026	15	6	transfer	transfer	NOUN
abc-4026	15	7	,	,	PUNCT
abc-4026	15	8	and	and	CCONJ
abc-4026	15	9	redox	redox	ADJ
abc-4026	15	10	reactions	reaction	NOUN
abc-4026	15	11	,	,	PUNCT
abc-4026	15	12	in	in	ADP
abc-4026	15	13	synchrony	synchrony	NOUN
abc-4026	15	14	,	,	PUNCT
abc-4026	15	15	generate	generate	VERB
abc-4026	15	16	the	the	DET
abc-4026	15	17	proton	proton	NOUN
abc-4026	15	18	motive	motive	NOUN
abc-4026	15	19	force	force	NOUN
abc-4026	15	20	necessary	necessary	ADJ
abc-4026	15	21	for	for	ADP
abc-4026	15	22	the	the	DET
abc-4026	15	23	synthesis	synthesis	NOUN
abc-4026	15	24	of	of	ADP
abc-4026	15	25	adenosine	adenosine	ADJ
abc-4026	15	26	triphosphate	triphosphate	NOUN
abc-4026	15	27	(	(	PUNCT
abc-4026	15	28	atp	atp	PROPN
abc-4026	15	29	)	)	PUNCT
abc-4026	15	30	and	and	CCONJ
abc-4026	15	31	directing	direct	VERB
abc-4026	15	32	electrons	electron	NOUN
abc-4026	15	33	towards	towards	ADP
abc-4026	15	34	the	the	DET
abc-4026	15	35	production	production	NOUN
abc-4026	15	36	of	of	ADP
abc-4026	15	37	stromal	stromal	ADJ
abc-4026	15	38	reducing	reduce	VERB
abc-4026	15	39	equivalent	equivalent	ADJ
abc-4026	15	40	nicotinamide	nicotinamide	NOUN
abc-4026	15	41	adenine	adenine	ADJ
abc-4026	15	42	dinucleotide	dinucleotide	NOUN
abc-4026	15	43	phosphate	phosphate	NOUN
abc-4026	15	44	(	(	PUNCT
abc-4026	15	45	nadph	nadph	ADJ
abc-4026	15	46	)	)	PUNCT
abc-4026	15	47	.	.	PUNCT
abc-4026	16	1	the	the	DET
abc-4026	16	2	transport	transport	NOUN
abc-4026	16	3	of	of	ADP
abc-4026	16	4	photosynthetic	photosynthetic	ADJ
abc-4026	16	5	electrons	electron	NOUN
abc-4026	16	6	terminates	terminate	VERB
abc-4026	16	7	at	at	ADP
abc-4026	16	8	the	the	DET
abc-4026	16	9	stromal	stromal	ADJ
abc-4026	16	10	side	side	NOUN
abc-4026	16	11	of	of	ADP
abc-4026	16	12	photosystem	photosystem	NOUN
abc-4026	16	13	i	i	PRON
abc-4026	16	14	(	(	PUNCT
abc-4026	16	15	psi	psi	PROPN
abc-4026	16	16	)	)	PUNCT
abc-4026	16	17	,	,	PUNCT
abc-4026	16	18	where	where	SCONJ
abc-4026	16	19	the	the	DET
abc-4026	16	20	electrons	electron	NOUN
abc-4026	16	21	are	be	AUX
abc-4026	16	22	being	be	AUX
abc-4026	16	23	primarily	primarily	ADV
abc-4026	16	24	handed	hand	VERB
abc-4026	16	25	over	over	ADP
abc-4026	16	26	from	from	ADP
abc-4026	16	27	reduced	reduce	VERB
abc-4026	16	28	ferredoxin	ferredoxin	ADJ
abc-4026	16	29	(	(	PUNCT
abc-4026	16	30	fd	fd	PROPN
abc-4026	16	31	)	)	PUNCT
abc-4026	16	32	to	to	AUX
abc-4026	16	33	ferredoxin	ferredoxin	ADJ
abc-4026	16	34	:	:	PUNCT
abc-4026	16	35	nadp+	nadp+	X
abc-4026	16	36	oxidoreductase	oxidoreductase	PROPN
abc-4026	16	37	(	(	PUNCT
abc-4026	16	38	fnr	fnr	PROPN
abc-4026	16	39	)	)	PUNCT
abc-4026	16	40	.	.	PUNCT
abc-4026	17	1	although	although	SCONJ
abc-4026	17	2	in	in	ADP
abc-4026	17	3	chloroplasts	chloroplast	NOUN
abc-4026	17	4	the	the	DET
abc-4026	17	5	main	main	ADJ
abc-4026	17	6	sink	sink	NOUN
abc-4026	17	7	for	for	ADP
abc-4026	17	8	electrons	electron	NOUN
abc-4026	17	9	from	from	ADP
abc-4026	17	10	ferredoxin	ferredoxin	NOUN
abc-4026	17	11	is	be	AUX
abc-4026	17	12	nadph	nadph	ADJ
abc-4026	17	13	,	,	PUNCT
abc-4026	17	14	depending	depend	VERB
abc-4026	17	15	on	on	ADP
abc-4026	17	16	the	the	DET
abc-4026	17	17	organelle	organelle	NOUN
abc-4026	17	18	needs	need	NOUN
abc-4026	17	19	,	,	PUNCT
abc-4026	17	20	other	other	ADJ
abc-4026	17	21	stromal	stromal	ADJ
abc-4026	17	22	acceptors	acceptor	NOUN
abc-4026	17	23	can	can	AUX
abc-4026	17	24	receive	receive	VERB
abc-4026	17	25	photosynthetic	photosynthetic	ADJ
abc-4026	17	26	electrons	electron	NOUN
abc-4026	17	27	as	as	ADV
abc-4026	17	28	well	well	ADV
abc-4026	17	29	.	.	PUNCT
abc-4026	18	1	such	such	ADJ
abc-4026	18	2	acceptors	acceptor	NOUN
abc-4026	18	3	are	be	AUX
abc-4026	18	4	oxygen	oxygen	NOUN
abc-4026	18	5	in	in	ADP
abc-4026	18	6	pseudocyclic	pseudocyclic	PROPN
abc-4026	18	7	electron	electron	NOUN
abc-4026	18	8	transport	transport	NOUN
abc-4026	18	9	(	(	PUNCT
abc-4026	18	10	allen	allen	NOUN
abc-4026	18	11	2003	2003	NUM
abc-4026	18	12	)	)	PUNCT
abc-4026	18	13	,	,	PUNCT
abc-4026	18	14	ferredoxin	ferredoxin	NOUN
abc-4026	18	15	-	-	PUNCT
abc-4026	18	16	thioredoxin	thioredoxin	PROPN
abc-4026	18	17	reductase	reductase	NOUN
abc-4026	18	18	,	,	PUNCT
abc-4026	18	19	which	which	PRON
abc-4026	18	20	is	be	AUX
abc-4026	18	21	important	important	ADJ
abc-4026	18	22	for	for	ADP
abc-4026	18	23	the	the	DET
abc-4026	18	24	regulation	regulation	NOUN
abc-4026	18	25	of	of	ADP
abc-4026	18	26	carbon	carbon	NOUN
abc-4026	18	27	assimilation	assimilation	NOUN
abc-4026	18	28	(	(	PUNCT
abc-4026	18	29	buchanan	buchanan	PROPN
abc-4026	18	30	and	and	CCONJ
abc-4026	18	31	balmer	balmer	PROPN
abc-4026	18	32	2005	2005	NUM
abc-4026	18	33	)	)	PUNCT
abc-4026	18	34	,	,	PUNCT
abc-4026	18	35	nitrogen	nitrogen	NOUN
abc-4026	18	36	and	and	CCONJ
abc-4026	18	37	sulfur	sulfur	NOUN
abc-4026	18	38	assimilation	assimilation	NOUN
abc-4026	18	39	reactions	reaction	NOUN
abc-4026	18	40	,	,	PUNCT
abc-4026	18	41	the	the	DET
abc-4026	18	42	biosynthesis	biosynthesis	NOUN
abc-4026	18	43	of	of	ADP
abc-4026	18	44	chlorophyll	chlorophyll	NOUN
abc-4026	18	45	,	,	PUNCT
abc-4026	18	46	phytochrome	phytochrome	NOUN
abc-4026	18	47	and	and	CCONJ
abc-4026	18	48	fatty	fatty	NOUN
abc-4026	18	49	acids	acid	NOUN
abc-4026	18	50	(	(	PUNCT
abc-4026	18	51	hanke	hanke	NOUN
abc-4026	18	52	and	and	CCONJ
abc-4026	18	53	mulo	mulo	NOUN
abc-4026	18	54	2013	2013	NUM
abc-4026	18	55	)	)	PUNCT
abc-4026	18	56	.	.	PUNCT
abc-4026	19	1	cyclic	cyclic	ADJ
abc-4026	19	2	electron	electron	NOUN
abc-4026	19	3	transport	transport	NOUN
abc-4026	19	4	(	(	PUNCT
abc-4026	19	5	cet	cet	PROPN
abc-4026	19	6	)	)	PUNCT
abc-4026	19	7	around	around	ADP
abc-4026	19	8	photosystem	photosystem	NOUN
abc-4026	19	9	i	i	PRON
abc-4026	19	10	,	,	PUNCT
abc-4026	19	11	where	where	SCONJ
abc-4026	19	12	the	the	DET
abc-4026	19	13	electrons	electron	NOUN
abc-4026	19	14	are	be	AUX
abc-4026	19	15	returned	return	VERB
abc-4026	19	16	from	from	ADP
abc-4026	19	17	ps	ps	PROPN
abc-4026	19	18	i	i	PRON
abc-4026	19	19	to	to	ADP
abc-4026	19	20	the	the	DET
abc-4026	19	21	cytochrome	cytochrome	NOUN
abc-4026	19	22	b6f	b6f	NOUN
abc-4026	19	23	complex	complex	ADJ
abc-4026	19	24	(	(	PUNCT
abc-4026	19	25	joliot	joliot	NOUN
abc-4026	19	26	and	and	CCONJ
abc-4026	19	27	joliot	joliot	NOUN
abc-4026	19	28	2006	2006	NUM
abc-4026	19	29	)	)	PUNCT
abc-4026	19	30	is	be	AUX
abc-4026	19	31	also	also	ADV
abc-4026	19	32	possible	possible	ADJ
abc-4026	19	33	.	.	PUNCT
abc-4026	20	1	the	the	DET
abc-4026	20	2	important	important	ADJ
abc-4026	20	3	regulator	regulator	NOUN
abc-4026	20	4	of	of	ADP
abc-4026	20	5	this	this	DET
abc-4026	20	6	final	final	ADJ
abc-4026	20	7	linear	linear	NOUN
abc-4026	20	8	electron	electron	NOUN
abc-4026	20	9	transfer	transfer	NOUN
abc-4026	20	10	step	step	NOUN
abc-4026	20	11	is	be	AUX
abc-4026	20	12	the	the	DET
abc-4026	20	13	thylakoid	thylakoid	ADJ
abc-4026	20	14	-	-	PUNCT
abc-4026	20	15	membrane	membrane	NOUN
abc-4026	20	16	incorporated	incorporate	VERB
abc-4026	20	17	thylakoid	thylakoid	ADJ
abc-4026	20	18	rhodanese	rhodanese	ADJ
abc-4026	20	19	-	-	PUNCT
abc-4026	20	20	like	like	ADJ
abc-4026	20	21	protein	protein	NOUN
abc-4026	20	22	(	(	PUNCT
abc-4026	20	23	trol	trol	NOUN
abc-4026	20	24	)	)	PUNCT
abc-4026	20	25	that	that	PRON
abc-4026	20	26	interacts	interact	VERB
abc-4026	20	27	with	with	ADP
abc-4026	20	28	the	the	DET
abc-4026	20	29	fnr	fnr	NOUN
abc-4026	20	30	by	by	ADP
abc-4026	20	31	dynamic	dynamic	ADJ
abc-4026	20	32	tethering	tethering	NOUN
abc-4026	20	33	(	(	PUNCT
abc-4026	20	34	vojta	vojta	NOUN
abc-4026	20	35	et	et	PROPN
abc-4026	20	36	al	al	PROPN
abc-4026	20	37	.	.	PROPN
abc-4026	20	38	2012	2012	NUM
abc-4026	20	39	,	,	PUNCT
abc-4026	20	40	vojta	vojta	NOUN
abc-4026	20	41	and	and	CCONJ
abc-4026	20	42	fulgosi	fulgosi	NOUN
abc-4026	20	43	2012	2012	NUM
abc-4026	20	44	,	,	PUNCT
abc-4026	20	45	vojta	vojta	NOUN
abc-4026	20	46	and	and	CCONJ
abc-4026	20	47	fulgosi	fulgosi	NOUN
abc-4026	20	48	2016	2016	NUM
abc-4026	20	49	,	,	PUNCT
abc-4026	20	50	kekić	kekić	PROPN
abc-4026	20	51	et	et	PROPN
abc-4026	20	52	al	al	PROPN
abc-4026	20	53	.	.	PROPN
abc-4026	20	54	2020	2020	NUM
abc-4026	20	55	)	)	PUNCT
abc-4026	20	56	,	,	PUNCT
abc-4026	20	57	and	and	CCONJ
abc-4026	20	58	consequently	consequently	ADV
abc-4026	20	59	influences	influence	VERB
abc-4026	20	60	the	the	DET
abc-4026	20	61	end	end	NOUN
abc-4026	20	62	point	point	NOUN
abc-4026	20	63	of	of	ADP
abc-4026	20	64	photosynthetically	photosynthetically	ADJ
abc-4026	20	65	derived	derive	VERB
abc-4026	20	66	electrons	electron	NOUN
abc-4026	20	67	.	.	PUNCT
abc-4026	21	1	trol	trol	PROPN
abc-4026	21	2	contains	contain	VERB
abc-4026	21	3	the	the	DET
abc-4026	21	4	binding	bind	VERB
abc-4026	21	5	region	region	NOUN
abc-4026	21	6	for	for	ADP
abc-4026	21	7	the	the	DET
abc-4026	21	8	fnr	fnr	PROPN
abc-4026	21	9	(	(	PUNCT
abc-4026	21	10	jurić	jurić	VERB
abc-4026	21	11	et	et	PROPN
abc-4026	21	12	al	al	PROPN
abc-4026	21	13	.	.	PROPN
abc-4026	21	14	2009	2009	NUM
abc-4026	21	15	,	,	PUNCT
abc-4026	21	16	kekić	kekić	PROPN
abc-4026	21	17	et	et	PROPN
abc-4026	21	18	al	al	PROPN
abc-4026	21	19	.	.	PROPN
abc-4026	21	20	2020	2020	NUM
abc-4026	21	21	)	)	PUNCT
abc-4026	21	22	and	and	CCONJ
abc-4026	21	23	seems	seem	VERB
abc-4026	21	24	to	to	PART
abc-4026	21	25	be	be	AUX
abc-4026	21	26	the	the	DET
abc-4026	21	27	exclusive	exclusive	ADJ
abc-4026	21	28	docking	docking	NOUN
abc-4026	21	29	site	site	NOUN
abc-4026	21	30	for	for	ADP
abc-4026	21	31	this	this	DET
abc-4026	21	32	protein	protein	NOUN
abc-4026	21	33	(	(	PUNCT
abc-4026	21	34	mckenzie	mckenzie	NOUN
abc-4026	21	35	et	et	PROPN
abc-4026	21	36	al	al	PROPN
abc-4026	21	37	.	.	PROPN
abc-4026	21	38	2020	2020	NUM
abc-4026	21	39	)	)	PUNCT
abc-4026	21	40	.	.	PUNCT
abc-4026	22	1	however	however	ADV
abc-4026	22	2	,	,	PUNCT
abc-4026	22	3	it	it	PRON
abc-4026	22	4	has	have	AUX
abc-4026	22	5	been	be	AUX
abc-4026	22	6	shown	show	VERB
abc-4026	22	7	that	that	SCONJ
abc-4026	22	8	trol	trol	NOUN
abc-4026	22	9	is	be	AUX
abc-4026	22	10	not	not	PART
abc-4026	22	11	essential	essential	ADJ
abc-4026	22	12	for	for	ADP
abc-4026	22	13	arabidopsis	arabidopsis	NOUN
abc-4026	22	14	growth	growth	NOUN
abc-4026	22	15	and	and	CCONJ
abc-4026	22	16	development	development	NOUN
abc-4026	22	17	(	(	PUNCT
abc-4026	22	18	jurić	jurić	VERB
abc-4026	22	19	et	et	PROPN
abc-4026	22	20	al	al	PROPN
abc-4026	22	21	.	.	PROPN
abc-4026	22	22	2009	2009	NUM
abc-4026	22	23	,	,	PUNCT
abc-4026	22	24	vojta	vojta	NOUN
abc-4026	22	25	et	et	PROPN
abc-4026	22	26	al	al	PROPN
abc-4026	22	27	.	.	PROPN
abc-4026	22	28	2015	2015	NUM
abc-4026	22	29	)	)	PUNCT
abc-4026	22	30	.	.	PUNCT
abc-4026	23	1	in	in	ADP
abc-4026	23	2	trol	trol	NOUN
abc-4026	23	3	knock	knock	NOUN
abc-4026	23	4	-	-	PUNCT
abc-4026	23	5	out	out	NOUN
abc-4026	23	6	(	(	PUNCT
abc-4026	23	7	ko	ko	PROPN
abc-4026	23	8	)	)	PUNCT
abc-4026	23	9	mutants	mutant	NOUN
abc-4026	23	10	,	,	PUNCT
abc-4026	23	11	because	because	SCONJ
abc-4026	23	12	there	there	PRON
abc-4026	23	13	is	be	VERB
abc-4026	23	14	no	no	DET
abc-4026	23	15	trol	trol	NOUN
abc-4026	23	16	to	to	PART
abc-4026	23	17	dock	dock	PROPN
abc-4026	23	18	fnr	fnr	PROPN
abc-4026	23	19	,	,	PUNCT
abc-4026	23	20	the	the	DET
abc-4026	23	21	photosynthetic	photosynthetic	ADJ
abc-4026	23	22	electron	electron	NOUN
abc-4026	23	23	transfer	transfer	NOUN
abc-4026	23	24	is	be	AUX
abc-4026	23	25	not	not	PART
abc-4026	23	26	primarily	primarily	ADV
abc-4026	23	27	directed	direct	VERB
abc-4026	23	28	to	to	ADP
abc-4026	23	29	the	the	DET
abc-4026	23	30	production	production	NOUN
abc-4026	23	31	of	of	ADP
abc-4026	23	32	*	*	PUNCT
abc-4026	23	33	corresponding	correspond	VERB
abc-4026	23	34	author	author	NOUN
abc-4026	23	35	e	e	NOUN
abc-4026	23	36	-	-	NOUN
abc-4026	23	37	mail	mail	NOUN
abc-4026	23	38	:	:	PUNCT
abc-4026	23	39	lvojta@irb.hr	lvojta@irb.hr	PROPN
abc-4026	23	40	mailto:lvojta@irb.hr	mailto:lvojta@irb.hr	PROPN
abc-4026	23	41	dual	dual	ADJ
abc-4026	23	42	to	to	ADP
abc-4026	23	43	single	single	ADJ
abc-4026	23	44	localization	localization	NOUN
abc-4026	23	45	exchange	exchange	NOUN
abc-4026	23	46	of	of	ADP
abc-4026	23	47	trol	trol	NOUN
abc-4026	23	48	protein	protein	NOUN
abc-4026	23	49	acta	acta	PROPN
abc-4026	23	50	bot	bot	PROPN
abc-4026	23	51	.	.	PUNCT
abc-4026	24	1	croat	croat	PROPN
abc-4026	24	2	.	.	PUNCT
abc-4026	25	1	84	84	NUM
abc-4026	25	2	(	(	PUNCT
abc-4026	25	3	2	2	NUM
abc-4026	25	4	)	)	PUNCT
abc-4026	25	5	,	,	PUNCT
abc-4026	25	6	2025	2025	NUM
abc-4026	25	7	257	257	NUM
abc-4026	25	8	nadph	nadph	NOUN
abc-4026	25	9	,	,	PUNCT
abc-4026	25	10	which	which	PRON
abc-4026	25	11	is	be	AUX
abc-4026	25	12	an	an	DET
abc-4026	25	13	electron	electron	NOUN
abc-4026	25	14	donor	donor	NOUN
abc-4026	25	15	for	for	ADP
abc-4026	25	16	the	the	DET
abc-4026	25	17	calvin	calvin	PROPN
abc-4026	25	18	-	-	PUNCT
abc-4026	25	19	benson	benson	PROPN
abc-4026	25	20	cycle	cycle	NOUN
abc-4026	25	21	,	,	PUNCT
abc-4026	25	22	but	but	CCONJ
abc-4026	25	23	other	other	ADJ
abc-4026	25	24	electron	electron	NOUN
abc-4026	25	25	acceptors	acceptor	NOUN
abc-4026	25	26	are	be	AUX
abc-4026	25	27	more	more	ADV
abc-4026	25	28	likely	likely	ADJ
abc-4026	25	29	to	to	PART
abc-4026	25	30	receive	receive	VERB
abc-4026	25	31	the	the	DET
abc-4026	25	32	produced	produce	VERB
abc-4026	25	33	electrons	electron	NOUN
abc-4026	25	34	.	.	PUNCT
abc-4026	26	1	such	such	ADJ
abc-4026	26	2	acceptors	acceptor	NOUN
abc-4026	26	3	are	be	AUX
abc-4026	26	4	nitrite	nitrite	NOUN
abc-4026	26	5	reductase	reductase	NOUN
abc-4026	26	6	,	,	PUNCT
abc-4026	26	7	sulfite	sulfite	NOUN
abc-4026	26	8	reduc	reduc	PROPN
abc-4026	26	9	tase	tase	NOUN
abc-4026	26	10	,	,	PUNCT
abc-4026	26	11	fatty	fatty	NOUN
abc-4026	26	12	acid	acid	NOUN
abc-4026	26	13	desaturase	desaturase	NOUN
abc-4026	26	14	,	,	PUNCT
abc-4026	26	15	glutamine-2	glutamine-2	PROPN
abc-4026	26	16	-	-	ADJ
abc-4026	26	17	oxoglutarate	oxoglutarate	ADJ
abc-4026	26	18	amino	amino	NOUN
abc-4026	26	19	transferase	transferase	NOUN
abc-4026	26	20	,	,	PUNCT
abc-4026	26	21	and	and	CCONJ
abc-4026	26	22	ferredoxin	ferredoxin	NOUN
abc-4026	26	23	-	-	PUNCT
abc-4026	26	24	thioredoxin	thioredoxin	PROPN
abc-4026	26	25	reductase	reductase	NOUN
abc-4026	26	26	(	(	PUNCT
abc-4026	26	27	ftr	ftr	PROPN
abc-4026	26	28	)	)	PUNCT
abc-4026	26	29	.	.	PUNCT
abc-4026	27	1	the	the	DET
abc-4026	27	2	ftr	ftr	PROPN
abc-4026	27	3	pathway	pathway	NOUN
abc-4026	27	4	constitutes	constitute	VERB
abc-4026	27	5	an	an	DET
abc-4026	27	6	indispensable	indispensable	ADJ
abc-4026	27	7	redox	redox	NOUN
abc-4026	27	8	-	-	PUNCT
abc-4026	27	9	signaling	signal	VERB
abc-4026	27	10	cascade	cascade	NOUN
abc-4026	27	11	for	for	ADP
abc-4026	27	12	light	light	ADJ
abc-4026	27	13	-	-	PUNCT
abc-4026	27	14	dependent	dependent	ADJ
abc-4026	27	15	reduction	reduction	NOUN
abc-4026	27	16	of	of	ADP
abc-4026	27	17	chloroplast	chloroplast	ADJ
abc-4026	27	18	stromal	stromal	ADJ
abc-4026	27	19	proteins	protein	NOUN
abc-4026	27	20	(	(	PUNCT
abc-4026	27	21	yoshida	yoshida	PROPN
abc-4026	27	22	et	et	PROPN
abc-4026	27	23	al	al	PROPN
abc-4026	27	24	.	.	PROPN
abc-4026	27	25	2022	2022	NUM
abc-4026	27	26	)	)	PUNCT
abc-4026	27	27	.	.	PUNCT
abc-4026	28	1	fnr	fnr	PROPN
abc-4026	28	2	may	may	AUX
abc-4026	28	3	also	also	ADV
abc-4026	28	4	act	act	VERB
abc-4026	28	5	as	as	ADP
abc-4026	28	6	the	the	DET
abc-4026	28	7	direct	direct	ADJ
abc-4026	28	8	ferredoxin	ferredoxin	NOUN
abc-4026	28	9	:	:	PUNCT
abc-4026	28	10	plastoquinone	plastoquinone	NOUN
abc-4026	28	11	reductase	reductase	NOUN
abc-4026	28	12	(	(	PUNCT
abc-4026	28	13	fd	fd	PROPN
abc-4026	28	14	:	:	PUNCT
abc-4026	28	15	pq	pq	NOUN
abc-4026	28	16	)	)	PUNCT
abc-4026	28	17	,	,	PUNCT
abc-4026	28	18	establishing	establish	VERB
abc-4026	28	19	redox	redox	ADJ
abc-4026	28	20	regulation	regulation	NOUN
abc-4026	28	21	and	and	CCONJ
abc-4026	28	22	antioxidant	antioxidant	ADJ
abc-4026	28	23	defense	defense	NOUN
abc-4026	28	24	point	point	NOUN
abc-4026	28	25	(	(	PUNCT
abc-4026	28	26	jurić	jurić	VERB
abc-4026	28	27	et	et	PROPN
abc-4026	28	28	al	al	PROPN
abc-4026	28	29	.	.	PROPN
abc-4026	28	30	2013	2013	NUM
abc-4026	28	31	)	)	PUNCT
abc-4026	28	32	.	.	PUNCT
abc-4026	29	1	therefore	therefore	ADV
abc-4026	29	2	,	,	PUNCT
abc-4026	29	3	in	in	ADP
abc-4026	29	4	the	the	DET
abc-4026	29	5	absence	absence	NOUN
abc-4026	29	6	of	of	ADP
abc-4026	29	7	trol	trol	NOUN
abc-4026	29	8	,	,	PUNCT
abc-4026	29	9	the	the	DET
abc-4026	29	10	distribution	distribution	NOUN
abc-4026	29	11	of	of	ADP
abc-4026	29	12	high	high	ADJ
abc-4026	29	13	-	-	PUNCT
abc-4026	29	14	energy	energy	NOUN
abc-4026	29	15	electrons	electron	NOUN
abc-4026	29	16	is	be	AUX
abc-4026	29	17	directed	direct	VERB
abc-4026	29	18	towards	towards	ADP
abc-4026	29	19	ros	ros	PROPN
abc-4026	29	20	scavenging	scavenge	VERB
abc-4026	29	21	pathways	pathway	NOUN
abc-4026	29	22	,	,	PUNCT
abc-4026	29	23	rather	rather	ADV
abc-4026	29	24	than	than	ADP
abc-4026	29	25	to	to	ADP
abc-4026	29	26	the	the	DET
abc-4026	29	27	nadp+	nadp+	NOUN
abc-4026	29	28	reduction	reduction	NOUN
abc-4026	29	29	(	(	PUNCT
abc-4026	29	30	vojta	vojta	NOUN
abc-4026	29	31	et	et	PROPN
abc-4026	29	32	al	al	PROPN
abc-4026	29	33	.	.	PROPN
abc-4026	29	34	2015	2015	NUM
abc-4026	29	35	)	)	PUNCT
abc-4026	29	36	.	.	PUNCT
abc-4026	30	1	trol	trol	PROPN
abc-4026	30	2	ko	ko	PROPN
abc-4026	30	3	plants	plant	NOUN
abc-4026	30	4	show	show	VERB
abc-4026	30	5	increased	increase	VERB
abc-4026	30	6	stress	stress	NOUN
abc-4026	30	7	resistance	resistance	NOUN
abc-4026	30	8	along	along	ADP
abc-4026	30	9	with	with	ADP
abc-4026	30	10	significantly	significantly	ADV
abc-4026	30	11	enhanced	enhance	VERB
abc-4026	30	12	ros	ros	PROPN
abc-4026	30	13	scavenging	scavenging	NOUN
abc-4026	30	14	(	(	PUNCT
abc-4026	30	15	vojta	vojta	NOUN
abc-4026	30	16	et	et	PROPN
abc-4026	30	17	al	al	PROPN
abc-4026	30	18	.	.	PROPN
abc-4026	30	19	2015	2015	NUM
abc-4026	30	20	)	)	PUNCT
abc-4026	30	21	.	.	PUNCT
abc-4026	31	1	also	also	ADV
abc-4026	31	2	,	,	PUNCT
abc-4026	31	3	the	the	DET
abc-4026	31	4	absence	absence	NOUN
abc-4026	31	5	of	of	ADP
abc-4026	31	6	trol	trol	NOUN
abc-4026	31	7	leads	lead	VERB
abc-4026	31	8	to	to	ADP
abc-4026	31	9	the	the	DET
abc-4026	31	10	complete	complete	ADJ
abc-4026	31	11	loss	loss	NOUN
abc-4026	31	12	of	of	ADP
abc-4026	31	13	the	the	DET
abc-4026	31	14	dynamic	dynamic	ADJ
abc-4026	31	15	fnr	fnr	NOUN
abc-4026	31	16	-	-	PUNCT
abc-4026	31	17	binding	bind	VERB
abc-4026	31	18	and	and	CCONJ
abc-4026	31	19	release	release	VERB
abc-4026	31	20	to	to	PART
abc-4026	31	21	/	/	SYM
abc-4026	31	22	from	from	ADP
abc-4026	31	23	the	the	DET
abc-4026	31	24	thylakoid	thylakoid	ADJ
abc-4026	31	25	membrane	membrane	NOUN
abc-4026	31	26	(	(	PUNCT
abc-4026	31	27	vojta	vojta	NOUN
abc-4026	31	28	and	and	CCONJ
abc-4026	31	29	fulgosi	fulgosi	NOUN
abc-4026	31	30	2016	2016	NUM
abc-4026	31	31	)	)	PUNCT
abc-4026	31	32	.	.	PUNCT
abc-4026	32	1	therefore	therefore	ADV
abc-4026	32	2	,	,	PUNCT
abc-4026	32	3	the	the	DET
abc-4026	32	4	trol	trol	PROPN
abc-4026	32	5	-	-	PUNCT
abc-4026	32	6	fnr	fnr	PROPN
abc-4026	32	7	interac	interac	PROPN
abc-4026	32	8	tion	tion	NOUN
abc-4026	32	9	seems	seem	VERB
abc-4026	32	10	to	to	PART
abc-4026	32	11	be	be	AUX
abc-4026	32	12	an	an	DET
abc-4026	32	13	important	important	ADJ
abc-4026	32	14	mechanism	mechanism	NOUN
abc-4026	32	15	for	for	ADP
abc-4026	32	16	the	the	DET
abc-4026	32	17	regulation	regulation	NOUN
abc-4026	32	18	and	and	CCONJ
abc-4026	32	19	prioritization	prioritization	NOUN
abc-4026	32	20	of	of	ADP
abc-4026	32	21	energy	energy	NOUN
abc-4026	32	22	-	-	PUNCT
abc-4026	32	23	conserving	conserve	VERB
abc-4026	32	24	and	and	CCONJ
abc-4026	32	25	energy	energy	NOUN
abc-4026	32	26	dissipating	dissipate	VERB
abc-4026	32	27	pathways	pathway	NOUN
abc-4026	32	28	in	in	ADP
abc-4026	32	29	vascular	vascular	ADJ
abc-4026	32	30	plant	plant	NOUN
abc-4026	32	31	photosynthesis	photosynthesis	NOUN
abc-4026	32	32	(	(	PUNCT
abc-4026	32	33	fulgosi	fulgosi	NOUN
abc-4026	32	34	and	and	CCONJ
abc-4026	32	35	vojta	vojta	NOUN
abc-4026	32	36	2020	2020	NUM
abc-4026	32	37	)	)	PUNCT
abc-4026	32	38	.	.	PUNCT
abc-4026	33	1	recently	recently	ADV
abc-4026	33	2	,	,	PUNCT
abc-4026	33	3	the	the	DET
abc-4026	33	4	topology	topology	NOUN
abc-4026	33	5	of	of	ADP
abc-4026	33	6	trol	trol	NOUN
abc-4026	33	7	has	have	AUX
abc-4026	33	8	been	be	AUX
abc-4026	33	9	investigated	investigate	VERB
abc-4026	33	10	in	in	ADP
abc-4026	33	11	detail	detail	NOUN
abc-4026	33	12	to	to	PART
abc-4026	33	13	define	define	VERB
abc-4026	33	14	the	the	DET
abc-4026	33	15	localization	localization	NOUN
abc-4026	33	16	and	and	CCONJ
abc-4026	33	17	orientations	orientation	NOUN
abc-4026	33	18	of	of	ADP
abc-4026	33	19	its	its	PRON
abc-4026	33	20	domains	domain	NOUN
abc-4026	33	21	(	(	PUNCT
abc-4026	33	22	vojta	vojta	NOUN
abc-4026	33	23	and	and	CCONJ
abc-4026	33	24	fulgosi	fulgosi	NOUN
abc-4026	33	25	2019	2019	NUM
abc-4026	33	26	)	)	PUNCT
abc-4026	33	27	.	.	PUNCT
abc-4026	34	1	trol	trol	PROPN
abc-4026	34	2	spans	span	VERB
abc-4026	34	3	the	the	DET
abc-4026	34	4	thylakoid	thylakoid	ADJ
abc-4026	34	5	membranes	membrane	NOUN
abc-4026	34	6	with	with	ADP
abc-4026	34	7	the	the	DET
abc-4026	34	8	two	two	NUM
abc-4026	34	9	segments	segment	NOUN
abc-4026	34	10	,	,	PUNCT
abc-4026	34	11	one	one	NUM
abc-4026	34	12	at	at	ADP
abc-4026	34	13	the	the	DET
abc-4026	34	14	n	n	NOUN
abc-4026	34	15	-	-	PUNCT
abc-4026	34	16	terminus	terminus	NOUN
abc-4026	34	17	of	of	ADP
abc-4026	34	18	the	the	DET
abc-4026	34	19	protein	protein	NOUN
abc-4026	34	20	and	and	CCONJ
abc-4026	34	21	the	the	DET
abc-4026	34	22	other	other	ADJ
abc-4026	34	23	close	close	ADV
abc-4026	34	24	to	to	ADP
abc-4026	34	25	its	its	PRON
abc-4026	34	26	c	c	NOUN
abc-4026	34	27	-	-	PUNCT
abc-4026	34	28	terminal	terminal	ADJ
abc-4026	34	29	part	part	NOUN
abc-4026	34	30	.	.	PUNCT
abc-4026	35	1	the	the	DET
abc-4026	35	2	c	c	NOUN
abc-4026	35	3	-	-	PUNCT
abc-4026	35	4	terminal	terminal	ADJ
abc-4026	35	5	polyproline	polyproline	NOUN
abc-4026	35	6	(	(	PUNCT
abc-4026	35	7	pepe	pepe	NOUN
abc-4026	35	8	)	)	PUNCT
abc-4026	35	9	domain	domain	NOUN
abc-4026	35	10	and	and	CCONJ
abc-4026	35	11	fnr	fnr	NOUN
abc-4026	35	12	-	-	PUNCT
abc-4026	35	13	interacting	interact	VERB
abc-4026	35	14	itep	itep	NOUN
abc-4026	35	15	domain	domain	NOUN
abc-4026	35	16	protrude	protrude	NOUN
abc-4026	35	17	to	to	ADP
abc-4026	35	18	the	the	DET
abc-4026	35	19	chloroplast	chloroplast	ADJ
abc-4026	35	20	stroma	stroma	NOUN
abc-4026	35	21	and	and	CCONJ
abc-4026	35	22	provide	provide	VERB
abc-4026	35	23	a	a	DET
abc-4026	35	24	flexible	flexible	ADJ
abc-4026	35	25	binding	bind	VERB
abc-4026	35	26	site	site	NOUN
abc-4026	35	27	for	for	ADP
abc-4026	35	28	the	the	DET
abc-4026	35	29	fnr	fnr	PROPN
abc-4026	35	30	(	(	PUNCT
abc-4026	35	31	jurić	jurić	VERB
abc-4026	35	32	et	et	PROPN
abc-4026	35	33	al	al	PROPN
abc-4026	35	34	.	.	PROPN
abc-4026	35	35	2009	2009	NUM
abc-4026	35	36	,	,	PUNCT
abc-4026	35	37	vojta	vojta	NOUN
abc-4026	35	38	and	and	CCONJ
abc-4026	35	39	fulgosi	fulgosi	NOUN
abc-4026	35	40	2019	2019	NUM
abc-4026	35	41	,	,	PUNCT
abc-4026	35	42	kekić	kekić	PROPN
abc-4026	35	43	et	et	PROPN
abc-4026	35	44	al	al	PROPN
abc-4026	35	45	.	.	PROPN
abc-4026	35	46	2020	2020	NUM
abc-4026	35	47	)	)	PUNCT
abc-4026	35	48	.	.	PUNCT
abc-4026	36	1	in	in	ADP
abc-4026	36	2	the	the	DET
abc-4026	36	3	thylakoid	thylakoid	ADJ
abc-4026	36	4	lumen	luman	NOUN
abc-4026	36	5	,	,	PUNCT
abc-4026	36	6	encompassed	encompass	VERB
abc-4026	36	7	by	by	ADP
abc-4026	36	8	the	the	DET
abc-4026	36	9	two	two	NUM
abc-4026	36	10	transmembrane	transmembrane	ADJ
abc-4026	36	11	helices	helix	NOUN
abc-4026	36	12	,	,	PUNCT
abc-4026	36	13	resides	reside	VERB
abc-4026	36	14	inactive	inactive	ADJ
abc-4026	36	15	rhodanese	rhodanese	NOUN
abc-4026	36	16	(	(	PUNCT
abc-4026	36	17	rho	rho	ADJ
abc-4026	36	18	)	)	PUNCT
abc-4026	36	19	domain	domain	NOUN
abc-4026	36	20	,	,	PUNCT
abc-4026	36	21	which	which	PRON
abc-4026	36	22	most	most	ADV
abc-4026	36	23	probably	probably	ADV
abc-4026	36	24	has	have	VERB
abc-4026	36	25	the	the	DET
abc-4026	36	26	regulatory	regulatory	ADJ
abc-4026	36	27	role	role	NOUN
abc-4026	36	28	(	(	PUNCT
abc-4026	36	29	jurić	jurić	VERB
abc-4026	36	30	et	et	PROPN
abc-4026	36	31	al	al	PROPN
abc-4026	36	32	.	.	PROPN
abc-4026	36	33	2009	2009	NUM
abc-4026	36	34	,	,	PUNCT
abc-4026	36	35	vojta	vojta	NOUN
abc-4026	36	36	and	and	CCONJ
abc-4026	36	37	fulgosi	fulgosi	NOUN
abc-4026	36	38	2019	2019	NUM
abc-4026	36	39	)	)	PUNCT
abc-4026	36	40	.	.	PUNCT
abc-4026	37	1	trol	trol	PROPN
abc-4026	37	2	is	be	AUX
abc-4026	37	3	one	one	NUM
abc-4026	37	4	of	of	ADP
abc-4026	37	5	the	the	DET
abc-4026	37	6	few	few	ADJ
abc-4026	37	7	known	know	VERB
abc-4026	37	8	dually	dually	ADV
abc-4026	37	9	localized	localize	VERB
abc-4026	37	10	chloroplast	chloroplast	ADJ
abc-4026	37	11	proteins	protein	NOUN
abc-4026	37	12	.	.	PUNCT
abc-4026	38	1	seventeen	seventeen	NUM
abc-4026	38	2	other	other	ADJ
abc-4026	38	3	proteins	protein	NOUN
abc-4026	38	4	have	have	AUX
abc-4026	38	5	been	be	AUX
abc-4026	38	6	identified	identify	VERB
abc-4026	38	7	in	in	ADP
abc-4026	38	8	both	both	DET
abc-4026	38	9	chloroplast	chloroplast	ADJ
abc-4026	38	10	envelope	envelope	NOUN
abc-4026	38	11	and	and	CCONJ
abc-4026	38	12	thylakoid	thylakoid	ADJ
abc-4026	38	13	membranes	membrane	NOUN
abc-4026	38	14	(	(	PUNCT
abc-4026	38	15	klasek	klasek	PROPN
abc-4026	38	16	and	and	CCONJ
abc-4026	38	17	inoue	inoue	PROPN
abc-4026	38	18	2016	2016	NUM
abc-4026	38	19	)	)	PUNCT
abc-4026	38	20	.	.	PUNCT
abc-4026	39	1	they	they	PRON
abc-4026	39	2	all	all	PRON
abc-4026	39	3	carry	carry	VERB
abc-4026	39	4	an	an	DET
abc-4026	39	5	n	n	CCONJ
abc-4026	39	6	-	-	PUNCT
abc-4026	39	7	terminal	terminal	ADJ
abc-4026	39	8	signal	signal	NOUN
abc-4026	39	9	for	for	ADP
abc-4026	39	10	import	import	NOUN
abc-4026	39	11	into	into	ADP
abc-4026	39	12	chloroplasts	chloroplast	NOUN
abc-4026	39	13	.	.	PUNCT
abc-4026	40	1	these	these	DET
abc-4026	40	2	proteins	protein	NOUN
abc-4026	40	3	are	be	AUX
abc-4026	40	4	involved	involve	VERB
abc-4026	40	5	in	in	ADP
abc-4026	40	6	protein	protein	NOUN
abc-4026	40	7	transport	transport	NOUN
abc-4026	40	8	,	,	PUNCT
abc-4026	40	9	tetrapyrrole	tetrapyrrole	NOUN
abc-4026	40	10	biosynthesis	biosynthesis	NOUN
abc-4026	40	11	,	,	PUNCT
abc-4026	40	12	membrane	membrane	NOUN
abc-4026	40	13	dynamics	dynamic	NOUN
abc-4026	40	14	,	,	PUNCT
abc-4026	40	15	transport	transport	NOUN
abc-4026	40	16	of	of	ADP
abc-4026	40	17	nucleotides	nucleotide	NOUN
abc-4026	40	18	and	and	CCONJ
abc-4026	40	19	inorganic	inorganic	ADJ
abc-4026	40	20	phosphate	phosphate	NOUN
abc-4026	40	21	(	(	PUNCT
abc-4026	40	22	klasek	klasek	PROPN
abc-4026	40	23	and	and	CCONJ
abc-4026	40	24	inoue	inoue	PROPN
abc-4026	40	25	2016	2016	NUM
abc-4026	40	26	)	)	PUNCT
abc-4026	40	27	.	.	PUNCT
abc-4026	41	1	one	one	NUM
abc-4026	41	2	of	of	ADP
abc-4026	41	3	these	these	DET
abc-4026	41	4	proteins	protein	NOUN
abc-4026	41	5	is	be	AUX
abc-4026	41	6	tic62	tic62	NOUN
abc-4026	41	7	,	,	PUNCT
abc-4026	41	8	a	a	DET
abc-4026	41	9	redox	redox	ADJ
abc-4026	41	10	sensor	sensor	NOUN
abc-4026	41	11	in	in	ADP
abc-4026	41	12	the	the	DET
abc-4026	41	13	inner	inner	ADJ
abc-4026	41	14	envelope	envelope	NOUN
abc-4026	41	15	membrane	membrane	NOUN
abc-4026	41	16	and	and	CCONJ
abc-4026	41	17	the	the	DET
abc-4026	41	18	thylakoids	thylakoid	NOUN
abc-4026	41	19	,	,	PUNCT
abc-4026	41	20	proposed	propose	VERB
abc-4026	41	21	to	to	PART
abc-4026	41	22	anchor	anchor	PROPN
abc-4026	41	23	fnr	fnr	PROPN
abc-4026	41	24	,	,	PUNCT
abc-4026	41	25	just	just	ADV
abc-4026	41	26	like	like	ADP
abc-4026	41	27	trol	trol	NOUN
abc-4026	41	28	(	(	PUNCT
abc-4026	41	29	benz	benz	PROPN
abc-4026	41	30	et	et	PROPN
abc-4026	41	31	al	al	PROPN
abc-4026	41	32	.	.	PROPN
abc-4026	41	33	2010	2010	NUM
abc-4026	41	34	)	)	PUNCT
abc-4026	41	35	and	and	CCONJ
abc-4026	41	36	is	be	AUX
abc-4026	41	37	involved	involve	VERB
abc-4026	41	38	in	in	ADP
abc-4026	41	39	chloroplast	chloroplast	ADJ
abc-4026	41	40	protein	protein	NOUN
abc-4026	41	41	import	import	NOUN
abc-4026	41	42	(	(	PUNCT
abc-4026	41	43	küchler	küchler	NOUN
abc-4026	41	44	et	et	PROPN
abc-4026	41	45	al	al	PROPN
abc-4026	41	46	.	.	PROPN
abc-4026	41	47	2002	2002	NUM
abc-4026	41	48	)	)	PUNCT
abc-4026	41	49	.	.	PUNCT
abc-4026	42	1	besides	besides	SCONJ
abc-4026	42	2	the	the	DET
abc-4026	42	3	thylakoids	thylakoid	NOUN
abc-4026	42	4	-	-	PUNCT
abc-4026	42	5	envelope	envelope	NOUN
abc-4026	42	6	,	,	PUNCT
abc-4026	42	7	there	there	PRON
abc-4026	42	8	can	can	AUX
abc-4026	42	9	also	also	ADV
abc-4026	42	10	be	be	AUX
abc-4026	42	11	dual	dual	ADJ
abc-4026	42	12	localization	localization	NOUN
abc-4026	42	13	in	in	ADP
abc-4026	42	14	the	the	DET
abc-4026	42	15	stroma	stroma	NOUN
abc-4026	42	16	-	-	PUNCT
abc-4026	42	17	envelope	envelope	NOUN
abc-4026	42	18	compartments	compartment	NOUN
abc-4026	42	19	,	,	PUNCT
abc-4026	42	20	as	as	ADP
abc-4026	42	21	in	in	ADP
abc-4026	42	22	the	the	DET
abc-4026	42	23	case	case	NOUN
abc-4026	42	24	of	of	ADP
abc-4026	42	25	protein	protein	NOUN
abc-4026	42	26	cpsar1	cpsar1	PROPN
abc-4026	42	27	,	,	PUNCT
abc-4026	42	28	which	which	PRON
abc-4026	42	29	is	be	AUX
abc-4026	42	30	dually	dually	ADV
abc-4026	42	31	localized	localize	VERB
abc-4026	42	32	in	in	ADP
abc-4026	42	33	the	the	DET
abc-4026	42	34	stroma	stroma	NOUN
abc-4026	42	35	and	and	CCONJ
abc-4026	42	36	the	the	DET
abc-4026	42	37	inner	inner	ADJ
abc-4026	42	38	envelope	envelope	NOUN
abc-4026	42	39	membrane	membrane	NOUN
abc-4026	42	40	and	and	CCONJ
abc-4026	42	41	is	be	AUX
abc-4026	42	42	involved	involve	VERB
abc-4026	42	43	in	in	ADP
abc-4026	42	44	thylakoid	thylakoid	ADJ
abc-4026	42	45	biogenesis	biogenesis	NOUN
abc-4026	42	46	(	(	PUNCT
abc-4026	42	47	garcia	garcia	PROPN
abc-4026	42	48	et	et	PROPN
abc-4026	42	49	al	al	PROPN
abc-4026	42	50	.	.	PROPN
abc-4026	42	51	2010	2010	NUM
abc-4026	42	52	)	)	PUNCT
abc-4026	42	53	.	.	PUNCT
abc-4026	43	1	also	also	ADV
abc-4026	43	2	,	,	PUNCT
abc-4026	43	3	chloroplast	chloroplast	NOUN
abc-4026	43	4	-	-	PUNCT
abc-4026	43	5	nucleus	nucleus	NOUN
abc-4026	43	6	localization	localization	NOUN
abc-4026	43	7	has	have	AUX
abc-4026	43	8	been	be	AUX
abc-4026	43	9	confirmed	confirm	VERB
abc-4026	43	10	,	,	PUNCT
abc-4026	43	11	as	as	ADP
abc-4026	43	12	for	for	ADP
abc-4026	43	13	the	the	DET
abc-4026	43	14	protein	protein	NOUN
abc-4026	43	15	npr1	npr1	NOUN
abc-4026	43	16	which	which	PRON
abc-4026	43	17	switches	switch	VERB
abc-4026	43	18	its	its	PRON
abc-4026	43	19	location	location	NOUN
abc-4026	43	20	as	as	ADP
abc-4026	43	21	adaptive	adaptive	ADJ
abc-4026	43	22	response	response	NOUN
abc-4026	43	23	to	to	PART
abc-4026	43	24	salt	salt	VERB
abc-4026	43	25	stress	stress	NOUN
abc-4026	43	26	(	(	PUNCT
abc-4026	43	27	seo	seo	NOUN
abc-4026	43	28	et	et	PROPN
abc-4026	43	29	al	al	PROPN
abc-4026	43	30	.	.	PROPN
abc-4026	43	31	2020	2020	NUM
abc-4026	43	32	)	)	PUNCT
abc-4026	43	33	.	.	PUNCT
abc-4026	44	1	finally	finally	ADV
abc-4026	44	2	,	,	PUNCT
abc-4026	44	3	it	it	PRON
abc-4026	44	4	was	be	AUX
abc-4026	44	5	reported	report	VERB
abc-4026	44	6	that	that	SCONJ
abc-4026	44	7	approximately	approximately	ADV
abc-4026	44	8	5	5	NUM
abc-4026	44	9	%	%	NOUN
abc-4026	44	10	of	of	ADP
abc-4026	44	11	mitochondrial	mitochondrial	ADJ
abc-4026	44	12	and	and	CCONJ
abc-4026	44	13	chloroplast	chloroplast	ADJ
abc-4026	44	14	proteins	protein	NOUN
abc-4026	44	15	are	be	AUX
abc-4026	44	16	dually	dually	ADV
abc-4026	44	17	targeted	target	VERB
abc-4026	44	18	in	in	ADP
abc-4026	44	19	plants	plant	NOUN
abc-4026	44	20	(	(	PUNCT
abc-4026	44	21	sáiz	sáiz	NOUN
abc-4026	44	22	-	-	PUNCT
abc-4026	44	23	bonilla	bonilla	NOUN
abc-4026	44	24	et	et	PROPN
abc-4026	44	25	al	al	PROPN
abc-4026	44	26	.	.	PROPN
abc-4026	44	27	2023	2023	NUM
abc-4026	44	28	)	)	PUNCT
abc-4026	44	29	.	.	PUNCT
abc-4026	45	1	in	in	ADP
abc-4026	45	2	addition	addition	NOUN
abc-4026	45	3	to	to	ADP
abc-4026	45	4	being	be	AUX
abc-4026	45	5	mainly	mainly	ADV
abc-4026	45	6	located	locate	VERB
abc-4026	45	7	at	at	ADP
abc-4026	45	8	the	the	DET
abc-4026	45	9	stroma	stroma	ADJ
abc-4026	45	10	thylakoids	thylakoid	NOUN
abc-4026	45	11	,	,	PUNCT
abc-4026	45	12	in	in	ADP
abc-4026	45	13	its	its	PRON
abc-4026	45	14	fully	fully	ADV
abc-4026	45	15	processed	process	VERB
abc-4026	45	16	form	form	NOUN
abc-4026	45	17	of	of	ADP
abc-4026	45	18	66	66	NUM
abc-4026	45	19	kda	kda	NOUN
abc-4026	45	20	,	,	PUNCT
abc-4026	45	21	trol	trol	PROPN
abc-4026	45	22	can	can	AUX
abc-4026	45	23	also	also	ADV
abc-4026	45	24	be	be	AUX
abc-4026	45	25	found	find	VERB
abc-4026	45	26	embedded	embed	VERB
abc-4026	45	27	in	in	ADP
abc-4026	45	28	the	the	DET
abc-4026	45	29	chloroplast	chloroplast	ADJ
abc-4026	45	30	inner	inner	ADJ
abc-4026	45	31	envelope	envelope	NOUN
abc-4026	45	32	membrane	membrane	NOUN
abc-4026	45	33	(	(	PUNCT
abc-4026	45	34	ie	ie	X
abc-4026	45	35	)	)	PUNCT
abc-4026	45	36	in	in	ADP
abc-4026	45	37	its	its	PRON
abc-4026	45	38	non	non	ADJ
abc-4026	45	39	-	-	ADJ
abc-4026	45	40	processed	processed	ADJ
abc-4026	45	41	form	form	NOUN
abc-4026	45	42	of	of	ADP
abc-4026	45	43	70	70	NUM
abc-4026	45	44	kda	kda	NOUN
abc-4026	45	45	(	(	PUNCT
abc-4026	45	46	jurić	jurić	VERB
abc-4026	45	47	et	et	PROPN
abc-4026	45	48	al	al	PROPN
abc-4026	45	49	.	.	PROPN
abc-4026	45	50	2009	2009	NUM
abc-4026	45	51	,	,	PUNCT
abc-4026	45	52	vojta	vojta	NOUN
abc-4026	45	53	et	et	PROPN
abc-4026	45	54	al	al	PROPN
abc-4026	45	55	.	.	PROPN
abc-4026	45	56	2018	2018	NUM
abc-4026	45	57	)	)	PUNCT
abc-4026	45	58	,	,	PUNCT
abc-4026	45	59	with	with	ADP
abc-4026	45	60	an	an	DET
abc-4026	45	61	as	as	ADV
abc-4026	45	62	yet	yet	ADV
abc-4026	45	63	unraveled	unraveled	ADJ
abc-4026	45	64	role	role	NOUN
abc-4026	45	65	.	.	PUNCT
abc-4026	46	1	this	this	DET
abc-4026	46	2	dual	dual	ADJ
abc-4026	46	3	localization	localization	NOUN
abc-4026	46	4	has	have	AUX
abc-4026	46	5	been	be	AUX
abc-4026	46	6	proven	prove	VERB
abc-4026	46	7	by	by	ADP
abc-4026	46	8	the	the	DET
abc-4026	46	9	proteome	proteome	ADJ
abc-4026	46	10	analysis	analysis	NOUN
abc-4026	46	11	of	of	ADP
abc-4026	46	12	chloroplast	chloroplast	ADJ
abc-4026	46	13	envelopes	envelope	NOUN
abc-4026	46	14	and	and	CCONJ
abc-4026	46	15	thylakoid	thylakoid	ADJ
abc-4026	46	16	membranes	membrane	NOUN
abc-4026	46	17	(	(	PUNCT
abc-4026	46	18	peltier	peltier	NOUN
abc-4026	46	19	et	et	PROPN
abc-4026	46	20	al	al	PROPN
abc-4026	46	21	.	.	PROPN
abc-4026	46	22	2004	2004	NUM
abc-4026	46	23	)	)	PUNCT
abc-4026	46	24	.	.	PUNCT
abc-4026	47	1	both	both	DET
abc-4026	47	2	forms	form	NOUN
abc-4026	47	3	remain	remain	AUX
abc-4026	47	4	protected	protect	VERB
abc-4026	47	5	after	after	ADP
abc-4026	47	6	thermolysin	thermolysin	NOUN
abc-4026	47	7	digestion	digestion	NOUN
abc-4026	47	8	of	of	ADP
abc-4026	47	9	intact	intact	ADJ
abc-4026	47	10	chloroplasts	chloroplast	NOUN
abc-4026	47	11	,	,	PUNCT
abc-4026	47	12	indicating	indicate	VERB
abc-4026	47	13	their	their	PRON
abc-4026	47	14	complete	complete	ADJ
abc-4026	47	15	incorporation	incorporation	NOUN
abc-4026	47	16	into	into	ADP
abc-4026	47	17	these	these	DET
abc-4026	47	18	membranes	membrane	NOUN
abc-4026	47	19	(	(	PUNCT
abc-4026	47	20	vojta	vojta	NOUN
abc-4026	47	21	et	et	PROPN
abc-4026	47	22	al	al	PROPN
abc-4026	47	23	.	.	PROPN
abc-4026	47	24	2018	2018	NUM
abc-4026	47	25	)	)	PUNCT
abc-4026	47	26	.	.	PUNCT
abc-4026	48	1	during	during	ADP
abc-4026	48	2	protein	protein	NOUN
abc-4026	48	3	import	import	NOUN
abc-4026	48	4	into	into	ADP
abc-4026	48	5	chloroplasts	chloroplast	NOUN
abc-4026	48	6	,	,	PUNCT
abc-4026	48	7	the	the	DET
abc-4026	48	8	information	information	NOUN
abc-4026	48	9	contained	contain	VERB
abc-4026	48	10	in	in	ADP
abc-4026	48	11	targeting	target	VERB
abc-4026	48	12	sequences	sequence	NOUN
abc-4026	48	13	are	be	AUX
abc-4026	48	14	sequentially	sequentially	ADV
abc-4026	48	15	decoded	decode	VERB
abc-4026	48	16	resulting	result	VERB
abc-4026	48	17	in	in	ADP
abc-4026	48	18	localization	localization	NOUN
abc-4026	48	19	of	of	ADP
abc-4026	48	20	the	the	DET
abc-4026	48	21	polypeptide	polypeptide	NOUN
abc-4026	48	22	to	to	ADP
abc-4026	48	23	the	the	DET
abc-4026	48	24	appropriate	appropriate	ADJ
abc-4026	48	25	organelle	organelle	NOUN
abc-4026	48	26	subcompartment	subcompartment	NOUN
abc-4026	48	27	(	(	PUNCT
abc-4026	48	28	cline	cline	PROPN
abc-4026	48	29	and	and	CCONJ
abc-4026	48	30	henry	henry	PROPN
abc-4026	48	31	1996	1996	NUM
abc-4026	48	32	)	)	PUNCT
abc-4026	48	33	.	.	PUNCT
abc-4026	49	1	trol	trol	PROPN
abc-4026	49	2	is	be	AUX
abc-4026	49	3	a	a	DET
abc-4026	49	4	nuclear	nuclear	NOUN
abc-4026	49	5	-	-	PUNCT
abc-4026	49	6	encoded	encode	VERB
abc-4026	49	7	protein	protein	NOUN
abc-4026	49	8	,	,	PUNCT
abc-4026	49	9	synthesized	synthesize	VERB
abc-4026	49	10	with	with	ADP
abc-4026	49	11	the	the	DET
abc-4026	49	12	cleavable	cleavable	ADJ
abc-4026	49	13	nterminal	nterminal	ADJ
abc-4026	49	14	69	69	NUM
abc-4026	49	15	amino	amino	NOUN
abc-4026	49	16	acids	acid	NOUN
abc-4026	49	17	long	long	ADJ
abc-4026	49	18	presequence	presequence	NOUN
abc-4026	49	19	that	that	PRON
abc-4026	49	20	directs	direct	VERB
abc-4026	49	21	the	the	DET
abc-4026	49	22	protein	protein	NOUN
abc-4026	49	23	to	to	ADP
abc-4026	49	24	the	the	DET
abc-4026	49	25	chloroplasts	chloroplast	NOUN
abc-4026	49	26	.	.	PUNCT
abc-4026	50	1	trol	trol	PROPN
abc-4026	50	2	is	be	AUX
abc-4026	50	3	,	,	PUNCT
abc-4026	50	4	like	like	ADP
abc-4026	50	5	most	most	ADJ
abc-4026	50	6	of	of	ADP
abc-4026	50	7	the	the	DET
abc-4026	50	8	ie	ie	ADJ
abc-4026	50	9	membrane	membrane	NOUN
abc-4026	50	10	proteins	protein	NOUN
abc-4026	50	11	,	,	PUNCT
abc-4026	50	12	directed	direct	VERB
abc-4026	50	13	through	through	ADP
abc-4026	50	14	the	the	DET
abc-4026	50	15	general	general	ADJ
abc-4026	50	16	import	import	NOUN
abc-4026	50	17	pathway	pathway	NOUN
abc-4026	50	18	(	(	PUNCT
abc-4026	50	19	toc	toc	NOUN
abc-4026	50	20	and	and	CCONJ
abc-4026	50	21	tic	tic	ADJ
abc-4026	50	22	complex	complex	NOUN
abc-4026	50	23	)	)	PUNCT
abc-4026	50	24	to	to	PART
abc-4026	50	25	cross	cross	VERB
abc-4026	50	26	the	the	DET
abc-4026	50	27	envelope	envelope	NOUN
abc-4026	50	28	membranes	membrane	NOUN
abc-4026	50	29	.	.	PUNCT
abc-4026	51	1	this	this	DET
abc-4026	51	2	transfer	transfer	NOUN
abc-4026	51	3	might	might	AUX
abc-4026	51	4	end	end	VERB
abc-4026	51	5	at	at	ADP
abc-4026	51	6	the	the	DET
abc-4026	51	7	level	level	NOUN
abc-4026	51	8	of	of	ADP
abc-4026	51	9	the	the	DET
abc-4026	51	10	ie	ie	X
abc-4026	51	11	membrane	membrane	NOUN
abc-4026	51	12	,	,	PUNCT
abc-4026	51	13	where	where	SCONJ
abc-4026	51	14	we	we	PRON
abc-4026	51	15	suppose	suppose	VERB
abc-4026	51	16	trol	trol	NOUN
abc-4026	51	17	is	be	AUX
abc-4026	51	18	released	release	VERB
abc-4026	51	19	from	from	ADP
abc-4026	51	20	the	the	DET
abc-4026	51	21	translocon	translocon	NOUN
abc-4026	51	22	machinery	machinery	NOUN
abc-4026	51	23	,	,	PUNCT
abc-4026	51	24	as	as	SCONJ
abc-4026	51	25	instructed	instruct	VERB
abc-4026	51	26	by	by	ADP
abc-4026	51	27	a	a	DET
abc-4026	51	28	hydrophobic	hydrophobic	NOUN
abc-4026	51	29	stop	stop	NOUN
abc-4026	51	30	-	-	PUNCT
abc-4026	51	31	transfer	transfer	NOUN
abc-4026	51	32	signal	signal	NOUN
abc-4026	51	33	in	in	ADP
abc-4026	51	34	its	its	PRON
abc-4026	51	35	sequence	sequence	NOUN
abc-4026	51	36	(	(	PUNCT
abc-4026	51	37	vojta	vojta	NOUN
abc-4026	51	38	et	et	PROPN
abc-4026	51	39	al	al	PROPN
abc-4026	51	40	.	.	PROPN
abc-4026	51	41	2007	2007	NUM
abc-4026	51	42	)	)	PUNCT
abc-4026	51	43	.	.	PUNCT
abc-4026	52	1	the	the	DET
abc-4026	52	2	majority	majority	NOUN
abc-4026	52	3	of	of	ADP
abc-4026	52	4	the	the	DET
abc-4026	52	5	trol	trol	NOUN
abc-4026	52	6	protein	protein	NOUN
abc-4026	52	7	pool	pool	NOUN
abc-4026	52	8	continues	continue	VERB
abc-4026	52	9	its	its	PRON
abc-4026	52	10	way	way	NOUN
abc-4026	52	11	towards	towards	ADP
abc-4026	52	12	the	the	DET
abc-4026	52	13	thylakoids	thylakoid	NOUN
abc-4026	52	14	,	,	PUNCT
abc-4026	52	15	by	by	ADP
abc-4026	52	16	entering	enter	VERB
abc-4026	52	17	the	the	DET
abc-4026	52	18	chloroplast	chloroplast	ADJ
abc-4026	52	19	stroma	stroma	NOUN
abc-4026	52	20	where	where	SCONJ
abc-4026	52	21	the	the	DET
abc-4026	52	22	preprotein	preprotein	NOUN
abc-4026	52	23	is	be	AUX
abc-4026	52	24	recognized	recognize	VERB
abc-4026	52	25	and	and	CCONJ
abc-4026	52	26	processed	process	VERB
abc-4026	52	27	by	by	ADP
abc-4026	52	28	the	the	DET
abc-4026	52	29	stromal	stromal	ADJ
abc-4026	52	30	processing	processing	NOUN
abc-4026	52	31	peptidase	peptidase	NOUN
abc-4026	52	32	(	(	PUNCT
abc-4026	52	33	spp	spp	NOUN
abc-4026	52	34	)	)	PUNCT
abc-4026	52	35	,	,	PUNCT
abc-4026	52	36	the	the	DET
abc-4026	52	37	mature	mature	ADJ
abc-4026	52	38	protein	protein	NOUN
abc-4026	52	39	being	be	AUX
abc-4026	52	40	finally	finally	ADV
abc-4026	52	41	incorporated	incorporate	VERB
abc-4026	52	42	into	into	ADP
abc-4026	52	43	thylakoid	thylakoid	ADJ
abc-4026	52	44	membranes	membrane	NOUN
abc-4026	52	45	(	(	PUNCT
abc-4026	52	46	vojta	vojta	NOUN
abc-4026	52	47	et	et	PROPN
abc-4026	52	48	al	al	PROPN
abc-4026	52	49	.	.	PROPN
abc-4026	52	50	2007	2007	NUM
abc-4026	52	51	,	,	PUNCT
abc-4026	52	52	vojta	vojta	NOUN
abc-4026	52	53	et	et	PROPN
abc-4026	52	54	al	al	PROPN
abc-4026	52	55	.	.	PROPN
abc-4026	52	56	2018	2018	NUM
abc-4026	52	57	)	)	PUNCT
abc-4026	52	58	.	.	PUNCT
abc-4026	53	1	proteins	protein	NOUN
abc-4026	53	2	targeted	target	VERB
abc-4026	53	3	to	to	ADP
abc-4026	53	4	the	the	DET
abc-4026	53	5	thylakoid	thylakoid	ADJ
abc-4026	53	6	membrane	membrane	NOUN
abc-4026	53	7	require	require	NOUN
abc-4026	53	8	dual	dual	ADJ
abc-4026	53	9	targeting	targeting	NOUN
abc-4026	53	10	signals	signal	NOUN
abc-4026	53	11	that	that	PRON
abc-4026	53	12	direct	direct	VERB
abc-4026	53	13	their	their	PRON
abc-4026	53	14	import	import	NOUN
abc-4026	53	15	across	across	ADP
abc-4026	53	16	the	the	DET
abc-4026	53	17	chloroplast	chloroplast	NOUN
abc-4026	53	18	envelope	envelope	NOUN
abc-4026	53	19	membranes	membrane	NOUN
abc-4026	53	20	and	and	CCONJ
abc-4026	53	21	subsequent	subsequent	ADJ
abc-4026	53	22	incorporation	incorporation	NOUN
abc-4026	53	23	into	into	ADP
abc-4026	53	24	the	the	DET
abc-4026	53	25	thylakoids	thylakoid	NOUN
abc-4026	53	26	.	.	PUNCT
abc-4026	54	1	the	the	DET
abc-4026	54	2	targeting	targeting	NOUN
abc-4026	54	3	signal	signal	NOUN
abc-4026	54	4	for	for	ADP
abc-4026	54	5	thylakoids	thylakoid	NOUN
abc-4026	54	6	can	can	AUX
abc-4026	54	7	be	be	AUX
abc-4026	54	8	in	in	ADP
abc-4026	54	9	the	the	DET
abc-4026	54	10	form	form	NOUN
abc-4026	54	11	of	of	ADP
abc-4026	54	12	a	a	DET
abc-4026	54	13	single	single	ADJ
abc-4026	54	14	bipartite	bipartite	PROPN
abc-4026	54	15	transit	transit	NOUN
abc-4026	54	16	sequence	sequence	NOUN
abc-4026	54	17	that	that	PRON
abc-4026	54	18	carries	carry	VERB
abc-4026	54	19	the	the	DET
abc-4026	54	20	information	information	NOUN
abc-4026	54	21	for	for	ADP
abc-4026	54	22	targeting	target	VERB
abc-4026	54	23	to	to	PART
abc-4026	54	24	stroma	stroma	VERB
abc-4026	54	25	at	at	ADP
abc-4026	54	26	the	the	DET
abc-4026	54	27	n	n	CCONJ
abc-4026	54	28	-	-	PUNCT
abc-4026	54	29	terminal	terminal	ADJ
abc-4026	54	30	region	region	NOUN
abc-4026	54	31	and	and	CCONJ
abc-4026	54	32	to	to	ADP
abc-4026	54	33	the	the	DET
abc-4026	54	34	thylakoids	thylakoid	NOUN
abc-4026	54	35	at	at	ADP
abc-4026	54	36	the	the	DET
abc-4026	54	37	c	c	NOUN
abc-4026	54	38	-	-	PUNCT
abc-4026	54	39	terminal	terminal	ADJ
abc-4026	54	40	region	region	NOUN
abc-4026	54	41	of	of	ADP
abc-4026	54	42	the	the	DET
abc-4026	54	43	presequence	presequence	NOUN
abc-4026	54	44	(	(	PUNCT
abc-4026	54	45	cline	cline	PROPN
abc-4026	54	46	and	and	CCONJ
abc-4026	54	47	henry	henry	PROPN
abc-4026	54	48	1996	1996	NUM
abc-4026	54	49	,	,	PUNCT
abc-4026	54	50	schnell	schnell	PROPN
abc-4026	54	51	1998	1998	NUM
abc-4026	54	52	)	)	PUNCT
abc-4026	54	53	.	.	PUNCT
abc-4026	55	1	since	since	SCONJ
abc-4026	55	2	the	the	DET
abc-4026	55	3	single	single	ADJ
abc-4026	55	4	targeting	targeting	NOUN
abc-4026	55	5	domain	domain	NOUN
abc-4026	55	6	is	be	AUX
abc-4026	55	7	predicted	predict	VERB
abc-4026	55	8	for	for	ADP
abc-4026	55	9	the	the	DET
abc-4026	55	10	transit	transit	NOUN
abc-4026	55	11	sequence	sequence	NOUN
abc-4026	55	12	of	of	ADP
abc-4026	55	13	trol	trol	NOUN
abc-4026	55	14	,	,	PUNCT
abc-4026	55	15	the	the	DET
abc-4026	55	16	signals	signal	NOUN
abc-4026	55	17	for	for	ADP
abc-4026	55	18	the	the	DET
abc-4026	55	19	targeting	targeting	NOUN
abc-4026	55	20	of	of	ADP
abc-4026	55	21	trol	trol	NOUN
abc-4026	55	22	to	to	ADP
abc-4026	55	23	the	the	DET
abc-4026	55	24	thylakoids	thylakoid	NOUN
abc-4026	55	25	seem	seem	VERB
abc-4026	55	26	to	to	PART
abc-4026	55	27	reside	reside	VERB
abc-4026	55	28	within	within	ADP
abc-4026	55	29	the	the	DET
abc-4026	55	30	primary	primary	ADJ
abc-4026	55	31	sequence	sequence	NOUN
abc-4026	55	32	of	of	ADP
abc-4026	55	33	the	the	DET
abc-4026	55	34	mature	mature	ADJ
abc-4026	55	35	polypeptide	polypeptide	NOUN
abc-4026	55	36	,	,	PUNCT
abc-4026	55	37	as	as	SCONJ
abc-4026	55	38	reported	report	VERB
abc-4026	55	39	for	for	ADP
abc-4026	55	40	other	other	ADJ
abc-4026	55	41	integral	integral	ADJ
abc-4026	55	42	thylakoid	thylakoid	ADJ
abc-4026	55	43	membrane	membrane	NOUN
abc-4026	55	44	proteins	protein	NOUN
abc-4026	55	45	,	,	PUNCT
abc-4026	55	46	such	such	ADJ
abc-4026	55	47	as	as	ADP
abc-4026	55	48	lightharvesting	lightharveste	VERB
abc-4026	55	49	chlorophyll	chlorophyll	NOUN
abc-4026	55	50	a	a	DET
abc-4026	55	51	/	/	SYM
abc-4026	55	52	b	b	NOUN
abc-4026	55	53	binding	bind	VERB
abc-4026	55	54	protein	protein	NOUN
abc-4026	55	55	(	(	PUNCT
abc-4026	55	56	prelhcp	prelhcp	NOUN
abc-4026	55	57	)	)	PUNCT
abc-4026	55	58	and	and	CCONJ
abc-4026	55	59	the	the	DET
abc-4026	55	60	precursor	precursor	NOUN
abc-4026	55	61	to	to	ADP
abc-4026	55	62	the	the	DET
abc-4026	55	63	20	20	NUM
abc-4026	55	64	-	-	PUNCT
abc-4026	55	65	kda	kda	NOUN
abc-4026	55	66	subunit	subunit	NOUN
abc-4026	55	67	of	of	ADP
abc-4026	55	68	the	the	DET
abc-4026	55	69	cp24	cp24	PROPN
abc-4026	55	70	complex	complex	NOUN
abc-4026	55	71	(	(	PUNCT
abc-4026	55	72	schnell	schnell	PROPN
abc-4026	55	73	1998	1998	NUM
abc-4026	55	74	,	,	PUNCT
abc-4026	55	75	lamppa	lamppa	NOUN
abc-4026	55	76	1988	1988	NUM
abc-4026	55	77	)	)	PUNCT
abc-4026	55	78	.	.	PUNCT
abc-4026	56	1	in	in	ADP
abc-4026	56	2	our	our	PRON
abc-4026	56	3	previous	previous	ADJ
abc-4026	56	4	experiments	experiment	NOUN
abc-4026	56	5	,	,	PUNCT
abc-4026	56	6	we	we	PRON
abc-4026	56	7	determined	determine	VERB
abc-4026	56	8	that	that	SCONJ
abc-4026	56	9	a	a	DET
abc-4026	56	10	single	single	ADJ
abc-4026	56	11	amino	amino	NOUN
abc-4026	56	12	acid	acid	NOUN
abc-4026	56	13	mutation	mutation	NOUN
abc-4026	56	14	around	around	ADP
abc-4026	56	15	the	the	DET
abc-4026	56	16	stromal	stromal	ADJ
abc-4026	56	17	protease	protease	NOUN
abc-4026	56	18	processing	processing	NOUN
abc-4026	56	19	site	site	NOUN
abc-4026	56	20	of	of	ADP
abc-4026	56	21	the	the	DET
abc-4026	56	22	presequence	presequence	NOUN
abc-4026	56	23	of	of	ADP
abc-4026	56	24	trol	trol	NOUN
abc-4026	56	25	,	,	PUNCT
abc-4026	56	26	ala67ile	ala67ile	ADJ
abc-4026	56	27	,	,	PUNCT
abc-4026	56	28	directs	direct	VERB
abc-4026	56	29	the	the	DET
abc-4026	56	30	entire	entire	ADJ
abc-4026	56	31	pool	pool	NOUN
abc-4026	56	32	of	of	ADP
abc-4026	56	33	in	in	ADP
abc-4026	56	34	vitro	vitro	X
abc-4026	56	35	synthesized	synthesize	VERB
abc-4026	56	36	and	and	CCONJ
abc-4026	56	37	imported	import	VERB
abc-4026	56	38	trol	trol	NOUN
abc-4026	56	39	to	to	ADP
abc-4026	56	40	the	the	DET
abc-4026	56	41	chloroplast	chloroplast	NOUN
abc-4026	56	42	ie	ie	X
abc-4026	56	43	membrane	membrane	NOUN
abc-4026	56	44	,	,	PUNCT
abc-4026	56	45	without	without	ADP
abc-4026	56	46	incorporation	incorporation	NOUN
abc-4026	56	47	in	in	ADP
abc-4026	56	48	the	the	DET
abc-4026	56	49	thylakoids	thylakoid	NOUN
abc-4026	56	50	,	,	PUNCT
abc-4026	56	51	and	and	CCONJ
abc-4026	56	52	if	if	SCONJ
abc-4026	56	53	so	so	ADV
abc-4026	56	54	,	,	PUNCT
abc-4026	56	55	then	then	ADV
abc-4026	56	56	to	to	ADP
abc-4026	56	57	a	a	DET
abc-4026	56	58	very	very	ADV
abc-4026	56	59	low	low	ADJ
abc-4026	56	60	extent	extent	NOUN
abc-4026	56	61	(	(	PUNCT
abc-4026	56	62	vojta	vojta	NOUN
abc-4026	56	63	et	et	PROPN
abc-4026	56	64	al	al	PROPN
abc-4026	56	65	.	.	PROPN
abc-4026	56	66	2018	2018	NUM
abc-4026	56	67	)	)	PUNCT
abc-4026	56	68	.	.	PUNCT
abc-4026	57	1	this	this	DET
abc-4026	57	2	result	result	NOUN
abc-4026	57	3	led	lead	VERB
abc-4026	57	4	to	to	ADP
abc-4026	57	5	the	the	DET
abc-4026	57	6	idea	idea	NOUN
abc-4026	57	7	of	of	ADP
abc-4026	57	8	creating	create	VERB
abc-4026	57	9	arabidopsis	arabidopsis	NOUN
abc-4026	57	10	plants	plant	NOUN
abc-4026	57	11	that	that	PRON
abc-4026	57	12	would	would	AUX
abc-4026	57	13	accumulate	accumulate	VERB
abc-4026	57	14	trol	trol	NOUN
abc-4026	57	15	located	locate	VERB
abc-4026	57	16	at	at	ADP
abc-4026	57	17	the	the	DET
abc-4026	57	18	single	single	ADJ
abc-4026	57	19	intrachloroplastic	intrachloroplastic	ADJ
abc-4026	57	20	site	site	NOUN
abc-4026	57	21	–	–	PUNCT
abc-4026	57	22	the	the	DET
abc-4026	57	23	ie	ie	X
abc-4026	57	24	.	.	PUNCT
abc-4026	58	1	such	such	ADJ
abc-4026	58	2	plants	plant	NOUN
abc-4026	58	3	could	could	AUX
abc-4026	58	4	unravel	unravel	VERB
abc-4026	58	5	the	the	DET
abc-4026	58	6	still	still	ADV
abc-4026	58	7	unknown	unknown	ADJ
abc-4026	58	8	function	function	NOUN
abc-4026	58	9	of	of	ADP
abc-4026	58	10	trol	trol	NOUN
abc-4026	58	11	in	in	ADP
abc-4026	58	12	this	this	DET
abc-4026	58	13	membrane	membrane	NOUN
abc-4026	58	14	.	.	PUNCT
abc-4026	59	1	the	the	DET
abc-4026	59	2	importance	importance	NOUN
abc-4026	59	3	of	of	ADP
abc-4026	59	4	constructing	construct	VERB
abc-4026	59	5	trol	trol	NOUN
abc-4026	59	6	-	-	PUNCT
abc-4026	59	7	ie	ie	X
abc-4026	59	8	plants	plant	NOUN
abc-4026	59	9	lies	lie	VERB
abc-4026	59	10	in	in	ADP
abc-4026	59	11	the	the	DET
abc-4026	59	12	fact	fact	NOUN
abc-4026	59	13	that	that	SCONJ
abc-4026	59	14	chloroplast	chloroplast	ADJ
abc-4026	59	15	envelopes	envelope	NOUN
abc-4026	59	16	make	make	VERB
abc-4026	59	17	up	up	ADP
abc-4026	59	18	only	only	ADV
abc-4026	59	19	around	around	ADV
abc-4026	59	20	3	3	NUM
abc-4026	59	21	%	%	NOUN
abc-4026	59	22	of	of	ADP
abc-4026	59	23	total	total	ADJ
abc-4026	59	24	vojta	vojta	PROPN
abc-4026	59	25	l.	l.	PROPN
abc-4026	59	26	,	,	PUNCT
abc-4026	59	27	fulgosi	fulgosi	PROPN
abc-4026	59	28	h.	h.	PROPN
abc-4026	59	29	,	,	PUNCT
abc-4026	59	30	tomašić	tomašić	PROPN
abc-4026	59	31	paić	paić	PROPN
abc-4026	59	32	a.	a.	PROPN
abc-4026	59	33	,	,	PUNCT
abc-4026	59	34	dumančić	dumančić	PROPN
abc-4026	59	35	e.	e.	PROPN
abc-4026	59	36	258	258	NUM
abc-4026	59	37	acta	acta	PROPN
abc-4026	59	38	bot	bot	PROPN
abc-4026	59	39	.	.	PUNCT
abc-4026	60	1	croat	croat	PROPN
abc-4026	60	2	.	.	PUNCT
abc-4026	61	1	84	84	NUM
abc-4026	61	2	(	(	PUNCT
abc-4026	61	3	2	2	NUM
abc-4026	61	4	)	)	PUNCT
abc-4026	61	5	,	,	PUNCT
abc-4026	61	6	2025	2025	NUM
abc-4026	61	7	chloroplast	chloroplast	ADJ
abc-4026	61	8	membranes	membrane	NOUN
abc-4026	61	9	.	.	PUNCT
abc-4026	62	1	the	the	DET
abc-4026	62	2	vast	vast	ADJ
abc-4026	62	3	majority	majority	NOUN
abc-4026	62	4	of	of	ADP
abc-4026	62	5	membranes	membrane	NOUN
abc-4026	62	6	are	be	AUX
abc-4026	62	7	thylakoids	thylakoid	NOUN
abc-4026	62	8	and	and	CCONJ
abc-4026	62	9	by	by	ADP
abc-4026	62	10	investigations	investigation	NOUN
abc-4026	62	11	performed	perform	VERB
abc-4026	62	12	on	on	ADP
abc-4026	62	13	chloroplasts	chloroplast	NOUN
abc-4026	62	14	or	or	CCONJ
abc-4026	62	15	total	total	ADJ
abc-4026	62	16	membrane	membrane	NOUN
abc-4026	62	17	extracts	extract	NOUN
abc-4026	62	18	we	we	PRON
abc-4026	62	19	are	be	AUX
abc-4026	62	20	not	not	PART
abc-4026	62	21	able	able	ADJ
abc-4026	62	22	to	to	PART
abc-4026	62	23	properly	properly	ADV
abc-4026	62	24	investigate	investigate	VERB
abc-4026	62	25	the	the	DET
abc-4026	62	26	role	role	NOUN
abc-4026	62	27	of	of	ADP
abc-4026	62	28	trol	trol	NOUN
abc-4026	62	29	in	in	ADP
abc-4026	62	30	the	the	DET
abc-4026	62	31	ie	ie	NOUN
abc-4026	62	32	.	.	PUNCT
abc-4026	63	1	by	by	ADP
abc-4026	63	2	constructing	construct	VERB
abc-4026	63	3	trol	trol	NOUN
abc-4026	63	4	-	-	PUNCT
abc-4026	63	5	ie	ie	ADJ
abc-4026	63	6	plants	plant	NOUN
abc-4026	63	7	we	we	PRON
abc-4026	63	8	will	will	AUX
abc-4026	63	9	be	be	AUX
abc-4026	63	10	able	able	ADJ
abc-4026	63	11	,	,	PUNCT
abc-4026	63	12	for	for	ADP
abc-4026	63	13	the	the	DET
abc-4026	63	14	first	first	ADJ
abc-4026	63	15	time	time	NOUN
abc-4026	63	16	,	,	PUNCT
abc-4026	63	17	to	to	PART
abc-4026	63	18	properly	properly	ADV
abc-4026	63	19	assess	assess	VERB
abc-4026	63	20	the	the	DET
abc-4026	63	21	role	role	NOUN
abc-4026	63	22	/	/	SYM
abc-4026	63	23	s	s	NOUN
abc-4026	63	24	of	of	ADP
abc-4026	63	25	trol	trol	NOUN
abc-4026	63	26	in	in	ADP
abc-4026	63	27	the	the	DET
abc-4026	63	28	ie	ie	NOUN
abc-4026	63	29	and	and	CCONJ
abc-4026	63	30	the	the	DET
abc-4026	63	31	interactions	interaction	NOUN
abc-4026	63	32	with	with	ADP
abc-4026	63	33	its	its	PRON
abc-4026	63	34	ie	ie	ADV
abc-4026	63	35	-	-	PUNCT
abc-4026	63	36	associated	associated	ADJ
abc-4026	63	37	partners	partner	NOUN
abc-4026	63	38	.	.	PUNCT
abc-4026	64	1	materials	material	NOUN
abc-4026	64	2	and	and	CCONJ
abc-4026	64	3	methods	method	NOUN
abc-4026	64	4	plant	plant	NOUN
abc-4026	64	5	material	material	NOUN
abc-4026	64	6	and	and	CCONJ
abc-4026	64	7	breeding	breeding	NOUN
abc-4026	64	8	conditions	condition	NOUN
abc-4026	64	9	several	several	ADJ
abc-4026	64	10	arabidopsis	arabidopsis	NOUN
abc-4026	64	11	lines	line	NOUN
abc-4026	64	12	have	have	AUX
abc-4026	64	13	been	be	AUX
abc-4026	64	14	used	use	VERB
abc-4026	64	15	in	in	ADP
abc-4026	64	16	this	this	DET
abc-4026	64	17	research	research	NOUN
abc-4026	64	18	.	.	PUNCT
abc-4026	65	1	arabidopsis	arabidopsis	NOUN
abc-4026	65	2	thaliana	thaliana	NOUN
abc-4026	65	3	(	(	PUNCT
abc-4026	65	4	l.	l.	PROPN
abc-4026	65	5	)	)	PUNCT
abc-4026	65	6	ecotype	ecotype	PROPN
abc-4026	65	7	columbia	columbia	PROPN
abc-4026	65	8	(	(	PUNCT
abc-4026	65	9	col-0	col-0	NOUN
abc-4026	65	10	)	)	PUNCT
abc-4026	65	11	plants	plant	NOUN
abc-4026	65	12	,	,	PUNCT
abc-4026	65	13	or	or	CCONJ
abc-4026	65	14	wild	wild	ADJ
abc-4026	65	15	-	-	PUNCT
abc-4026	65	16	type	type	NOUN
abc-4026	65	17	(	(	PUNCT
abc-4026	65	18	wt	wt	NOUN
abc-4026	65	19	)	)	PUNCT
abc-4026	65	20	;	;	PUNCT
abc-4026	65	21	trol	trol	NOUN
abc-4026	65	22	knock	knock	VERB
abc-4026	65	23	-	-	PUNCT
abc-4026	65	24	out	out	ADP
abc-4026	65	25	plants	plant	NOUN
abc-4026	65	26	(	(	PUNCT
abc-4026	65	27	ko	ko	PROPN
abc-4026	65	28	)	)	PUNCT
abc-4026	65	29	,	,	PUNCT
abc-4026	65	30	that	that	PRON
abc-4026	65	31	do	do	AUX
abc-4026	65	32	not	not	PART
abc-4026	65	33	accumulate	accumulate	VERB
abc-4026	65	34	protein	protein	NOUN
abc-4026	65	35	trol	trol	NOUN
abc-4026	65	36	due	due	ADP
abc-4026	65	37	to	to	ADP
abc-4026	65	38	the	the	DET
abc-4026	65	39	t	t	PROPN
abc-4026	65	40	-	-	PUNCT
abc-4026	65	41	dna	dna	PROPN
abc-4026	65	42	insertion	insertion	NOUN
abc-4026	65	43	into	into	ADP
abc-4026	65	44	the	the	DET
abc-4026	65	45	gene	gene	NOUN
abc-4026	65	46	at4g01050	at4g01050	PROPN
abc-4026	65	47	(	(	PUNCT
abc-4026	65	48	sail_27_b04	sail_27_b04	PROPN
abc-4026	65	49	,	,	PUNCT
abc-4026	65	50	obtained	obtain	VERB
abc-4026	65	51	from	from	ADP
abc-4026	65	52	nasc	nasc	PROPN
abc-4026	65	53	)	)	PUNCT
abc-4026	65	54	col	col	PROPN
abc-4026	65	55	background	background	NOUN
abc-4026	65	56	(	(	PUNCT
abc-4026	65	57	jurić	jurić	VERB
abc-4026	65	58	et	et	PROPN
abc-4026	65	59	al	al	PROPN
abc-4026	65	60	.	.	PROPN
abc-4026	65	61	2009	2009	NUM
abc-4026	65	62	)	)	PUNCT
abc-4026	65	63	;	;	PUNCT
abc-4026	65	64	trol	trol	NOUN
abc-4026	65	65	overexpression	overexpression	NOUN
abc-4026	65	66	line	line	NOUN
abc-4026	65	67	(	(	PUNCT
abc-4026	65	68	ox	ox	NOUN
abc-4026	65	69	)	)	PUNCT
abc-4026	65	70	that	that	PRON
abc-4026	65	71	was	be	AUX
abc-4026	65	72	constructed	construct	VERB
abc-4026	65	73	by	by	ADP
abc-4026	65	74	transformation	transformation	NOUN
abc-4026	65	75	of	of	ADP
abc-4026	65	76	trol	trol	PROPN
abc-4026	65	77	ko	ko	PROPN
abc-4026	65	78	a.	a.	PROPN
abc-4026	65	79	thaliana	thaliana	PROPN
abc-4026	65	80	plants	plant	NOUN
abc-4026	65	81	with	with	ADP
abc-4026	65	82	the	the	DET
abc-4026	65	83	plasmid	plasmid	ADJ
abc-4026	65	84	vector	vector	NOUN
abc-4026	65	85	ph7wg2.0	ph7wg2.0	PROPN
abc-4026	65	86	(	(	PUNCT
abc-4026	65	87	35s	35	NOUN
abc-4026	65	88	promoter	promoter	NOUN
abc-4026	65	89	)	)	PUNCT
abc-4026	65	90	containing	contain	VERB
abc-4026	65	91	trol	trol	NOUN
abc-4026	65	92	-	-	PUNCT
abc-4026	65	93	ha	ha	INTJ
abc-4026	65	94	-	-	PUNCT
abc-4026	65	95	flag	flag	NOUN
abc-4026	65	96	construct	construct	NOUN
abc-4026	65	97	,	,	PUNCT
abc-4026	65	98	in	in	ADP
abc-4026	65	99	which	which	PRON
abc-4026	65	100	the	the	DET
abc-4026	65	101	ha	ha	INTJ
abc-4026	65	102	and	and	CCONJ
abc-4026	65	103	flag	flag	NOUN
abc-4026	65	104	tags	tag	NOUN
abc-4026	65	105	were	be	AUX
abc-4026	65	106	added	add	VERB
abc-4026	65	107	c	c	NOUN
abc-4026	65	108	-	-	PUNCT
abc-4026	65	109	terminally	terminally	ADV
abc-4026	65	110	(	(	PUNCT
abc-4026	65	111	vojta	vojta	NOUN
abc-4026	65	112	and	and	CCONJ
abc-4026	65	113	fulgosi	fulgosi	NOUN
abc-4026	65	114	2019	2019	NUM
abc-4026	65	115	)	)	PUNCT
abc-4026	65	116	;	;	PUNCT
abc-4026	65	117	and	and	CCONJ
abc-4026	65	118	finally	finally	ADV
abc-4026	65	119	trol	trol	VERB
abc-4026	65	120	-	-	PUNCT
abc-4026	65	121	ie	ie	X
abc-4026	65	122	plants	plant	NOUN
abc-4026	65	123	,	,	PUNCT
abc-4026	65	124	that	that	PRON
abc-4026	65	125	contain	contain	VERB
abc-4026	65	126	trol	trol	NOUN
abc-4026	65	127	only	only	ADV
abc-4026	65	128	in	in	ADP
abc-4026	65	129	the	the	DET
abc-4026	65	130	inner	inner	ADJ
abc-4026	65	131	envelope	envelope	NOUN
abc-4026	65	132	membrane	membrane	NOUN
abc-4026	65	133	of	of	ADP
abc-4026	65	134	chloroplasts	chloroplast	NOUN
abc-4026	65	135	and	and	CCONJ
abc-4026	65	136	were	be	AUX
abc-4026	65	137	constructed	construct	VERB
abc-4026	65	138	in	in	ADP
abc-4026	65	139	this	this	DET
abc-4026	65	140	research	research	NOUN
abc-4026	65	141	.	.	PUNCT
abc-4026	66	1	all	all	DET
abc-4026	66	2	plants	plant	NOUN
abc-4026	66	3	were	be	AUX
abc-4026	66	4	grown	grow	VERB
abc-4026	66	5	under	under	ADP
abc-4026	66	6	16/8h	16/8h	NUM
abc-4026	66	7	light	light	ADJ
abc-4026	66	8	/	/	SYM
abc-4026	66	9	dark	dark	ADJ
abc-4026	66	10	period	period	NOUN
abc-4026	66	11	with	with	ADP
abc-4026	66	12	a	a	DET
abc-4026	66	13	photosynthetic	photosynthetic	ADJ
abc-4026	66	14	light	light	ADJ
abc-4026	66	15	intensity	intensity	NOUN
abc-4026	66	16	of	of	ADP
abc-4026	66	17	25	25	NUM
abc-4026	66	18	μmol	μmol	NOUN
abc-4026	66	19	photons	photon	NOUN
abc-4026	66	20	m−2	m−2	PROPN
abc-4026	66	21	s−1	s−1	PROPN
abc-4026	66	22	(	(	PUNCT
abc-4026	66	23	osram	osram	PROPN
abc-4026	66	24	flora	flora	PROPN
abc-4026	66	25	lamps	lamp	NOUN
abc-4026	66	26	)	)	PUNCT
abc-4026	66	27	at	at	ADP
abc-4026	66	28	22	22	NUM
abc-4026	66	29	°	°	NOUN
abc-4026	66	30	c	c	NOUN
abc-4026	66	31	,	,	PUNCT
abc-4026	66	32	relative	relative	ADJ
abc-4026	66	33	humidity	humidity	NOUN
abc-4026	66	34	60	60	NUM
abc-4026	66	35	%	%	NOUN
abc-4026	66	36	during	during	ADP
abc-4026	66	37	the	the	DET
abc-4026	66	38	day	day	NOUN
abc-4026	66	39	and	and	CCONJ
abc-4026	66	40	70	70	NUM
abc-4026	66	41	%	%	NOUN
abc-4026	66	42	during	during	ADP
abc-4026	66	43	the	the	DET
abc-4026	66	44	night	night	NOUN
abc-4026	66	45	.	.	PUNCT
abc-4026	67	1	plants	plant	NOUN
abc-4026	67	2	were	be	AUX
abc-4026	67	3	grown	grow	VERB
abc-4026	67	4	on	on	ADP
abc-4026	67	5	a	a	DET
abc-4026	67	6	potting	potting	NOUN
abc-4026	67	7	substrate	substrate	NOUN
abc-4026	67	8	(	(	PUNCT
abc-4026	67	9	a400	a400	PROPN
abc-4026	67	10	,	,	PUNCT
abc-4026	67	11	stender	stender	NOUN
abc-4026	67	12	gmbh	gmbh	PROPN
abc-4026	67	13	,	,	PUNCT
abc-4026	67	14	schermbeck	schermbeck	NOUN
abc-4026	67	15	,	,	PUNCT
abc-4026	67	16	germany	germany	PROPN
abc-4026	67	17	)	)	PUNCT
abc-4026	67	18	in	in	ADP
abc-4026	67	19	a	a	DET
abc-4026	67	20	growth	growth	NOUN
abc-4026	67	21	chamber	chamber	NOUN
abc-4026	67	22	(	(	PUNCT
abc-4026	67	23	kambič	kambič	PROPN
abc-4026	67	24	,	,	PUNCT
abc-4026	67	25	slovenia	slovenia	PROPN
abc-4026	67	26	)	)	PUNCT
abc-4026	67	27	.	.	PUNCT
abc-4026	68	1	trol	trol	PROPN
abc-4026	68	2	presequence	presequence	NOUN
abc-4026	68	3	mutagenesis	mutagenesis	NOUN
abc-4026	68	4	using	use	VERB
abc-4026	68	5	the	the	DET
abc-4026	68	6	quikchange	quikchange	NOUN
abc-4026	68	7	multi	multi	NOUN
abc-4026	68	8	site	site	NOUN
abc-4026	68	9	-	-	PUNCT
abc-4026	68	10	directed	direct	VERB
abc-4026	68	11	mutagenesis	mutagenesis	NOUN
abc-4026	68	12	method	method	NOUN
abc-4026	68	13	(	(	PUNCT
abc-4026	68	14	agilent	agilent	PROPN
abc-4026	68	15	technologies	technologies	PROPN
abc-4026	68	16	,	,	PUNCT
abc-4026	68	17	santa	santa	PROPN
abc-4026	68	18	clara	clara	PROPN
abc-4026	68	19	,	,	PUNCT
abc-4026	68	20	california	california	PROPN
abc-4026	68	21	,	,	PUNCT
abc-4026	68	22	united	united	PROPN
abc-4026	68	23	states	states	PROPN
abc-4026	68	24	)	)	PUNCT
abc-4026	68	25	,	,	PUNCT
abc-4026	68	26	67ala	67ala	NOUN
abc-4026	68	27	→	→	SYM
abc-4026	68	28	67ile	67ile	NOUN
abc-4026	68	29	substitution	substitution	NOUN
abc-4026	68	30	was	be	AUX
abc-4026	68	31	introduced	introduce	VERB
abc-4026	68	32	into	into	ADP
abc-4026	68	33	the	the	DET
abc-4026	68	34	trol	trol	NOUN
abc-4026	68	35	presequence	presequence	NOUN
abc-4026	68	36	.	.	PUNCT
abc-4026	69	1	amino	amino	ADJ
abc-4026	69	2	acids	acid	NOUN
abc-4026	69	3	67–78	67–78	NUM
abc-4026	69	4	of	of	ADP
abc-4026	69	5	the	the	DET
abc-4026	69	6	sequence	sequence	NOUN
abc-4026	69	7	of	of	ADP
abc-4026	69	8	trol	trol	NOUN
abc-4026	69	9	,	,	PUNCT
abc-4026	69	10	aksltyeealqq	aksltyeealqq	PROPN
abc-4026	69	11	,	,	PUNCT
abc-4026	69	12	represent	represent	VERB
abc-4026	69	13	a	a	DET
abc-4026	69	14	partially	partially	ADV
abc-4026	69	15	conserved	conserve	VERB
abc-4026	69	16	n	n	CCONJ
abc-4026	69	17	-	-	PUNCT
abc-4026	69	18	terminal	terminal	ADJ
abc-4026	69	19	part	part	NOUN
abc-4026	69	20	of	of	ADP
abc-4026	69	21	the	the	DET
abc-4026	69	22	polypeptide	polypeptide	NOUN
abc-4026	69	23	,	,	PUNCT
abc-4026	69	24	around	around	ADP
abc-4026	69	25	the	the	DET
abc-4026	69	26	predicted	predict	VERB
abc-4026	69	27	transit	transit	NOUN
abc-4026	69	28	peptide	peptide	NOUN
abc-4026	69	29	cleavage	cleavage	NOUN
abc-4026	69	30	site	site	NOUN
abc-4026	69	31	.	.	PUNCT
abc-4026	70	1	the	the	DET
abc-4026	70	2	substitution	substitution	NOUN
abc-4026	70	3	67ala→67ile	67ala→67ile	NOUN
abc-4026	70	4	leads	lead	VERB
abc-4026	70	5	to	to	ADP
abc-4026	70	6	the	the	DET
abc-4026	70	7	absence	absence	NOUN
abc-4026	70	8	of	of	ADP
abc-4026	70	9	processing	processing	NOUN
abc-4026	70	10	of	of	ADP
abc-4026	70	11	the	the	DET
abc-4026	70	12	transit	transit	NOUN
abc-4026	70	13	peptide	peptide	NOUN
abc-4026	70	14	and	and	CCONJ
abc-4026	70	15	the	the	DET
abc-4026	70	16	subsequent	subsequent	ADJ
abc-4026	70	17	arrest	arrest	NOUN
abc-4026	70	18	of	of	ADP
abc-4026	70	19	the	the	DET
abc-4026	70	20	protein	protein	NOUN
abc-4026	70	21	trol	trol	NOUN
abc-4026	70	22	in	in	ADP
abc-4026	70	23	the	the	DET
abc-4026	70	24	inner	inner	ADJ
abc-4026	70	25	envelope	envelope	NOUN
abc-4026	70	26	membrane	membrane	NOUN
abc-4026	70	27	of	of	ADP
abc-4026	70	28	chloroplasts	chloroplast	NOUN
abc-4026	70	29	(	(	PUNCT
abc-4026	70	30	vojta	vojta	NOUN
abc-4026	70	31	et	et	PROPN
abc-4026	70	32	al	al	PROPN
abc-4026	70	33	.	.	PROPN
abc-4026	70	34	2018	2018	NUM
abc-4026	70	35	)	)	PUNCT
abc-4026	70	36	.	.	PUNCT
abc-4026	71	1	besides	besides	SCONJ
abc-4026	71	2	the	the	DET
abc-4026	71	3	ala67	ala67	NOUN
abc-4026	71	4	to	to	ADP
abc-4026	71	5	ile67	ile67	ADJ
abc-4026	71	6	amino	amino	NOUN
abc-4026	71	7	acid	acid	NOUN
abc-4026	71	8	exchange	exchange	NOUN
abc-4026	71	9	flag	flag	NOUN
abc-4026	71	10	(	(	PUNCT
abc-4026	71	11	dykddddk	dykddddk	ADJ
abc-4026	71	12	)	)	PUNCT
abc-4026	71	13	and	and	CCONJ
abc-4026	71	14	ha	ha	INTJ
abc-4026	71	15	(	(	PUNCT
abc-4026	71	16	human	human	ADJ
abc-4026	71	17	influenza	influenza	NOUN
abc-4026	71	18	hemagglutinin	hemagglutinin	NOUN
abc-4026	71	19	,	,	PUNCT
abc-4026	71	20	ypydvpdya	ypydvpdya	PROPN
abc-4026	71	21	)	)	PUNCT
abc-4026	71	22	tags	tag	NOUN
abc-4026	71	23	have	have	AUX
abc-4026	71	24	been	be	AUX
abc-4026	71	25	added	add	VERB
abc-4026	71	26	to	to	ADP
abc-4026	71	27	the	the	DET
abc-4026	71	28	c	c	NOUN
abc-4026	71	29	-	-	PUNCT
abc-4026	71	30	terminus	terminus	NOUN
abc-4026	71	31	of	of	ADP
abc-4026	71	32	the	the	DET
abc-4026	71	33	protein	protein	NOUN
abc-4026	71	34	for	for	ADP
abc-4026	71	35	easier	easy	ADJ
abc-4026	71	36	downstream	downstream	ADJ
abc-4026	71	37	detection	detection	NOUN
abc-4026	71	38	and	and	CCONJ
abc-4026	71	39	purification	purification	NOUN
abc-4026	71	40	.	.	PUNCT
abc-4026	72	1	the	the	DET
abc-4026	72	2	whole	whole	ADJ
abc-4026	72	3	construct	construct	NOUN
abc-4026	72	4	was	be	AUX
abc-4026	72	5	cloned	clone	VERB
abc-4026	72	6	into	into	ADP
abc-4026	72	7	the	the	DET
abc-4026	72	8	ph7wg2.0	ph7wg2.0	PROPN
abc-4026	72	9	vector	vector	NOUN
abc-4026	72	10	under	under	ADP
abc-4026	72	11	the	the	DET
abc-4026	72	12	control	control	NOUN
abc-4026	72	13	of	of	ADP
abc-4026	72	14	35s	35	NOUN
abc-4026	72	15	promoter	promoter	NOUN
abc-4026	72	16	(	(	PUNCT
abc-4026	72	17	vojta	vojta	NOUN
abc-4026	72	18	et	et	PROPN
abc-4026	72	19	al	al	PROPN
abc-4026	72	20	.	.	PROPN
abc-4026	72	21	2018	2018	NUM
abc-4026	72	22	)	)	PUNCT
abc-4026	72	23	.	.	PUNCT
abc-4026	73	1	cultivation	cultivation	NOUN
abc-4026	73	2	of	of	ADP
abc-4026	73	3	agrobacterium	agrobacterium	NOUN
abc-4026	73	4	tumefaciens	tumefacien	NOUN
abc-4026	73	5	bacteria	bacteria	NOUN
abc-4026	73	6	for	for	ADP
abc-4026	73	7	transformation	transformation	NOUN
abc-4026	73	8	competent	competent	ADJ
abc-4026	73	9	agrobacterium	agrobacterium	NOUN
abc-4026	73	10	tumefaciens	tumefacien	NOUN
abc-4026	73	11	eha	eha	PROPN
abc-4026	73	12	105	105	NUM
abc-4026	73	13	bacteria	bacteria	NOUN
abc-4026	73	14	were	be	AUX
abc-4026	73	15	transformed	transform	VERB
abc-4026	73	16	chemically	chemically	ADV
abc-4026	73	17	with	with	ADP
abc-4026	73	18	the	the	DET
abc-4026	73	19	trol(a	trol(a	NOUN
abc-4026	73	20	/	/	SYM
abc-4026	73	21	i)-flag	i)-flag	NOUN
abc-4026	73	22	-	-	PUNCT
abc-4026	73	23	ha	ha	INTJ
abc-4026	73	24	construct	construct	NOUN
abc-4026	73	25	in	in	ADP
abc-4026	73	26	the	the	DET
abc-4026	73	27	binary	binary	ADJ
abc-4026	73	28	vector	vector	NOUN
abc-4026	73	29	ph7wg2.0	ph7wg2.0	PROPN
abc-4026	73	30	.	.	PUNCT
abc-4026	74	1	transformed	transform	VERB
abc-4026	74	2	agrobacteria	agrobacteria	PROPN
abc-4026	74	3	were	be	AUX
abc-4026	74	4	multiplied	multiply	VERB
abc-4026	74	5	by	by	ADP
abc-4026	74	6	growth	growth	NOUN
abc-4026	74	7	in	in	ADP
abc-4026	74	8	liquid	liquid	NOUN
abc-4026	74	9	yeb	yeb	PRON
abc-4026	74	10	medium	medium	NOUN
abc-4026	74	11	with	with	ADP
abc-4026	74	12	addition	addition	NOUN
abc-4026	74	13	of	of	ADP
abc-4026	74	14	rifampicin	rifampicin	NOUN
abc-4026	74	15	and	and	CCONJ
abc-4026	74	16	spectinomycin	spectinomycin	NOUN
abc-4026	74	17	in	in	ADP
abc-4026	74	18	a	a	DET
abc-4026	74	19	horizontal	horizontal	ADJ
abc-4026	74	20	shaker	shaker	NOUN
abc-4026	74	21	at	at	ADP
abc-4026	74	22	28	28	NUM
abc-4026	74	23	°	°	ADP
abc-4026	74	24	c	c	NOUN
abc-4026	74	25	and	and	CCONJ
abc-4026	74	26	250	250	NUM
abc-4026	74	27	rpm	rpm	NOUN
abc-4026	74	28	until	until	ADP
abc-4026	74	29	od600	od600	NOUN
abc-4026	74	30	reached	reach	VERB
abc-4026	74	31	1	1	NUM
abc-4026	74	32	-	-	SYM
abc-4026	74	33	1.5	1.5	NUM
abc-4026	74	34	.	.	PUNCT
abc-4026	75	1	the	the	DET
abc-4026	75	2	bacterial	bacterial	ADJ
abc-4026	75	3	suspension	suspension	NOUN
abc-4026	75	4	was	be	AUX
abc-4026	75	5	then	then	ADV
abc-4026	75	6	transferred	transfer	VERB
abc-4026	75	7	to	to	ADP
abc-4026	75	8	tubes	tube	NOUN
abc-4026	75	9	and	and	CCONJ
abc-4026	75	10	centrifuged	centrifuge	VERB
abc-4026	75	11	for	for	ADP
abc-4026	75	12	15	15	NUM
abc-4026	75	13	min	min	NOUN
abc-4026	75	14	at	at	ADP
abc-4026	75	15	1460	1460	NUM
abc-4026	75	16	g.	g.	X
abc-4026	75	17	the	the	DET
abc-4026	75	18	centrifugation	centrifugation	NOUN
abc-4026	75	19	procedure	procedure	NOUN
abc-4026	75	20	was	be	AUX
abc-4026	75	21	repeated	repeat	VERB
abc-4026	75	22	to	to	PART
abc-4026	75	23	collect	collect	VERB
abc-4026	75	24	the	the	DET
abc-4026	75	25	remaining	remain	VERB
abc-4026	75	26	precipitate	precipitate	NOUN
abc-4026	75	27	.	.	PUNCT
abc-4026	76	1	the	the	DET
abc-4026	76	2	bacterial	bacterial	ADJ
abc-4026	76	3	pellet	pellet	NOUN
abc-4026	76	4	was	be	AUX
abc-4026	76	5	resuspended	resuspend	VERB
abc-4026	76	6	in	in	ADP
abc-4026	76	7	infiltration	infiltration	NOUN
abc-4026	76	8	medium	medium	NOUN
abc-4026	76	9	with	with	ADP
abc-4026	76	10	the	the	DET
abc-4026	76	11	addition	addition	NOUN
abc-4026	76	12	of	of	ADP
abc-4026	76	13	0.03	0.03	NUM
abc-4026	76	14	%	%	NOUN
abc-4026	76	15	(	(	PUNCT
abc-4026	76	16	v	v	NOUN
abc-4026	76	17	/	/	SYM
abc-4026	76	18	v	v	NOUN
abc-4026	76	19	)	)	PUNCT
abc-4026	76	20	of	of	ADP
abc-4026	76	21	the	the	DET
abc-4026	76	22	mild	mild	ADJ
abc-4026	76	23	surfactant	surfactant	NOUN
abc-4026	76	24	silwet	silwet	NOUN
abc-4026	76	25	l-77	l-77	PROPN
abc-4026	76	26	(	(	PUNCT
abc-4026	76	27	momentive	momentive	ADJ
abc-4026	76	28	performance	performance	NOUN
abc-4026	76	29	materials	material	NOUN
abc-4026	76	30	gmbh	gmbh	PROPN
abc-4026	76	31	&	&	CCONJ
abc-4026	76	32	co	co	NOUN
abc-4026	76	33	kg	kg	PROPN
abc-4026	76	34	,	,	PUNCT
abc-4026	76	35	leverkusen	leverkusen	PROPN
abc-4026	76	36	,	,	PUNCT
abc-4026	76	37	germany	germany	PROPN
abc-4026	76	38	)	)	PUNCT
abc-4026	76	39	to	to	PART
abc-4026	76	40	lower	lower	VERB
abc-4026	76	41	surface	surface	NOUN
abc-4026	76	42	tension	tension	NOUN
abc-4026	76	43	and	and	CCONJ
abc-4026	76	44	to	to	PART
abc-4026	76	45	enable	enable	VERB
abc-4026	76	46	bacteria	bacteria	NOUN
abc-4026	76	47	to	to	PART
abc-4026	76	48	enter	enter	VERB
abc-4026	76	49	hard	hard	ADV
abc-4026	76	50	-	-	PUNCT
abc-4026	76	51	to	to	PART
abc-4026	76	52	-	-	PUNCT
abc-4026	76	53	reach	reach	VERB
abc-4026	76	54	parts	part	NOUN
abc-4026	76	55	of	of	ADP
abc-4026	76	56	the	the	DET
abc-4026	76	57	flower	flower	NOUN
abc-4026	76	58	during	during	ADP
abc-4026	76	59	transformation	transformation	NOUN
abc-4026	76	60	by	by	ADP
abc-4026	76	61	“	"	PUNCT
abc-4026	76	62	floral	floral	ADJ
abc-4026	76	63	-	-	PUNCT
abc-4026	76	64	dip	dip	NOUN
abc-4026	76	65	”	"	PUNCT
abc-4026	76	66	method	method	NOUN
abc-4026	76	67	.	.	PUNCT
abc-4026	77	1	cultivation	cultivation	NOUN
abc-4026	77	2	of	of	ADP
abc-4026	77	3	a.	a.	NOUN
abc-4026	77	4	thaliana	thaliana	PROPN
abc-4026	77	5	trol	trol	PROPN
abc-4026	77	6	ko	ko	PROPN
abc-4026	77	7	plants	plant	NOUN
abc-4026	77	8	for	for	ADP
abc-4026	77	9	transformation	transformation	NOUN
abc-4026	77	10	eighteen	eighteen	NUM
abc-4026	77	11	arabidopsis	arabidopsis	NOUN
abc-4026	77	12	trol	trol	NOUN
abc-4026	77	13	ko	ko	PROPN
abc-4026	77	14	plants	plant	NOUN
abc-4026	77	15	were	be	AUX
abc-4026	77	16	grown	grow	VERB
abc-4026	77	17	in	in	ADP
abc-4026	77	18	jars	jar	NOUN
abc-4026	77	19	in	in	ADP
abc-4026	77	20	a	a	DET
abc-4026	77	21	climate	climate	NOUN
abc-4026	77	22	chamber	chamber	NOUN
abc-4026	77	23	as	as	SCONJ
abc-4026	77	24	described	describe	VERB
abc-4026	77	25	.	.	PUNCT
abc-4026	78	1	when	when	SCONJ
abc-4026	78	2	the	the	DET
abc-4026	78	3	plants	plant	NOUN
abc-4026	78	4	began	begin	VERB
abc-4026	78	5	to	to	PART
abc-4026	78	6	develop	develop	VERB
abc-4026	78	7	the	the	DET
abc-4026	78	8	primary	primary	ADJ
abc-4026	78	9	inflorescence	inflorescence	NOUN
abc-4026	78	10	,	,	PUNCT
abc-4026	78	11	it	it	PRON
abc-4026	78	12	was	be	AUX
abc-4026	78	13	necessary	necessary	ADJ
abc-4026	78	14	to	to	PART
abc-4026	78	15	cut	cut	VERB
abc-4026	78	16	it	it	PRON
abc-4026	78	17	at	at	ADP
abc-4026	78	18	the	the	DET
abc-4026	78	19	base	base	NOUN
abc-4026	78	20	,	,	PUNCT
abc-4026	78	21	in	in	ADP
abc-4026	78	22	order	order	NOUN
abc-4026	78	23	to	to	PART
abc-4026	78	24	break	break	VERB
abc-4026	78	25	the	the	DET
abc-4026	78	26	apical	apical	ADJ
abc-4026	78	27	dominance	dominance	NOUN
abc-4026	78	28	and	and	CCONJ
abc-4026	78	29	allow	allow	VERB
abc-4026	78	30	the	the	DET
abc-4026	78	31	development	development	NOUN
abc-4026	78	32	of	of	ADP
abc-4026	78	33	the	the	DET
abc-4026	78	34	secondary	secondary	ADJ
abc-4026	78	35	inflorescence	inflorescence	NOUN
abc-4026	78	36	.	.	PUNCT
abc-4026	79	1	after	after	ADP
abc-4026	79	2	5	5	NUM
abc-4026	79	3	-	-	SYM
abc-4026	79	4	7	7	NUM
abc-4026	79	5	days	day	NOUN
abc-4026	79	6	,	,	PUNCT
abc-4026	79	7	the	the	DET
abc-4026	79	8	stems	stem	NOUN
abc-4026	79	9	with	with	ADP
abc-4026	79	10	the	the	DET
abc-4026	79	11	secondary	secondary	ADJ
abc-4026	79	12	inflorescences	inflorescence	NOUN
abc-4026	79	13	were	be	AUX
abc-4026	79	14	2	2	NUM
abc-4026	79	15	-	-	SYM
abc-4026	79	16	10	10	NUM
abc-4026	79	17	cm	cm	NOUN
abc-4026	79	18	long	long	ADV
abc-4026	79	19	,	,	PUNCT
abc-4026	79	20	representing	represent	VERB
abc-4026	79	21	the	the	DET
abc-4026	79	22	optimal	optimal	ADJ
abc-4026	79	23	stage	stage	NOUN
abc-4026	79	24	for	for	ADP
abc-4026	79	25	transformation	transformation	NOUN
abc-4026	79	26	.	.	PUNCT
abc-4026	80	1	in	in	ADP
abc-4026	80	2	planta	planta	NOUN
abc-4026	80	3	transformation	transformation	NOUN
abc-4026	80	4	of	of	ADP
abc-4026	80	5	a.	a.	NOUN
abc-4026	80	6	thaliana	thaliana	PROPN
abc-4026	80	7	trol	trol	NOUN
abc-4026	80	8	ko	ko	PROPN
abc-4026	80	9	plants	plant	NOUN
abc-4026	80	10	by	by	ADP
abc-4026	80	11	the	the	DET
abc-4026	80	12	"	"	PUNCT
abc-4026	80	13	floral	floral	ADJ
abc-4026	80	14	-	-	PUNCT
abc-4026	80	15	dip	dip	NOUN
abc-4026	80	16	"	"	PUNCT
abc-4026	80	17	method	method	NOUN
abc-4026	80	18	arabidopsis	arabidopsis	NOUN
abc-4026	80	19	plants	plant	NOUN
abc-4026	80	20	with	with	ADP
abc-4026	80	21	developed	developed	ADJ
abc-4026	80	22	secondary	secondary	ADJ
abc-4026	80	23	inflorescences	inflorescence	NOUN
abc-4026	80	24	were	be	AUX
abc-4026	80	25	immersed	immerse	VERB
abc-4026	80	26	in	in	ADP
abc-4026	80	27	a	a	DET
abc-4026	80	28	suspension	suspension	NOUN
abc-4026	80	29	of	of	ADP
abc-4026	80	30	agrobacteria	agrobacteria	PROPN
abc-4026	80	31	transformed	transform	VERB
abc-4026	80	32	with	with	ADP
abc-4026	80	33	the	the	DET
abc-4026	80	34	trol(a	trol(a	NOUN
abc-4026	80	35	/	/	SYM
abc-4026	80	36	i)-flag	i)-flag	NOUN
abc-4026	80	37	-	-	PUNCT
abc-4026	80	38	ha	ha	INTJ
abc-4026	80	39	construct	construct	NOUN
abc-4026	80	40	in	in	ADP
abc-4026	80	41	ph7wg2	ph7wg2	PROPN
abc-4026	80	42	vector	vector	NOUN
abc-4026	80	43	,	,	PUNCT
abc-4026	80	44	without	without	ADP
abc-4026	80	45	using	use	VERB
abc-4026	80	46	a	a	DET
abc-4026	80	47	vacuum	vacuum	NOUN
abc-4026	80	48	(	(	PUNCT
abc-4026	80	49	clough	clough	NOUN
abc-4026	80	50	and	and	CCONJ
abc-4026	80	51	bent	bent	ADJ
abc-4026	80	52	1998	1998	NUM
abc-4026	80	53	)	)	PUNCT
abc-4026	80	54	.	.	PUNCT
abc-4026	81	1	this	this	DET
abc-4026	81	2	way	way	NOUN
abc-4026	81	3	,	,	PUNCT
abc-4026	81	4	the	the	DET
abc-4026	81	5	transformation	transformation	NOUN
abc-4026	81	6	of	of	ADP
abc-4026	81	7	the	the	DET
abc-4026	81	8	entire	entire	ADJ
abc-4026	81	9	plants	plant	NOUN
abc-4026	81	10	or	or	CCONJ
abc-4026	81	11	seeds	seed	NOUN
abc-4026	81	12	occurs	occur	VERB
abc-4026	81	13	,	,	PUNCT
abc-4026	81	14	without	without	ADP
abc-4026	81	15	the	the	DET
abc-4026	81	16	need	need	NOUN
abc-4026	81	17	for	for	ADP
abc-4026	81	18	in	in	ADP
abc-4026	81	19	vitro	vitro	X
abc-4026	81	20	tissue	tissue	NOUN
abc-4026	81	21	culture	culture	NOUN
abc-4026	81	22	.	.	PUNCT
abc-4026	82	1	the	the	DET
abc-4026	82	2	pots	pot	NOUN
abc-4026	82	3	with	with	ADP
abc-4026	82	4	the	the	DET
abc-4026	82	5	plants	plant	NOUN
abc-4026	82	6	were	be	AUX
abc-4026	82	7	turned	turn	VERB
abc-4026	82	8	upside	upside	ADV
abc-4026	82	9	down	down	ADV
abc-4026	82	10	and	and	CCONJ
abc-4026	82	11	the	the	DET
abc-4026	82	12	inflorescences	inflorescence	NOUN
abc-4026	82	13	were	be	AUX
abc-4026	82	14	immersed	immerse	VERB
abc-4026	82	15	in	in	ADP
abc-4026	82	16	a	a	DET
abc-4026	82	17	glass	glass	NOUN
abc-4026	82	18	containing	contain	VERB
abc-4026	82	19	500	500	NUM
abc-4026	82	20	ml	ml	NOUN
abc-4026	82	21	of	of	ADP
abc-4026	82	22	infiltration	infiltration	NOUN
abc-4026	82	23	solution	solution	NOUN
abc-4026	82	24	for	for	ADP
abc-4026	82	25	20	20	NUM
abc-4026	82	26	-	-	SYM
abc-4026	82	27	30	30	NUM
abc-4026	82	28	seconds	second	NOUN
abc-4026	82	29	,	,	PUNCT
abc-4026	82	30	with	with	ADP
abc-4026	82	31	gentle	gentle	ADJ
abc-4026	82	32	stirring	stirring	NOUN
abc-4026	82	33	of	of	ADP
abc-4026	82	34	the	the	DET
abc-4026	82	35	solution	solution	NOUN
abc-4026	82	36	with	with	ADP
abc-4026	82	37	a	a	DET
abc-4026	82	38	glass	glass	NOUN
abc-4026	82	39	rod	rod	NOUN
abc-4026	82	40	.	.	PUNCT
abc-4026	83	1	the	the	DET
abc-4026	83	2	plants	plant	NOUN
abc-4026	83	3	were	be	AUX
abc-4026	83	4	then	then	ADV
abc-4026	83	5	placed	place	VERB
abc-4026	83	6	horizontally	horizontally	ADV
abc-4026	83	7	on	on	ADP
abc-4026	83	8	a	a	DET
abc-4026	83	9	plastic	plastic	ADJ
abc-4026	83	10	mat	mat	NOUN
abc-4026	83	11	,	,	PUNCT
abc-4026	83	12	covered	cover	VERB
abc-4026	83	13	with	with	ADP
abc-4026	83	14	baking	baking	NOUN
abc-4026	83	15	paper	paper	NOUN
abc-4026	83	16	,	,	PUNCT
abc-4026	83	17	and	and	CCONJ
abc-4026	83	18	stored	store	VERB
abc-4026	83	19	overnight	overnight	ADV
abc-4026	83	20	in	in	ADP
abc-4026	83	21	a	a	DET
abc-4026	83	22	climate	climate	NOUN
abc-4026	83	23	chamber	chamber	NOUN
abc-4026	83	24	under	under	ADP
abc-4026	83	25	low	low	ADJ
abc-4026	83	26	light	light	ADJ
abc-4026	83	27	conditions	condition	NOUN
abc-4026	83	28	.	.	PUNCT
abc-4026	84	1	on	on	ADP
abc-4026	84	2	the	the	DET
abc-4026	84	3	next	next	ADJ
abc-4026	84	4	day	day	NOUN
abc-4026	84	5	,	,	PUNCT
abc-4026	84	6	the	the	DET
abc-4026	84	7	jars	jar	NOUN
abc-4026	84	8	with	with	ADP
abc-4026	84	9	the	the	DET
abc-4026	84	10	plants	plant	NOUN
abc-4026	84	11	were	be	AUX
abc-4026	84	12	placed	place	VERB
abc-4026	84	13	upright	upright	ADJ
abc-4026	84	14	,	,	PUNCT
abc-4026	84	15	filled	fill	VERB
abc-4026	84	16	with	with	ADP
abc-4026	84	17	water	water	NOUN
abc-4026	84	18	,	,	PUNCT
abc-4026	84	19	and	and	CCONJ
abc-4026	84	20	exposed	expose	VERB
abc-4026	84	21	to	to	ADP
abc-4026	84	22	light	light	NOUN
abc-4026	84	23	(	(	PUNCT
abc-4026	84	24	~25	~25	NOUN
abc-4026	84	25	μmol	μmol	NOUN
abc-4026	84	26	photons	photon	NOUN
abc-4026	84	27	m-2	m-2	VERB
abc-4026	84	28	s-1	s-1	NOUN
abc-4026	84	29	)	)	PUNCT
abc-4026	84	30	.	.	PUNCT
abc-4026	85	1	the	the	DET
abc-4026	85	2	floral	floral	ADJ
abc-4026	85	3	-	-	PUNCT
abc-4026	85	4	dip	dip	NOUN
abc-4026	85	5	procedure	procedure	NOUN
abc-4026	85	6	was	be	AUX
abc-4026	85	7	repeated	repeat	VERB
abc-4026	85	8	after	after	ADP
abc-4026	85	9	8	8	NUM
abc-4026	85	10	days	day	NOUN
abc-4026	85	11	.	.	PUNCT
abc-4026	86	1	the	the	DET
abc-4026	86	2	plants	plant	NOUN
abc-4026	86	3	were	be	AUX
abc-4026	86	4	watered	water	VERB
abc-4026	86	5	for	for	ADP
abc-4026	86	6	the	the	DET
abc-4026	86	7	next	next	ADJ
abc-4026	86	8	two	two	NUM
abc-4026	86	9	weeks	week	NOUN
abc-4026	86	10	,	,	PUNCT
abc-4026	86	11	then	then	ADV
abc-4026	86	12	the	the	DET
abc-4026	86	13	watering	watering	NOUN
abc-4026	86	14	was	be	AUX
abc-4026	86	15	stopped	stop	VERB
abc-4026	86	16	,	,	PUNCT
abc-4026	86	17	and	and	CCONJ
abc-4026	86	18	the	the	DET
abc-4026	86	19	plants	plant	NOUN
abc-4026	86	20	were	be	AUX
abc-4026	86	21	allowed	allow	VERB
abc-4026	86	22	to	to	PART
abc-4026	86	23	dry	dry	VERB
abc-4026	86	24	in	in	ADP
abc-4026	86	25	order	order	NOUN
abc-4026	86	26	to	to	PART
abc-4026	86	27	collect	collect	VERB
abc-4026	86	28	the	the	DET
abc-4026	86	29	seeds	seed	NOUN
abc-4026	86	30	.	.	PUNCT
abc-4026	87	1	seeds	seed	NOUN
abc-4026	87	2	from	from	ADP
abc-4026	87	3	each	each	PRON
abc-4026	87	4	of	of	ADP
abc-4026	87	5	the	the	DET
abc-4026	87	6	transformed	transform	VERB
abc-4026	87	7	plants	plant	NOUN
abc-4026	87	8	were	be	AUX
abc-4026	87	9	collected	collect	VERB
abc-4026	87	10	separately	separately	ADV
abc-4026	87	11	,	,	PUNCT
abc-4026	87	12	and	and	CCONJ
abc-4026	87	13	represented	represent	VERB
abc-4026	87	14	the	the	DET
abc-4026	87	15	t1	t1	NOUN
abc-4026	87	16	generation	generation	NOUN
abc-4026	87	17	of	of	ADP
abc-4026	87	18	the	the	DET
abc-4026	87	19	transformants	transformant	NOUN
abc-4026	87	20	.	.	PUNCT
abc-4026	88	1	selection	selection	NOUN
abc-4026	88	2	of	of	ADP
abc-4026	88	3	transformed	transform	VERB
abc-4026	88	4	a.	a.	NOUN
abc-4026	88	5	thaliana	thaliana	NOUN
abc-4026	88	6	seeds	seed	NOUN
abc-4026	88	7	sterilization	sterilization	NOUN
abc-4026	88	8	of	of	ADP
abc-4026	88	9	the	the	DET
abc-4026	88	10	seeds	seed	NOUN
abc-4026	88	11	was	be	AUX
abc-4026	88	12	carried	carry	VERB
abc-4026	88	13	out	out	ADP
abc-4026	88	14	using	use	VERB
abc-4026	88	15	70	70	NUM
abc-4026	88	16	%	%	NOUN
abc-4026	88	17	etoh	etoh	NOUN
abc-4026	88	18	and	and	CCONJ
abc-4026	88	19	0.05	0.05	NUM
abc-4026	88	20	%	%	NOUN
abc-4026	88	21	triton	triton	PROPN
abc-4026	88	22	x-100	x-100	PROPN
abc-4026	88	23	.	.	PUNCT
abc-4026	89	1	seeds	seed	NOUN
abc-4026	89	2	were	be	AUX
abc-4026	89	3	mixed	mix	VERB
abc-4026	89	4	in	in	ADP
abc-4026	89	5	the	the	DET
abc-4026	89	6	solution	solution	NOUN
abc-4026	89	7	by	by	ADP
abc-4026	89	8	shaking	shake	VERB
abc-4026	89	9	for	for	ADP
abc-4026	89	10	5	5	NUM
abc-4026	89	11	min	min	NOUN
abc-4026	89	12	.	.	PROPN
abc-4026	89	13	supernatant	supernatant	PROPN
abc-4026	89	14	was	be	AUX
abc-4026	89	15	discarded	discard	VERB
abc-4026	89	16	,	,	PUNCT
abc-4026	89	17	followed	follow	VERB
abc-4026	89	18	by	by	ADP
abc-4026	89	19	subsequent	subsequent	ADJ
abc-4026	89	20	incubation	incubation	NOUN
abc-4026	89	21	with	with	ADP
abc-4026	89	22	70	70	NUM
abc-4026	89	23	%	%	NOUN
abc-4026	89	24	etoh	etoh	NOUN
abc-4026	89	25	for	for	ADP
abc-4026	89	26	10	10	NUM
abc-4026	89	27	min	min	NOUN
abc-4026	89	28	.	.	PUNCT
abc-4026	90	1	the	the	DET
abc-4026	90	2	sterilization	sterilization	NOUN
abc-4026	90	3	was	be	AUX
abc-4026	90	4	finished	finish	VERB
abc-4026	90	5	by	by	ADP
abc-4026	90	6	raising	raise	VERB
abc-4026	90	7	the	the	DET
abc-4026	90	8	seeds	seed	NOUN
abc-4026	90	9	in	in	ADP
abc-4026	90	10	sterile	sterile	ADJ
abc-4026	90	11	water	water	NOUN
abc-4026	90	12	.	.	PUNCT
abc-4026	91	1	following	follow	VERB
abc-4026	91	2	surface	surface	NOUN
abc-4026	91	3	sterilization	sterilization	NOUN
abc-4026	91	4	,	,	PUNCT
abc-4026	91	5	seeds	seed	NOUN
abc-4026	91	6	were	be	AUX
abc-4026	91	7	selected	select	VERB
abc-4026	91	8	for	for	ADP
abc-4026	91	9	hygromycin	hygromycin	PRON
abc-4026	91	10	resistance	resistance	NOUN
abc-4026	91	11	on	on	ADP
abc-4026	91	12	solid	solid	ADJ
abc-4026	91	13	ms	ms	NOUN
abc-4026	91	14	medium	medium	ADJ
abc-4026	91	15	(	(	PUNCT
abc-4026	91	16	moorashige	moorashige	NOUN
abc-4026	91	17	and	and	CCONJ
abc-4026	91	18	skoog	skoog	NOUN
abc-4026	91	19	basal	basal	VERB
abc-4026	91	20	salt	salt	NOUN
abc-4026	91	21	mixture	mixture	NOUN
abc-4026	91	22	,	,	PUNCT
abc-4026	91	23	sigma	sigma	PROPN
abc-4026	91	24	)	)	PUNCT
abc-4026	91	25	containing	contain	VERB
abc-4026	91	26	15µg	15µg	ADJ
abc-4026	91	27	/	/	SYM
abc-4026	91	28	ml	ml	NOUN
abc-4026	91	29	hygromycin	hygromycin	PROPN
abc-4026	91	30	.	.	PUNCT
abc-4026	92	1	seeds	seed	NOUN
abc-4026	92	2	were	be	AUX
abc-4026	92	3	stratified	stratify	VERB
abc-4026	92	4	for	for	ADP
abc-4026	92	5	2	2	NUM
abc-4026	92	6	days	day	NOUN
abc-4026	92	7	in	in	ADP
abc-4026	92	8	the	the	DET
abc-4026	92	9	dark	dark	NOUN
abc-4026	92	10	at	at	ADP
abc-4026	92	11	4	4	NUM
abc-4026	92	12	°	°	ADP
abc-4026	92	13	c	c	NOUN
abc-4026	92	14	and	and	CCONJ
abc-4026	92	15	then	then	ADV
abc-4026	92	16	transferred	transfer	VERB
abc-4026	92	17	to	to	ADP
abc-4026	92	18	the	the	DET
abc-4026	92	19	growth	growth	NOUN
abc-4026	92	20	chamber	chamber	NOUN
abc-4026	92	21	for	for	ADP
abc-4026	92	22	4	4	NUM
abc-4026	92	23	-	-	SYM
abc-4026	92	24	6	6	NUM
abc-4026	92	25	h	h	NOUN
abc-4026	92	26	at	at	ADP
abc-4026	92	27	22	22	NUM
abc-4026	92	28	°	°	NOUN
abc-4026	92	29	c	c	NOUN
abc-4026	92	30	in	in	ADP
abc-4026	92	31	continuous	continuous	ADJ
abc-4026	92	32	light	light	NOUN
abc-4026	92	33	(	(	PUNCT
abc-4026	92	34	par	par	NOUN
abc-4026	92	35	25	25	NUM
abc-4026	92	36	µmol	µmol	PROPN
abc-4026	92	37	photons	photon	NOUN
abc-4026	92	38	m–2	m–2	NOUN
abc-4026	92	39	s–1	s–1	NOUN
abc-4026	92	40	)	)	PUNCT
abc-4026	92	41	to	to	PART
abc-4026	92	42	stimulate	stimulate	VERB
abc-4026	92	43	germination	germination	NOUN
abc-4026	92	44	.	.	PUNCT
abc-4026	93	1	plates	plate	NOUN
abc-4026	93	2	were	be	AUX
abc-4026	93	3	dual	dual	ADJ
abc-4026	93	4	to	to	ADP
abc-4026	93	5	single	single	ADJ
abc-4026	93	6	localization	localization	NOUN
abc-4026	93	7	exchange	exchange	NOUN
abc-4026	93	8	of	of	ADP
abc-4026	93	9	trol	trol	NOUN
abc-4026	93	10	protein	protein	NOUN
abc-4026	93	11	acta	acta	PROPN
abc-4026	93	12	bot	bot	PROPN
abc-4026	93	13	.	.	PUNCT
abc-4026	94	1	croat	croat	PROPN
abc-4026	94	2	.	.	PUNCT
abc-4026	95	1	84	84	NUM
abc-4026	95	2	(	(	PUNCT
abc-4026	95	3	2	2	NUM
abc-4026	95	4	)	)	PUNCT
abc-4026	95	5	,	,	PUNCT
abc-4026	95	6	2025	2025	NUM
abc-4026	95	7	259	259	NUM
abc-4026	95	8	wrapped	wrap	VERB
abc-4026	95	9	in	in	ADP
abc-4026	95	10	aluminum	aluminum	NOUN
abc-4026	95	11	foil	foil	NOUN
abc-4026	95	12	and	and	CCONJ
abc-4026	95	13	incubated	incubate	VERB
abc-4026	95	14	for	for	ADP
abc-4026	95	15	2	2	NUM
abc-4026	95	16	days	day	NOUN
abc-4026	95	17	at	at	ADP
abc-4026	95	18	22	22	NUM
abc-4026	95	19	°	°	NOUN
abc-4026	95	20	c	c	NOUN
abc-4026	95	21	.	.	PUNCT
abc-4026	96	1	the	the	DET
abc-4026	96	2	foil	foil	NOUN
abc-4026	96	3	was	be	AUX
abc-4026	96	4	then	then	ADV
abc-4026	96	5	removed	remove	VERB
abc-4026	96	6	,	,	PUNCT
abc-4026	96	7	and	and	CCONJ
abc-4026	96	8	seeds	seed	NOUN
abc-4026	96	9	were	be	AUX
abc-4026	96	10	incubated	incubate	VERB
abc-4026	96	11	for	for	ADP
abc-4026	96	12	a	a	DET
abc-4026	96	13	further	further	ADJ
abc-4026	96	14	48	48	NUM
abc-4026	96	15	h	h	NOUN
abc-4026	96	16	in	in	ADP
abc-4026	96	17	continuous	continuous	ADJ
abc-4026	96	18	light	light	NOUN
abc-4026	96	19	(	(	PUNCT
abc-4026	96	20	par	par	NOUN
abc-4026	96	21	25	25	NUM
abc-4026	96	22	µmol	µmol	PROPN
abc-4026	96	23	photons	photon	NOUN
abc-4026	96	24	m–2	m–2	NOUN
abc-4026	96	25	s–1	s–1	NOUN
abc-4026	96	26	)	)	PUNCT
abc-4026	96	27	.	.	PUNCT
abc-4026	97	1	seedlings	seedling	NOUN
abc-4026	97	2	with	with	ADP
abc-4026	97	3	short	short	ADJ
abc-4026	97	4	hypocotyls	hypocotyls	NOUN
abc-4026	97	5	were	be	AUX
abc-4026	97	6	dismissed	dismiss	VERB
abc-4026	97	7	,	,	PUNCT
abc-4026	97	8	while	while	SCONJ
abc-4026	97	9	those	those	PRON
abc-4026	97	10	with	with	ADP
abc-4026	97	11	long	long	ADJ
abc-4026	97	12	hypocotyls	hypocotyls	NOUN
abc-4026	97	13	were	be	AUX
abc-4026	97	14	transferred	transfer	VERB
abc-4026	97	15	to	to	ADP
abc-4026	97	16	the	the	DET
abc-4026	97	17	soil	soil	NOUN
abc-4026	97	18	to	to	PART
abc-4026	97	19	produce	produce	VERB
abc-4026	97	20	t1	t1	NOUN
abc-4026	97	21	plants	plant	NOUN
abc-4026	97	22	and	and	CCONJ
abc-4026	97	23	t2	t2	NOUN
abc-4026	97	24	seeds	seed	NOUN
abc-4026	97	25	.	.	PUNCT
abc-4026	98	1	the	the	DET
abc-4026	98	2	t2	t2	NOUN
abc-4026	98	3	seeds	seed	NOUN
abc-4026	98	4	were	be	AUX
abc-4026	98	5	selected	select	VERB
abc-4026	98	6	by	by	ADP
abc-4026	98	7	transferring	transfer	VERB
abc-4026	98	8	seeds	seed	NOUN
abc-4026	98	9	from	from	ADP
abc-4026	98	10	each	each	DET
abc-4026	98	11	individual	individual	ADJ
abc-4026	98	12	plant	plant	NOUN
abc-4026	98	13	to	to	ADP
abc-4026	98	14	the	the	DET
abc-4026	98	15	ms	ms	PROPN
abc-4026	98	16	medium	medium	PROPN
abc-4026	98	17	+	+	ADP
abc-4026	98	18	hygromycin	hygromycin	PRON
abc-4026	98	19	and	and	CCONJ
abc-4026	98	20	treated	treat	VERB
abc-4026	98	21	as	as	SCONJ
abc-4026	98	22	described	describe	VERB
abc-4026	98	23	previously	previously	ADV
abc-4026	98	24	.	.	PUNCT
abc-4026	99	1	only	only	ADV
abc-4026	99	2	seeds	seed	NOUN
abc-4026	99	3	from	from	ADP
abc-4026	99	4	t1	t1	NOUN
abc-4026	99	5	plants	plant	NOUN
abc-4026	99	6	(	(	PUNCT
abc-4026	99	7	t2	t2	NOUN
abc-4026	99	8	seeds	seed	NOUN
abc-4026	99	9	)	)	PUNCT
abc-4026	99	10	that	that	PRON
abc-4026	99	11	produced	produce	VERB
abc-4026	99	12	70	70	NUM
abc-4026	99	13	%	%	NOUN
abc-4026	99	14	seedlings	seedling	NOUN
abc-4026	99	15	with	with	ADP
abc-4026	99	16	long	long	ADJ
abc-4026	99	17	hypocotyls	hypocotyls	NOUN
abc-4026	99	18	and	and	CCONJ
abc-4026	99	19	30	30	NUM
abc-4026	99	20	%	%	NOUN
abc-4026	99	21	with	with	ADP
abc-4026	99	22	short	short	ADJ
abc-4026	99	23	ones	one	NOUN
abc-4026	99	24	were	be	AUX
abc-4026	99	25	used	use	VERB
abc-4026	99	26	in	in	ADP
abc-4026	99	27	further	further	ADJ
abc-4026	99	28	selection	selection	NOUN
abc-4026	99	29	steps	step	NOUN
abc-4026	99	30	.	.	PUNCT
abc-4026	100	1	they	they	PRON
abc-4026	100	2	developed	develop	VERB
abc-4026	100	3	into	into	ADP
abc-4026	100	4	t2	t2	NOUN
abc-4026	100	5	plants	plant	NOUN
abc-4026	100	6	and	and	CCONJ
abc-4026	100	7	their	their	PRON
abc-4026	100	8	t3	t3	NOUN
abc-4026	100	9	seeds	seed	NOUN
abc-4026	100	10	were	be	AUX
abc-4026	100	11	further	far	ADV
abc-4026	100	12	selected	select	VERB
abc-4026	100	13	on	on	ADP
abc-4026	100	14	selective	selective	ADJ
abc-4026	100	15	hygromycin	hygromycin	PROPN
abc-4026	100	16	plates	plate	NOUN
abc-4026	100	17	.	.	PUNCT
abc-4026	101	1	only	only	ADV
abc-4026	101	2	those	those	PRON
abc-4026	101	3	with	with	ADP
abc-4026	101	4	all	all	DET
abc-4026	101	5	long	long	ADJ
abc-4026	101	6	hypocotyls	hypocotyls	NOUN
abc-4026	101	7	were	be	AUX
abc-4026	101	8	supposed	suppose	VERB
abc-4026	101	9	to	to	PART
abc-4026	101	10	be	be	AUX
abc-4026	101	11	homozygous	homozygous	ADJ
abc-4026	101	12	for	for	ADP
abc-4026	101	13	the	the	DET
abc-4026	101	14	ala67ile67	ala67ile67	PROPN
abc-4026	101	15	mutation	mutation	NOUN
abc-4026	101	16	and	and	CCONJ
abc-4026	101	17	were	be	AUX
abc-4026	101	18	used	use	VERB
abc-4026	101	19	further	far	ADV
abc-4026	101	20	.	.	PUNCT
abc-4026	102	1	t3	t3	NOUN
abc-4026	102	2	seeds	seed	NOUN
abc-4026	102	3	and	and	CCONJ
abc-4026	102	4	plants	plant	NOUN
abc-4026	102	5	were	be	AUX
abc-4026	102	6	tested	test	VERB
abc-4026	102	7	by	by	ADP
abc-4026	102	8	pcr	pcr	PROPN
abc-4026	102	9	,	,	PUNCT
abc-4026	102	10	dna	dna	NOUN
abc-4026	102	11	sequencing	sequence	VERB
abc-4026	102	12	and	and	CCONJ
abc-4026	102	13	western	western	ADJ
abc-4026	102	14	blotting	blotting	NOUN
abc-4026	102	15	.	.	PUNCT
abc-4026	103	1	dna	dna	PROPN
abc-4026	103	2	isolation	isolation	NOUN
abc-4026	103	3	was	be	AUX
abc-4026	103	4	performed	perform	VERB
abc-4026	103	5	using	use	VERB
abc-4026	103	6	phire	phire	NOUN
abc-4026	103	7	plant	plant	NOUN
abc-4026	103	8	direct	direct	ADJ
abc-4026	103	9	pcr	pcr	NOUN
abc-4026	103	10	kit	kit	NOUN
abc-4026	103	11	(	(	PUNCT
abc-4026	103	12	thermo	thermo	NOUN
abc-4026	103	13	scientific	scientific	ADJ
abc-4026	103	14	™	™	NOUN
abc-4026	103	15	)	)	PUNCT
abc-4026	103	16	,	,	PUNCT
abc-4026	103	17	and	and	CCONJ
abc-4026	103	18	pcr	pcr	NOUN
abc-4026	103	19	was	be	AUX
abc-4026	103	20	performed	perform	VERB
abc-4026	103	21	using	use	VERB
abc-4026	103	22	the	the	DET
abc-4026	103	23	forward	forward	ADJ
abc-4026	103	24	primer	primer	NOUN
abc-4026	103	25	for	for	ADP
abc-4026	103	26	trol	trol	NOUN
abc-4026	103	27	(	(	PUNCT
abc-4026	103	28	5	5	NUM
abc-4026	103	29	’	'	PUNCT
abc-4026	103	30	ggaattcatggaagctctgaaaaccgca	ggaattcatggaagctctgaaaaccgca	NOUN
abc-4026	103	31	3	3	NUM
abc-4026	103	32	’	'	PUNCT
abc-4026	103	33	)	)	PUNCT
abc-4026	103	34	and	and	CCONJ
abc-4026	103	35	the	the	DET
abc-4026	103	36	reverse	reverse	ADJ
abc-4026	103	37	primer	primer	NOUN
abc-4026	103	38	for	for	ADP
abc-4026	103	39	flag_linker_ha	flag_linker_ha	NOUN
abc-4026	103	40	tag	tag	NOUN
abc-4026	103	41	(	(	PUNCT
abc-4026	103	42	5	5	NUM
abc-4026	103	43	’	'	PUNCT
abc-4026	103	44	cttgtagtctaacttgacagcagcagcgta	cttgtagtctaacttgacagcagcagcgta	NOUN
abc-4026	103	45	)	)	PUNCT
abc-4026	103	46	.	.	PUNCT
abc-4026	104	1	this	this	DET
abc-4026	104	2	way	way	NOUN
abc-4026	104	3	,	,	PUNCT
abc-4026	104	4	only	only	ADV
abc-4026	104	5	trol	trol	NOUN
abc-4026	104	6	from	from	ADP
abc-4026	104	7	the	the	DET
abc-4026	104	8	transformed	transform	VERB
abc-4026	104	9	plants	plant	NOUN
abc-4026	104	10	(	(	PUNCT
abc-4026	104	11	containing	contain	VERB
abc-4026	104	12	flag	flag	NOUN
abc-4026	104	13	and	and	CCONJ
abc-4026	104	14	ha	ha	INTJ
abc-4026	104	15	tags	tag	NOUN
abc-4026	104	16	on	on	ADP
abc-4026	104	17	the	the	DET
abc-4026	104	18	3	3	NUM
abc-4026	104	19	’	'	PUNCT
abc-4026	104	20	end	end	NOUN
abc-4026	104	21	of	of	ADP
abc-4026	104	22	the	the	DET
abc-4026	104	23	gene	gene	NOUN
abc-4026	104	24	)	)	PUNCT
abc-4026	104	25	should	should	AUX
abc-4026	104	26	multiply	multiply	VERB
abc-4026	104	27	.	.	PUNCT
abc-4026	105	1	western	western	ADJ
abc-4026	105	2	blotting	blotting	ADJ
abc-4026	105	3	analyses	analysis	NOUN
abc-4026	105	4	were	be	AUX
abc-4026	105	5	performed	perform	VERB
abc-4026	105	6	on	on	ADP
abc-4026	105	7	total	total	ADJ
abc-4026	105	8	leaf	leaf	NOUN
abc-4026	105	9	extracts	extract	NOUN
abc-4026	105	10	,	,	PUNCT
abc-4026	105	11	intact	intact	ADJ
abc-4026	105	12	chloroplasts	chloroplast	NOUN
abc-4026	105	13	,	,	PUNCT
abc-4026	105	14	and	and	CCONJ
abc-4026	105	15	chloroplast	chloroplast	NOUN
abc-4026	105	16	membranes	membrane	NOUN
abc-4026	105	17	from	from	ADP
abc-4026	105	18	t2	t2	NOUN
abc-4026	105	19	plants	plant	NOUN
abc-4026	105	20	by	by	ADP
abc-4026	105	21	using	use	VERB
abc-4026	105	22	anti	anti	ADJ
abc-4026	105	23	-	-	NOUN
abc-4026	105	24	trol	trol	ADJ
abc-4026	105	25	(	(	PUNCT
abc-4026	105	26	1:2000	1:2000	NUM
abc-4026	105	27	,	,	PUNCT
abc-4026	105	28	agrisera	agrisera	NOUN
abc-4026	105	29	as194257	as194257	NOUN
abc-4026	105	30	)	)	PUNCT
abc-4026	105	31	and	and	CCONJ
abc-4026	105	32	anti	anti	ADJ
abc-4026	105	33	-	-	ADJ
abc-4026	105	34	ha	ha	INTJ
abc-4026	105	35	antibodies	antibody	NOUN
abc-4026	105	36	(	(	PUNCT
abc-4026	105	37	1:1000	1:1000	NUM
abc-4026	105	38	,	,	PUNCT
abc-4026	105	39	sigma	sigma	NOUN
abc-4026	105	40	h9658	h9658	NOUN
abc-4026	105	41	)	)	PUNCT
abc-4026	105	42	and	and	CCONJ
abc-4026	105	43	anti	anti	ADJ
abc-4026	105	44	-	-	ADJ
abc-4026	105	45	rabbit	rabbit	ADJ
abc-4026	105	46	igg	igg	PROPN
abc-4026	105	47	peroxidase	peroxidase	NOUN
abc-4026	105	48	(	(	PUNCT
abc-4026	105	49	1:50000	1:50000	NUM
abc-4026	105	50	,	,	PUNCT
abc-4026	105	51	sigma	sigma	PROPN
abc-4026	105	52	a0545	a0545	PROPN
abc-4026	105	53	)	)	PUNCT
abc-4026	105	54	as	as	ADP
abc-4026	105	55	a	a	DET
abc-4026	105	56	secondary	secondary	ADJ
abc-4026	105	57	antibody	antibody	NOUN
abc-4026	105	58	for	for	ADP
abc-4026	105	59	anti	anti	ADJ
abc-4026	105	60	-	-	NOUN
abc-4026	105	61	trol	trol	ADJ
abc-4026	105	62	,	,	PUNCT
abc-4026	105	63	and	and	CCONJ
abc-4026	105	64	anti	anti	ADJ
abc-4026	105	65	-	-	ADJ
abc-4026	105	66	rat	rat	ADJ
abc-4026	105	67	igg	igg	PROPN
abc-4026	105	68	peroxidase	peroxidase	NOUN
abc-4026	105	69	(	(	PUNCT
abc-4026	105	70	1:30000	1:30000	NUM
abc-4026	105	71	,	,	PUNCT
abc-4026	105	72	sigma	sigma	NOUN
abc-4026	105	73	a9073	a9073	NOUN
abc-4026	105	74	)	)	PUNCT
abc-4026	105	75	as	as	SCONJ
abc-4026	105	76	a	a	DET
abc-4026	105	77	secondary	secondary	ADJ
abc-4026	105	78	antibody	antibody	NOUN
abc-4026	105	79	for	for	ADP
abc-4026	105	80	anti	anti	ADJ
abc-4026	105	81	-	-	ADJ
abc-4026	105	82	ha	ha	INTJ
abc-4026	105	83	.	.	NOUN
abc-4026	105	84	plants	plant	NOUN
abc-4026	105	85	with	with	ADP
abc-4026	105	86	a	a	DET
abc-4026	105	87	stronger	strong	ADJ
abc-4026	105	88	signal	signal	NOUN
abc-4026	105	89	that	that	PRON
abc-4026	105	90	were	be	AUX
abc-4026	105	91	also	also	ADV
abc-4026	105	92	pcr	pcr	ADJ
abc-4026	105	93	-	-	ADJ
abc-4026	105	94	positive	positive	ADJ
abc-4026	105	95	were	be	AUX
abc-4026	105	96	used	use	VERB
abc-4026	105	97	for	for	ADP
abc-4026	105	98	further	further	ADJ
abc-4026	105	99	investigations	investigation	NOUN
abc-4026	105	100	.	.	PUNCT
abc-4026	106	1	those	those	PRON
abc-4026	106	2	were	be	AUX
abc-4026	106	3	plants	plant	NOUN
abc-4026	106	4	enumerated	enumerate	VERB
abc-4026	106	5	8	8	NUM
abc-4026	106	6	and	and	CCONJ
abc-4026	106	7	18	18	NUM
abc-4026	106	8	.	.	PUNCT
abc-4026	107	1	their	their	PRON
abc-4026	107	2	sequence	sequence	NOUN
abc-4026	107	3	(	(	PUNCT
abc-4026	107	4	mutation	mutation	NOUN
abc-4026	107	5	ala67	ala67	NOUN
abc-4026	107	6	to	to	ADP
abc-4026	107	7	ile67	ile67	PROPN
abc-4026	107	8	gct	gct	PROPN
abc-4026	107	9	to	to	ADP
abc-4026	107	10	att	att	PROPN
abc-4026	107	11	and	and	CCONJ
abc-4026	107	12	c	c	NOUN
abc-4026	107	13	-	-	PUNCT
abc-4026	107	14	terminal	terminal	ADJ
abc-4026	107	15	tags	tag	NOUN
abc-4026	107	16	)	)	PUNCT
abc-4026	107	17	was	be	AUX
abc-4026	107	18	also	also	ADV
abc-4026	107	19	successfully	successfully	ADV
abc-4026	107	20	checked	check	VERB
abc-4026	107	21	and	and	CCONJ
abc-4026	107	22	confirmed	confirm	VERB
abc-4026	107	23	by	by	ADP
abc-4026	107	24	dna	dna	PROPN
abc-4026	107	25	sequencing	sequencing	NOUN
abc-4026	107	26	.	.	PUNCT
abc-4026	108	1	therefore	therefore	ADV
abc-4026	108	2	,	,	PUNCT
abc-4026	108	3	the	the	DET
abc-4026	108	4	two	two	NUM
abc-4026	108	5	mutant	mutant	ADJ
abc-4026	108	6	lines	line	NOUN
abc-4026	108	7	used	use	VERB
abc-4026	108	8	in	in	ADP
abc-4026	108	9	this	this	DET
abc-4026	108	10	study	study	NOUN
abc-4026	108	11	were	be	AUX
abc-4026	108	12	designated	designate	VERB
abc-4026	108	13	trol	trol	NOUN
abc-4026	108	14	-	-	PUNCT
abc-4026	108	15	ie8	ie8	NOUN
abc-4026	108	16	and	and	CCONJ
abc-4026	108	17	trolie18	trolie18	NOUN
abc-4026	108	18	,	,	PUNCT
abc-4026	108	19	and	and	CCONJ
abc-4026	108	20	these	these	DET
abc-4026	108	21	two	two	NUM
abc-4026	108	22	lines	line	NOUN
abc-4026	108	23	were	be	AUX
abc-4026	108	24	used	use	VERB
abc-4026	108	25	for	for	ADP
abc-4026	108	26	future	future	ADJ
abc-4026	108	27	experiments	experiment	NOUN
abc-4026	108	28	.	.	PUNCT
abc-4026	109	1	production	production	NOUN
abc-4026	109	2	of	of	ADP
abc-4026	109	3	the	the	DET
abc-4026	109	4	pretrol	pretrol	NOUN
abc-4026	109	5	antiserum	antiserum	VERB
abc-4026	109	6	the	the	DET
abc-4026	109	7	first	first	ADJ
abc-4026	109	8	66	66	NUM
abc-4026	109	9	aminoacids	aminoacid	NOUN
abc-4026	109	10	of	of	ADP
abc-4026	109	11	the	the	DET
abc-4026	109	12	presequence	presequence	NOUN
abc-4026	109	13	of	of	ADP
abc-4026	109	14	trol	trol	NOUN
abc-4026	109	15	(	(	PUNCT
abc-4026	109	16	mealktatfspmsvlsekrseprkpfslpnlfppksqrpisqesflkrfngglalltsvlssatap	mealktatfspmsvlsekrseprkpfslpnlfppksqrpisqesflkrfngglalltsvlssatap	PROPN
abc-4026	109	17	)	)	PUNCT
abc-4026	109	18	were	be	AUX
abc-4026	109	19	custom	custom	NOUN
abc-4026	109	20	synthetized	synthetize	VERB
abc-4026	109	21	and	and	CCONJ
abc-4026	109	22	prepared	prepare	VERB
abc-4026	109	23	for	for	ADP
abc-4026	109	24	the	the	DET
abc-4026	109	25	immunization	immunization	NOUN
abc-4026	109	26	of	of	ADP
abc-4026	109	27	two	two	NUM
abc-4026	109	28	rabbits	rabbit	NOUN
abc-4026	109	29	by	by	ADP
abc-4026	109	30	the	the	DET
abc-4026	109	31	company	company	NOUN
abc-4026	110	1	davids	david	VERB
abc-4026	110	2	biotechnologie	biotechnologie	PROPN
abc-4026	110	3	gmbh	gmbh	PROPN
abc-4026	110	4	.	.	PUNCT
abc-4026	111	1	(	(	PUNCT
abc-4026	111	2	regensburg	regensburg	PROPN
abc-4026	111	3	,	,	PUNCT
abc-4026	111	4	germany	germany	PROPN
abc-4026	111	5	)	)	PUNCT
abc-4026	111	6	.	.	PUNCT
abc-4026	112	1	15	15	NUM
abc-4026	112	2	mg	mg	NOUN
abc-4026	112	3	of	of	ADP
abc-4026	112	4	the	the	DET
abc-4026	112	5	peptide	peptide	NOUN
abc-4026	112	6	of	of	ADP
abc-4026	112	7	purity	purity	NOUN
abc-4026	112	8	>	>	SYM
abc-4026	112	9	85	85	NUM
abc-4026	112	10	%	%	NOUN
abc-4026	112	11	was	be	AUX
abc-4026	112	12	synthetized	synthetize	VERB
abc-4026	112	13	,	,	PUNCT
abc-4026	112	14	quality	quality	NOUN
abc-4026	112	15	checked	check	VERB
abc-4026	112	16	by	by	ADP
abc-4026	112	17	hplc	hplc	PROPN
abc-4026	112	18	and	and	CCONJ
abc-4026	112	19	ms	ms	NOUN
abc-4026	112	20	and	and	CCONJ
abc-4026	112	21	conjugated	conjugate	VERB
abc-4026	112	22	to	to	ADP
abc-4026	112	23	klh	klh	PROPN
abc-4026	112	24	carrier	carrier	PROPN
abc-4026	112	25	for	for	ADP
abc-4026	112	26	immunization	immunization	NOUN
abc-4026	112	27	.	.	PUNCT
abc-4026	113	1	the	the	DET
abc-4026	113	2	antigen	antigen	NOUN
abc-4026	113	3	in	in	ADP
abc-4026	113	4	the	the	DET
abc-4026	113	5	concentration	concentration	NOUN
abc-4026	113	6	of	of	ADP
abc-4026	113	7	10	10	NUM
abc-4026	113	8	mg	mg	NOUN
abc-4026	113	9	ml–1	ml–1	PROPN
abc-4026	113	10	was	be	AUX
abc-4026	113	11	used	use	VERB
abc-4026	113	12	for	for	ADP
abc-4026	113	13	the	the	DET
abc-4026	113	14	immunization	immunization	NOUN
abc-4026	113	15	of	of	ADP
abc-4026	113	16	two	two	NUM
abc-4026	113	17	experimental	experimental	ADJ
abc-4026	113	18	animals	animal	NOUN
abc-4026	113	19	.	.	PUNCT
abc-4026	114	1	35	35	NUM
abc-4026	114	2	days	day	NOUN
abc-4026	114	3	after	after	ADP
abc-4026	114	4	immunization	immunization	NOUN
abc-4026	114	5	test	test	NOUN
abc-4026	114	6	,	,	PUNCT
abc-4026	114	7	sera	sera	NOUN
abc-4026	114	8	were	be	AUX
abc-4026	114	9	taken	take	VERB
abc-4026	114	10	from	from	ADP
abc-4026	114	11	the	the	DET
abc-4026	114	12	rabbits	rabbit	NOUN
abc-4026	114	13	and	and	CCONJ
abc-4026	114	14	verified	verify	VERB
abc-4026	114	15	,	,	PUNCT
abc-4026	114	16	together	together	ADV
abc-4026	114	17	with	with	ADP
abc-4026	114	18	the	the	DET
abc-4026	114	19	preimmune	preimmune	NOUN
abc-4026	114	20	serum	serum	NOUN
abc-4026	114	21	,	,	PUNCT
abc-4026	114	22	for	for	ADP
abc-4026	114	23	sensitivity	sensitivity	NOUN
abc-4026	114	24	and	and	CCONJ
abc-4026	114	25	specificity	specificity	NOUN
abc-4026	114	26	to	to	ADP
abc-4026	114	27	our	our	PRON
abc-4026	114	28	plant	plant	NOUN
abc-4026	114	29	extracts	extract	NOUN
abc-4026	114	30	.	.	PUNCT
abc-4026	115	1	antiserum	antiserum	NOUN
abc-4026	115	2	produced	produce	VERB
abc-4026	115	3	in	in	ADP
abc-4026	115	4	this	this	DET
abc-4026	115	5	way	way	NOUN
abc-4026	115	6	(	(	PUNCT
abc-4026	115	7	anti	anti	ADJ
abc-4026	115	8	-	-	NOUN
abc-4026	115	9	pretrol	pretrol	NOUN
abc-4026	115	10	)	)	PUNCT
abc-4026	115	11	was	be	AUX
abc-4026	115	12	expected	expect	VERB
abc-4026	115	13	to	to	PART
abc-4026	115	14	detect	detect	VERB
abc-4026	115	15	only	only	ADV
abc-4026	115	16	the	the	DET
abc-4026	115	17	inner	inner	ADJ
abc-4026	115	18	envelope	envelope	NOUN
abc-4026	115	19	membrane	membrane	NOUN
abc-4026	115	20	form	form	NOUN
abc-4026	115	21	of	of	ADP
abc-4026	115	22	the	the	DET
abc-4026	115	23	trol	trol	NOUN
abc-4026	115	24	and	and	CCONJ
abc-4026	115	25	not	not	PART
abc-4026	115	26	the	the	DET
abc-4026	115	27	thylakoid	thylakoid	NOUN
abc-4026	115	28	mature	mature	VERB
abc-4026	115	29	one	one	NUM
abc-4026	115	30	.	.	PUNCT
abc-4026	116	1	the	the	DET
abc-4026	116	2	immunization	immunization	NOUN
abc-4026	116	3	continued	continue	VERB
abc-4026	116	4	until	until	ADP
abc-4026	116	5	day	day	NOUN
abc-4026	116	6	63	63	NUM
abc-4026	116	7	to	to	PART
abc-4026	116	8	increase	increase	VERB
abc-4026	116	9	the	the	DET
abc-4026	116	10	titer	titer	NOUN
abc-4026	116	11	of	of	ADP
abc-4026	116	12	antibodies	antibody	NOUN
abc-4026	116	13	in	in	ADP
abc-4026	116	14	the	the	DET
abc-4026	116	15	serum	serum	NOUN
abc-4026	116	16	.	.	PUNCT
abc-4026	117	1	from	from	ADP
abc-4026	117	2	both	both	DET
abc-4026	117	3	sera	sera	NOUN
abc-4026	117	4	samples	sample	NOUN
abc-4026	117	5	,	,	PUNCT
abc-4026	117	6	a	a	DET
abc-4026	117	7	part	part	NOUN
abc-4026	117	8	was	be	AUX
abc-4026	117	9	purified	purify	VERB
abc-4026	117	10	on	on	ADP
abc-4026	117	11	affinity	affinity	NOUN
abc-4026	117	12	matrix	matrix	NOUN
abc-4026	117	13	with	with	ADP
abc-4026	117	14	the	the	DET
abc-4026	117	15	antigen	antigen	NOUN
abc-4026	117	16	.	.	PUNCT
abc-4026	118	1	final	final	ADJ
abc-4026	118	2	products	product	NOUN
abc-4026	118	3	were	be	AUX
abc-4026	118	4	four	four	NUM
abc-4026	118	5	different	different	ADJ
abc-4026	118	6	sera	sera	NOUN
abc-4026	118	7	:	:	PUNCT
abc-4026	118	8	serum	serum	NOUN
abc-4026	118	9	1	1	NUM
abc-4026	118	10	(	(	PUNCT
abc-4026	118	11	antipretrol1	antipretrol1	NOUN
abc-4026	118	12	)	)	PUNCT
abc-4026	118	13	,	,	PUNCT
abc-4026	118	14	serum	serum	NOUN
abc-4026	118	15	1	1	NUM
abc-4026	118	16	affinity	affinity	NOUN
abc-4026	118	17	purified	purify	VERB
abc-4026	118	18	(	(	PUNCT
abc-4026	118	19	anti	anti	ADJ
abc-4026	118	20	-	-	ADJ
abc-4026	118	21	pretrol1ap	pretrol1ap	ADJ
abc-4026	118	22	)	)	PUNCT
abc-4026	118	23	,	,	PUNCT
abc-4026	118	24	serum	serum	NOUN
abc-4026	118	25	2	2	NUM
abc-4026	118	26	(	(	PUNCT
abc-4026	118	27	anti	anti	ADJ
abc-4026	118	28	-	-	ADJ
abc-4026	118	29	pretrol2	pretrol2	ADJ
abc-4026	118	30	)	)	PUNCT
abc-4026	118	31	,	,	PUNCT
abc-4026	118	32	and	and	CCONJ
abc-4026	118	33	serum	serum	NOUN
abc-4026	118	34	2	2	NUM
abc-4026	118	35	affinity	affinity	NOUN
abc-4026	118	36	purified	purify	VERB
abc-4026	118	37	(	(	PUNCT
abc-4026	118	38	anti	anti	ADJ
abc-4026	118	39	-	-	ADJ
abc-4026	118	40	pretrol2ap	pretrol2ap	NOUN
abc-4026	118	41	)	)	PUNCT
abc-4026	118	42	.	.	PUNCT
abc-4026	119	1	they	they	PRON
abc-4026	119	2	were	be	AUX
abc-4026	119	3	all	all	PRON
abc-4026	119	4	tested	test	VERB
abc-4026	119	5	(	(	PUNCT
abc-4026	119	6	together	together	ADV
abc-4026	119	7	with	with	ADP
abc-4026	119	8	the	the	DET
abc-4026	119	9	preimmune	preimmune	ADJ
abc-4026	119	10	sera	sera	NOUN
abc-4026	119	11	)	)	PUNCT
abc-4026	119	12	for	for	ADP
abc-4026	119	13	specificity	specificity	NOUN
abc-4026	119	14	and	and	CCONJ
abc-4026	119	15	sensitivity	sensitivity	NOUN
abc-4026	119	16	of	of	ADP
abc-4026	119	17	trol	trol	NOUN
abc-4026	119	18	-	-	PUNCT
abc-4026	119	19	ie	ie	ADJ
abc-4026	119	20	detection	detection	NOUN
abc-4026	119	21	in	in	ADP
abc-4026	119	22	isolated	isolated	ADJ
abc-4026	119	23	chloroplasts	chloroplast	NOUN
abc-4026	119	24	of	of	ADP
abc-4026	119	25	trol	trol	PROPN
abc-4026	119	26	ox	ox	NOUN
abc-4026	119	27	and	and	CCONJ
abc-4026	119	28	trol	trol	VERB
abc-4026	119	29	ie	ie	X
abc-4026	119	30	plants	plant	NOUN
abc-4026	119	31	.	.	PUNCT
abc-4026	120	1	the	the	DET
abc-4026	120	2	optimal	optimal	ADJ
abc-4026	120	3	dilution	dilution	NOUN
abc-4026	120	4	of	of	ADP
abc-4026	120	5	the	the	DET
abc-4026	120	6	anti	anti	ADJ
abc-4026	120	7	-	-	ADJ
abc-4026	120	8	pretrol	pretrol	ADJ
abc-4026	120	9	antisera	antisera	NOUN
abc-4026	120	10	was	be	AUX
abc-4026	120	11	determined	determine	VERB
abc-4026	120	12	to	to	PART
abc-4026	120	13	be	be	AUX
abc-4026	120	14	1:100	1:100	NUM
abc-4026	120	15	.	.	PUNCT
abc-4026	121	1	isolation	isolation	NOUN
abc-4026	121	2	of	of	ADP
abc-4026	121	3	total	total	ADJ
abc-4026	121	4	leaf	leaf	NOUN
abc-4026	121	5	extracts	extract	NOUN
abc-4026	121	6	from	from	ADP
abc-4026	121	7	arabidopsis	arabidopsis	NOUN
abc-4026	121	8	plants	plant	NOUN
abc-4026	121	9	leaves	leave	NOUN
abc-4026	121	10	of	of	ADP
abc-4026	121	11	four	four	NUM
abc-4026	121	12	-	-	PUNCT
abc-4026	121	13	week	week	NOUN
abc-4026	121	14	-	-	PUNCT
abc-4026	121	15	old	old	ADJ
abc-4026	121	16	arabidopsis	arabidopsis	NOUN
abc-4026	121	17	plants	plant	NOUN
abc-4026	121	18	(	(	PUNCT
abc-4026	121	19	wt	wt	NOUN
abc-4026	121	20	,	,	PUNCT
abc-4026	121	21	ox	ox	NOUN
abc-4026	121	22	,	,	PUNCT
abc-4026	121	23	ie-8	ie-8	NOUN
abc-4026	121	24	,	,	PUNCT
abc-4026	121	25	and	and	CCONJ
abc-4026	121	26	ie-18	ie-18	NOUN
abc-4026	121	27	)	)	PUNCT
abc-4026	121	28	were	be	AUX
abc-4026	121	29	cut	cut	VERB
abc-4026	121	30	and	and	CCONJ
abc-4026	121	31	ground	grind	VERB
abc-4026	121	32	in	in	ADP
abc-4026	121	33	liquid	liquid	ADJ
abc-4026	121	34	nitrogen	nitrogen	NOUN
abc-4026	121	35	using	use	VERB
abc-4026	121	36	mortar	mortar	NOUN
abc-4026	121	37	and	and	CCONJ
abc-4026	121	38	pestle	pestle	NOUN
abc-4026	121	39	.	.	PUNCT
abc-4026	122	1	laemmli	laemmli	NOUN
abc-4026	122	2	buffer	buffer	NOUN
abc-4026	122	3	(	(	PUNCT
abc-4026	122	4	laemmli	laemmli	NOUN
abc-4026	122	5	1970	1970	NUM
abc-4026	122	6	)	)	PUNCT
abc-4026	122	7	was	be	AUX
abc-4026	122	8	added	add	VERB
abc-4026	122	9	to	to	ADP
abc-4026	122	10	the	the	DET
abc-4026	122	11	extract	extract	NOUN
abc-4026	122	12	,	,	PUNCT
abc-4026	122	13	samples	sample	NOUN
abc-4026	122	14	were	be	AUX
abc-4026	122	15	vortexed	vortexe	VERB
abc-4026	122	16	and	and	CCONJ
abc-4026	122	17	heated	heat	VERB
abc-4026	122	18	at	at	ADP
abc-4026	122	19	70	70	NUM
abc-4026	122	20	°	°	ADP
abc-4026	122	21	c	c	NOUN
abc-4026	122	22	for	for	ADP
abc-4026	122	23	5	5	NUM
abc-4026	122	24	-	-	SYM
abc-4026	122	25	10	10	NUM
abc-4026	122	26	min	min	NOUN
abc-4026	122	27	.	.	PROPN
abc-4026	122	28	centrifugation	centrifugation	NOUN
abc-4026	122	29	at	at	ADP
abc-4026	122	30	13000	13000	NUM
abc-4026	122	31	g	g	NOUN
abc-4026	122	32	for	for	ADP
abc-4026	122	33	5	5	NUM
abc-4026	122	34	min	min	NOUN
abc-4026	122	35	at	at	ADP
abc-4026	122	36	room	room	NOUN
abc-4026	122	37	temperature	temperature	NOUN
abc-4026	122	38	pelleted	pellete	VERB
abc-4026	122	39	the	the	DET
abc-4026	122	40	insoluble	insoluble	ADJ
abc-4026	122	41	leftovers	leftover	NOUN
abc-4026	122	42	and	and	CCONJ
abc-4026	122	43	the	the	DET
abc-4026	122	44	extracts	extract	NOUN
abc-4026	122	45	were	be	AUX
abc-4026	122	46	stored	store	VERB
abc-4026	122	47	at	at	ADP
abc-4026	122	48	-20	-20	PROPN
abc-4026	122	49	°	°	ADP
abc-4026	122	50	c	c	NOUN
abc-4026	122	51	(	(	PUNCT
abc-4026	122	52	for	for	ADP
abc-4026	122	53	faster	fast	ADJ
abc-4026	122	54	use	use	NOUN
abc-4026	122	55	)	)	PUNCT
abc-4026	122	56	or	or	CCONJ
abc-4026	122	57	at	at	ADP
abc-4026	122	58	-80	-80	NOUN
abc-4026	122	59	°	°	ADP
abc-4026	122	60	c	c	NOUN
abc-4026	122	61	(	(	PUNCT
abc-4026	122	62	for	for	ADP
abc-4026	122	63	later	later	ADJ
abc-4026	122	64	use	use	NOUN
abc-4026	122	65	)	)	PUNCT
abc-4026	122	66	.	.	PUNCT
abc-4026	123	1	isolation	isolation	NOUN
abc-4026	123	2	of	of	ADP
abc-4026	123	3	intact	intact	ADJ
abc-4026	123	4	chloroplasts	chloroplast	NOUN
abc-4026	123	5	from	from	ADP
abc-4026	123	6	arabidopsis	arabidopsis	NOUN
abc-4026	123	7	plants	plant	NOUN
abc-4026	123	8	leaves	leave	NOUN
abc-4026	123	9	of	of	ADP
abc-4026	123	10	four	four	NUM
abc-4026	123	11	-	-	PUNCT
abc-4026	123	12	week	week	NOUN
abc-4026	123	13	-	-	PUNCT
abc-4026	123	14	old	old	ADJ
abc-4026	123	15	arabidopsis	arabidopsis	NOUN
abc-4026	123	16	plants	plant	NOUN
abc-4026	123	17	(	(	PUNCT
abc-4026	123	18	wt	wt	NOUN
abc-4026	123	19	,	,	PUNCT
abc-4026	123	20	ox	ox	NOUN
abc-4026	123	21	,	,	PUNCT
abc-4026	123	22	ie-8	ie-8	NOUN
abc-4026	123	23	,	,	PUNCT
abc-4026	123	24	and	and	CCONJ
abc-4026	123	25	ie-18	ie-18	NOUN
abc-4026	123	26	)	)	PUNCT
abc-4026	123	27	were	be	AUX
abc-4026	123	28	cut	cut	VERB
abc-4026	123	29	and	and	CCONJ
abc-4026	123	30	ground	grind	VERB
abc-4026	123	31	in	in	ADP
abc-4026	123	32	ice	ice	NOUN
abc-4026	123	33	-	-	PUNCT
abc-4026	123	34	cold	cold	ADJ
abc-4026	123	35	isolation	isolation	NOUN
abc-4026	123	36	medium	medium	NOUN
abc-4026	123	37	(	(	PUNCT
abc-4026	123	38	330	330	NUM
abc-4026	123	39	mm	mm	NOUN
abc-4026	123	40	sorbitol	sorbitol	NOUN
abc-4026	123	41	,	,	PUNCT
abc-4026	123	42	20	20	NUM
abc-4026	123	43	mm	mm	NOUN
abc-4026	123	44	tris	tris	PROPN
abc-4026	123	45	/	/	SYM
abc-4026	123	46	hcl	hcl	PROPN
abc-4026	123	47	,	,	PUNCT
abc-4026	123	48	5	5	NUM
abc-4026	123	49	mm	mm	PROPN
abc-4026	123	50	edta	edta	NOUN
abc-4026	123	51	,	,	PUNCT
abc-4026	123	52	10	10	NUM
abc-4026	123	53	mm	mm	NOUN
abc-4026	123	54	na2co3	na2co3	PROPN
abc-4026	123	55	,	,	PUNCT
abc-4026	123	56	0.1	0.1	NUM
abc-4026	123	57	%	%	NOUN
abc-4026	123	58	bsa	bsa	NOUN
abc-4026	123	59	)	)	PUNCT
abc-4026	123	60	,	,	PUNCT
abc-4026	123	61	filtered	filter	VERB
abc-4026	123	62	through	through	ADP
abc-4026	123	63	4	4	NUM
abc-4026	123	64	-	-	PUNCT
abc-4026	123	65	layered	layered	ADJ
abc-4026	123	66	gauze	gauze	NOUN
abc-4026	123	67	and	and	CCONJ
abc-4026	123	68	miracloth	miracloth	NOUN
abc-4026	123	69	filter	filter	NOUN
abc-4026	123	70	(	(	PUNCT
abc-4026	123	71	sigma	sigma	PROPN
abc-4026	123	72	-	-	PUNCT
abc-4026	123	73	aldrich	aldrich	NOUN
abc-4026	123	74	)	)	PUNCT
abc-4026	123	75	and	and	CCONJ
abc-4026	123	76	sedimented	sediment	VERB
abc-4026	123	77	by	by	ADP
abc-4026	123	78	centrifugation	centrifugation	NOUN
abc-4026	123	79	at	at	ADP
abc-4026	123	80	1500	1500	NUM
abc-4026	123	81	g	g	NOUN
abc-4026	123	82	for	for	ADP
abc-4026	123	83	5	5	NUM
abc-4026	123	84	min	min	NOUN
abc-4026	123	85	,	,	PUNCT
abc-4026	123	86	at	at	ADP
abc-4026	123	87	0	0	NUM
abc-4026	123	88	°	°	ADP
abc-4026	123	89	c	c	NOUN
abc-4026	123	90	.	.	PUNCT
abc-4026	124	1	the	the	DET
abc-4026	124	2	pellet	pellet	NOUN
abc-4026	124	3	was	be	AUX
abc-4026	124	4	resuspended	resuspend	VERB
abc-4026	124	5	in	in	ADP
abc-4026	124	6	a	a	DET
abc-4026	124	7	small	small	ADJ
abc-4026	124	8	amount	amount	NOUN
abc-4026	124	9	of	of	ADP
abc-4026	124	10	isolation	isolation	NOUN
abc-4026	124	11	medium	medium	NOUN
abc-4026	124	12	and	and	CCONJ
abc-4026	124	13	purified	purify	VERB
abc-4026	124	14	through	through	ADP
abc-4026	124	15	55%/35	55%/35	NUM
abc-4026	124	16	%	%	NOUN
abc-4026	124	17	percoll	percoll	NOUN
abc-4026	124	18	density	density	NOUN
abc-4026	124	19	gradient	gradient	NOUN
abc-4026	124	20	.	.	PUNCT
abc-4026	125	1	centrifugation	centrifugation	NOUN
abc-4026	125	2	at	at	ADP
abc-4026	125	3	5000	5000	NUM
abc-4026	125	4	g	g	NOUN
abc-4026	125	5	was	be	AUX
abc-4026	125	6	performed	perform	VERB
abc-4026	125	7	for	for	ADP
abc-4026	125	8	10	10	NUM
abc-4026	125	9	min	min	NOUN
abc-4026	125	10	at	at	ADP
abc-4026	125	11	0	0	NUM
abc-4026	125	12	°	°	ADP
abc-4026	125	13	c	c	NOUN
abc-4026	125	14	,	,	PUNCT
abc-4026	125	15	in	in	ADP
abc-4026	125	16	the	the	DET
abc-4026	125	17	swing	swing	NOUN
abc-4026	125	18	-	-	PUNCT
abc-4026	125	19	out	out	ADP
abc-4026	125	20	rotor	rotor	NOUN
abc-4026	125	21	,	,	PUNCT
abc-4026	125	22	with	with	ADP
abc-4026	125	23	the	the	DET
abc-4026	125	24	slowest	slow	ADJ
abc-4026	125	25	possible	possible	ADJ
abc-4026	125	26	deceleration	deceleration	NOUN
abc-4026	125	27	rate	rate	NOUN
abc-4026	125	28	.	.	PUNCT
abc-4026	126	1	intact	intact	ADJ
abc-4026	126	2	chloroplasts	chloroplast	NOUN
abc-4026	126	3	were	be	AUX
abc-4026	126	4	collected	collect	VERB
abc-4026	126	5	from	from	ADP
abc-4026	126	6	the	the	DET
abc-4026	126	7	interphase	interphase	NOUN
abc-4026	126	8	between	between	ADP
abc-4026	126	9	55	55	NUM
abc-4026	126	10	%	%	NOUN
abc-4026	126	11	and	and	CCONJ
abc-4026	126	12	35	35	NUM
abc-4026	126	13	%	%	NOUN
abc-4026	126	14	percoll	percoll	NOUN
abc-4026	126	15	,	,	PUNCT
abc-4026	126	16	washed	wash	VERB
abc-4026	126	17	twice	twice	ADV
abc-4026	126	18	in	in	ADP
abc-4026	126	19	isolation	isolation	NOUN
abc-4026	126	20	medium	medium	NOUN
abc-4026	126	21	,	,	PUNCT
abc-4026	126	22	sedimented	sediment	VERB
abc-4026	126	23	at	at	ADP
abc-4026	126	24	1500	1500	NUM
abc-4026	126	25	g	g	NOUN
abc-4026	126	26	for	for	ADP
abc-4026	126	27	5	5	NUM
abc-4026	126	28	min	min	NOUN
abc-4026	126	29	at	at	ADP
abc-4026	126	30	0	0	NUM
abc-4026	126	31	°	°	ADP
abc-4026	126	32	c	c	NOUN
abc-4026	126	33	,	,	PUNCT
abc-4026	126	34	and	and	CCONJ
abc-4026	126	35	chlorophyll	chlorophyll	NOUN
abc-4026	126	36	concentration	concentration	NOUN
abc-4026	126	37	was	be	AUX
abc-4026	126	38	measured	measure	VERB
abc-4026	126	39	spectrophotometrically	spectrophotometrically	ADV
abc-4026	126	40	.	.	PUNCT
abc-4026	127	1	isolation	isolation	NOUN
abc-4026	127	2	of	of	ADP
abc-4026	127	3	total	total	ADJ
abc-4026	127	4	chloroplast	chloroplast	NOUN
abc-4026	127	5	membranes	membrane	NOUN
abc-4026	127	6	from	from	ADP
abc-4026	127	7	arabidopsis	arabidopsis	NOUN
abc-4026	127	8	plants	plant	NOUN
abc-4026	127	9	after	after	ADP
abc-4026	127	10	the	the	DET
abc-4026	127	11	determination	determination	NOUN
abc-4026	127	12	of	of	ADP
abc-4026	127	13	chlorophyll	chlorophyll	NOUN
abc-4026	127	14	concentration	concentration	NOUN
abc-4026	127	15	,	,	PUNCT
abc-4026	127	16	intact	intact	ADJ
abc-4026	127	17	chloroplasts	chloroplast	NOUN
abc-4026	127	18	corresponding	correspond	VERB
abc-4026	127	19	to	to	ADP
abc-4026	127	20	2	2	NUM
abc-4026	127	21	µg	µg	NOUN
abc-4026	127	22	chlorophyll	chlorophyll	NOUN
abc-4026	127	23	were	be	AUX
abc-4026	127	24	pelleted	pellete	VERB
abc-4026	127	25	at	at	ADP
abc-4026	127	26	1500	1500	NUM
abc-4026	127	27	g	g	NOUN
abc-4026	127	28	for	for	ADP
abc-4026	127	29	1	1	NUM
abc-4026	127	30	min	min	NOUN
abc-4026	127	31	at	at	ADP
abc-4026	127	32	0	0	NUM
abc-4026	127	33	°	°	ADP
abc-4026	127	34	c	c	NOUN
abc-4026	127	35	,	,	PUNCT
abc-4026	127	36	resuspended	resuspend	VERB
abc-4026	127	37	,	,	PUNCT
abc-4026	127	38	and	and	CCONJ
abc-4026	127	39	incubated	incubate	VERB
abc-4026	127	40	in	in	ADP
abc-4026	127	41	lysis	lysis	NOUN
abc-4026	127	42	buffer	buffer	NOUN
abc-4026	127	43	(	(	PUNCT
abc-4026	127	44	10	10	NUM
abc-4026	127	45	mm	mm	NUM
abc-4026	127	46	tris	tris	NOUN
abc-4026	127	47	-	-	PUNCT
abc-4026	127	48	base	base	NOUN
abc-4026	127	49	,	,	PUNCT
abc-4026	127	50	5	5	NUM
abc-4026	127	51	mm	mm	NOUN
abc-4026	127	52	mgcl2	mgcl2	PROPN
abc-4026	127	53	,	,	PUNCT
abc-4026	127	54	ph	ph	VERB
abc-4026	127	55	7.9	7.9	NUM
abc-4026	127	56	)	)	PUNCT
abc-4026	127	57	for	for	ADP
abc-4026	127	58	30	30	NUM
abc-4026	127	59	min	min	NOUN
abc-4026	127	60	on	on	ADP
abc-4026	127	61	ice	ice	NOUN
abc-4026	127	62	.	.	PUNCT
abc-4026	128	1	by	by	ADP
abc-4026	128	2	subsequent	subsequent	ADJ
abc-4026	128	3	centrifugation	centrifugation	NOUN
abc-4026	128	4	at	at	ADP
abc-4026	128	5	25000	25000	NUM
abc-4026	128	6	g	g	NOUN
abc-4026	128	7	for	for	ADP
abc-4026	128	8	20	20	NUM
abc-4026	128	9	min	min	NOUN
abc-4026	128	10	at	at	ADP
abc-4026	128	11	4	4	NUM
abc-4026	128	12	°	°	NOUN
abc-4026	128	13	c	c	NOUN
abc-4026	128	14	the	the	DET
abc-4026	128	15	sample	sample	NOUN
abc-4026	128	16	was	be	AUX
abc-4026	128	17	separated	separate	VERB
abc-4026	128	18	to	to	ADP
abc-4026	128	19	supernatant	supernatant	NOUN
abc-4026	128	20	(	(	PUNCT
abc-4026	128	21	stroma	stroma	PROPN
abc-4026	128	22	)	)	PUNCT
abc-4026	128	23	and	and	CCONJ
abc-4026	128	24	membrane	membrane	NOUN
abc-4026	128	25	pellet	pellet	NOUN
abc-4026	128	26	(	(	PUNCT
abc-4026	128	27	consisting	consist	VERB
abc-4026	128	28	mostly	mostly	ADV
abc-4026	128	29	of	of	ADP
abc-4026	128	30	thylakoids	thylakoid	NOUN
abc-4026	128	31	)	)	PUNCT
abc-4026	128	32	.	.	PUNCT
abc-4026	129	1	the	the	DET
abc-4026	129	2	pellet	pellet	NOUN
abc-4026	129	3	was	be	AUX
abc-4026	129	4	resuspended	resuspend	VERB
abc-4026	129	5	in	in	ADP
abc-4026	129	6	laemmli	laemmli	NOUN
abc-4026	129	7	buffer	buffer	NOUN
abc-4026	129	8	to	to	ADP
abc-4026	129	9	the	the	DET
abc-4026	129	10	final	final	ADJ
abc-4026	129	11	concentration	concentration	NOUN
abc-4026	129	12	of	of	ADP
abc-4026	129	13	2	2	NUM
abc-4026	129	14	mg	mg	NOUN
abc-4026	129	15	chlorophyll	chlorophyll	NOUN
abc-4026	129	16	/	/	SYM
abc-4026	129	17	ml	ml	NOUN
abc-4026	129	18	buffer	buffer	NOUN
abc-4026	129	19	and	and	CCONJ
abc-4026	129	20	stored	store	VERB
abc-4026	129	21	at	at	ADP
abc-4026	129	22	–	–	PUNCT
abc-4026	129	23	20	20	NUM
abc-4026	129	24	°	°	NUM
abc-4026	129	25	c	c	NOUN
abc-4026	129	26	until	until	ADP
abc-4026	129	27	further	further	ADJ
abc-4026	129	28	use	use	NOUN
abc-4026	129	29	.	.	PUNCT
abc-4026	130	1	western	western	ADJ
abc-4026	130	2	blot	blot	NOUN
abc-4026	130	3	analysis	analysis	NOUN
abc-4026	130	4	10	10	NUM
abc-4026	130	5	-	-	SYM
abc-4026	130	6	30	30	NUM
abc-4026	130	7	µg	µg	NOUN
abc-4026	130	8	of	of	ADP
abc-4026	130	9	isolated	isolated	ADJ
abc-4026	130	10	chloroplasts	chloroplast	NOUN
abc-4026	130	11	or	or	CCONJ
abc-4026	130	12	thylakoids	thylakoid	NOUN
abc-4026	130	13	of	of	ADP
abc-4026	130	14	the	the	DET
abc-4026	130	15	corresponding	corresponding	ADJ
abc-4026	130	16	arabidopsis	arabidopsis	NOUN
abc-4026	130	17	line	line	NOUN
abc-4026	130	18	were	be	AUX
abc-4026	130	19	loaded	load	VERB
abc-4026	130	20	on	on	ADP
abc-4026	130	21	10	10	NUM
abc-4026	130	22	%	%	NOUN
abc-4026	130	23	or	or	CCONJ
abc-4026	130	24	12	12	NUM
abc-4026	130	25	%	%	NOUN
abc-4026	130	26	sds	sds	NOUN
abc-4026	130	27	-	-	PUNCT
abc-4026	130	28	polyacrylamide	polyacrylamide	NOUN
abc-4026	130	29	gels	gel	NOUN
abc-4026	130	30	and	and	CCONJ
abc-4026	130	31	separated	separate	VERB
abc-4026	130	32	by	by	ADP
abc-4026	130	33	electrophoresis	electrophoresis	NOUN
abc-4026	130	34	(	(	PUNCT
abc-4026	130	35	sds	sds	NOUN
abc-4026	130	36	-	-	PUNCT
abc-4026	130	37	page	page	NOUN
abc-4026	130	38	)	)	PUNCT
abc-4026	130	39	.	.	PUNCT
abc-4026	131	1	afterwards	afterwards	ADV
abc-4026	131	2	,	,	PUNCT
abc-4026	131	3	western	western	ADJ
abc-4026	131	4	transfer	transfer	NOUN
abc-4026	131	5	to	to	ADP
abc-4026	131	6	the	the	DET
abc-4026	131	7	nitrocellulose	nitrocellulose	NOUN
abc-4026	131	8	membranes	membrane	NOUN
abc-4026	131	9	was	be	AUX
abc-4026	131	10	performed	perform	VERB
abc-4026	131	11	,	,	PUNCT
abc-4026	131	12	and	and	CCONJ
abc-4026	131	13	membranes	membrane	NOUN
abc-4026	131	14	were	be	AUX
abc-4026	131	15	immunodecorated	immunodecorate	VERB
abc-4026	131	16	with	with	ADP
abc-4026	131	17	the	the	DET
abc-4026	131	18	anti	anti	NOUN
abc-4026	131	19	-	-	NOUN
abc-4026	131	20	trol	trol	ADJ
abc-4026	131	21	(	(	PUNCT
abc-4026	131	22	1:3000	1:3000	NUM
abc-4026	131	23	,	,	PUNCT
abc-4026	131	24	agrisera	agrisera	NOUN
abc-4026	131	25	as194257	as194257	NOUN
abc-4026	131	26	)	)	PUNCT
abc-4026	131	27	,	,	PUNCT
abc-4026	131	28	anti	anti	ADJ
abc-4026	131	29	-	-	NOUN
abc-4026	131	30	pretrol	pretrol	ADJ
abc-4026	131	31	(	(	PUNCT
abc-4026	131	32	1:100	1:100	NUM
abc-4026	131	33	)	)	PUNCT
abc-4026	131	34	,	,	PUNCT
abc-4026	131	35	and	and	CCONJ
abc-4026	131	36	anti	anti	ADJ
abc-4026	131	37	-	-	ADJ
abc-4026	131	38	ha	ha	INTJ
abc-4026	131	39	antibodies	antibodies	PROPN
abc-4026	131	40	vojta	vojta	PROPN
abc-4026	131	41	l.	l.	PROPN
abc-4026	131	42	,	,	PUNCT
abc-4026	131	43	fulgosi	fulgosi	PROPN
abc-4026	131	44	h.	h.	PROPN
abc-4026	131	45	,	,	PUNCT
abc-4026	131	46	tomašić	tomašić	PROPN
abc-4026	131	47	paić	paić	PROPN
abc-4026	131	48	a.	a.	PROPN
abc-4026	131	49	,	,	PUNCT
abc-4026	131	50	dumančić	dumančić	PROPN
abc-4026	131	51	e.	e.	PROPN
abc-4026	131	52	260	260	NUM
abc-4026	131	53	acta	acta	PROPN
abc-4026	131	54	bot	bot	PROPN
abc-4026	131	55	.	.	PUNCT
abc-4026	132	1	croat	croat	PROPN
abc-4026	132	2	.	.	PUNCT
abc-4026	133	1	84	84	NUM
abc-4026	133	2	(	(	PUNCT
abc-4026	133	3	2	2	NUM
abc-4026	133	4	)	)	PUNCT
abc-4026	133	5	,	,	PUNCT
abc-4026	133	6	2025	2025	NUM
abc-4026	133	7	(	(	PUNCT
abc-4026	133	8	1:1000	1:1000	NUM
abc-4026	133	9	,	,	PUNCT
abc-4026	133	10	sigma	sigma	NOUN
abc-4026	133	11	h9658	h9658	NOUN
abc-4026	133	12	)	)	PUNCT
abc-4026	133	13	.	.	PUNCT
abc-4026	134	1	as	as	ADP
abc-4026	134	2	secondary	secondary	ADJ
abc-4026	134	3	antibody	antibody	NOUN
abc-4026	134	4	,	,	PUNCT
abc-4026	134	5	anti	anti	ADJ
abc-4026	134	6	-	-	ADJ
abc-4026	134	7	rabbit	rabbit	ADJ
abc-4026	134	8	igg	igg	PROPN
abc-4026	134	9	peroxidase	peroxidase	PROPN
abc-4026	134	10	(	(	PUNCT
abc-4026	134	11	sigma	sigma	PROPN
abc-4026	134	12	a0545	a0545	PROPN
abc-4026	134	13	)	)	PUNCT
abc-4026	134	14	was	be	AUX
abc-4026	134	15	used	use	VERB
abc-4026	134	16	for	for	ADP
abc-4026	134	17	anti	anti	ADJ
abc-4026	134	18	-	-	ADJ
abc-4026	134	19	trol	trol	ADJ
abc-4026	134	20	(	(	PUNCT
abc-4026	134	21	1:50000	1:50000	NUM
abc-4026	134	22	)	)	PUNCT
abc-4026	134	23	and	and	CCONJ
abc-4026	134	24	anti	anti	ADJ
abc-4026	134	25	-	-	NOUN
abc-4026	134	26	pretrol	pretrol	ADJ
abc-4026	134	27	(	(	PUNCT
abc-4026	134	28	1:10000	1:10000	NUM
abc-4026	134	29	)	)	PUNCT
abc-4026	134	30	and	and	CCONJ
abc-4026	134	31	anti	anti	ADJ
abc-4026	134	32	-	-	ADJ
abc-4026	134	33	rat	rat	ADJ
abc-4026	134	34	igg	igg	PROPN
abc-4026	134	35	peroxidase	peroxidase	NOUN
abc-4026	134	36	(	(	PUNCT
abc-4026	134	37	1:30000	1:30000	NUM
abc-4026	134	38	,	,	PUNCT
abc-4026	134	39	sigma	sigma	NOUN
abc-4026	134	40	a9073	a9073	PROPN
abc-4026	134	41	)	)	PUNCT
abc-4026	134	42	for	for	ADP
abc-4026	134	43	anti	anti	ADJ
abc-4026	134	44	-	-	ADJ
abc-4026	134	45	ha	ha	INTJ
abc-4026	134	46	.	.	NOUN
abc-4026	134	47	final	final	ADJ
abc-4026	134	48	detection	detection	NOUN
abc-4026	134	49	was	be	AUX
abc-4026	134	50	carried	carry	VERB
abc-4026	134	51	out	out	ADP
abc-4026	134	52	by	by	ADP
abc-4026	134	53	enhanced	enhanced	ADJ
abc-4026	134	54	chemiluminescence	chemiluminescence	NOUN
abc-4026	134	55	(	(	PUNCT
abc-4026	134	56	ecl	ecl	NOUN
abc-4026	134	57	)	)	PUNCT
abc-4026	134	58	and	and	CCONJ
abc-4026	134	59	exposure	exposure	NOUN
abc-4026	134	60	to	to	ADP
abc-4026	134	61	x	x	ADJ
abc-4026	134	62	-	-	NOUN
abc-4026	134	63	ray	ray	NOUN
abc-4026	134	64	films	film	NOUN
abc-4026	134	65	.	.	PUNCT
abc-4026	135	1	results	result	VERB
abc-4026	135	2	construction	construction	NOUN
abc-4026	135	3	of	of	ADP
abc-4026	135	4	arabidopsis	arabidopsis	NOUN
abc-4026	135	5	trol	trol	NOUN
abc-4026	135	6	-	-	PUNCT
abc-4026	135	7	ie	ie	ADJ
abc-4026	135	8	plants	plant	NOUN
abc-4026	135	9	containing	contain	VERB
abc-4026	135	10	trol	trol	NOUN
abc-4026	135	11	only	only	ADV
abc-4026	135	12	in	in	ADP
abc-4026	135	13	the	the	DET
abc-4026	135	14	inner	inner	ADJ
abc-4026	135	15	envelope	envelope	NOUN
abc-4026	135	16	membrane	membrane	NOUN
abc-4026	135	17	in	in	ADP
abc-4026	135	18	our	our	PRON
abc-4026	135	19	previous	previous	ADJ
abc-4026	135	20	work	work	NOUN
abc-4026	135	21	we	we	PRON
abc-4026	135	22	exchanged	exchange	VERB
abc-4026	135	23	several	several	ADJ
abc-4026	135	24	amino	amino	NOUN
abc-4026	135	25	acids	acid	NOUN
abc-4026	135	26	around	around	ADP
abc-4026	135	27	the	the	DET
abc-4026	135	28	protease	protease	NOUN
abc-4026	135	29	processing	processing	NOUN
abc-4026	135	30	site	site	NOUN
abc-4026	135	31	of	of	ADP
abc-4026	135	32	the	the	DET
abc-4026	135	33	trol	trol	NOUN
abc-4026	135	34	presequence	presequence	NOUN
abc-4026	135	35	.	.	PUNCT
abc-4026	136	1	the	the	DET
abc-4026	136	2	mutation	mutation	NOUN
abc-4026	136	3	of	of	ADP
abc-4026	136	4	ala67	ala67	NOUN
abc-4026	136	5	to	to	ADP
abc-4026	136	6	ile67	ile67	PROPN
abc-4026	136	7	was	be	AUX
abc-4026	136	8	the	the	DET
abc-4026	136	9	only	only	ADJ
abc-4026	136	10	one	one	NUM
abc-4026	136	11	that	that	PRON
abc-4026	136	12	influenced	influence	VERB
abc-4026	136	13	the	the	DET
abc-4026	136	14	processing	processing	NOUN
abc-4026	136	15	of	of	ADP
abc-4026	136	16	the	the	DET
abc-4026	136	17	protein	protein	NOUN
abc-4026	136	18	,	,	PUNCT
abc-4026	136	19	by	by	ADP
abc-4026	136	20	arresting	arrest	VERB
abc-4026	136	21	the	the	DET
abc-4026	136	22	trol	trol	NOUN
abc-4026	136	23	in	in	ADP
abc-4026	136	24	the	the	DET
abc-4026	136	25	chloroplast	chloroplast	ADJ
abc-4026	136	26	inner	inner	ADJ
abc-4026	136	27	envelope	envelope	NOUN
abc-4026	136	28	membrane	membrane	NOUN
abc-4026	136	29	(	(	PUNCT
abc-4026	136	30	vojta	vojta	NOUN
abc-4026	136	31	et	et	PROPN
abc-4026	136	32	al	al	PROPN
abc-4026	136	33	.	.	PROPN
abc-4026	136	34	2018	2018	NUM
abc-4026	136	35	)	)	PUNCT
abc-4026	136	36	.	.	PUNCT
abc-4026	137	1	in	in	ADP
abc-4026	137	2	order	order	NOUN
abc-4026	137	3	to	to	PART
abc-4026	137	4	investigate	investigate	VERB
abc-4026	137	5	in	in	ADP
abc-4026	137	6	vivo	vivo	NOUN
abc-4026	137	7	the	the	DET
abc-4026	137	8	role	role	NOUN
abc-4026	137	9	of	of	ADP
abc-4026	137	10	the	the	DET
abc-4026	137	11	trol	trol	NOUN
abc-4026	137	12	in	in	ADP
abc-4026	137	13	this	this	DET
abc-4026	137	14	compartment	compartment	NOUN
abc-4026	137	15	,	,	PUNCT
abc-4026	137	16	we	we	PRON
abc-4026	137	17	had	have	VERB
abc-4026	137	18	to	to	PART
abc-4026	137	19	construct	construct	VERB
abc-4026	137	20	the	the	DET
abc-4026	137	21	arabidopsis	arabidopsis	NOUN
abc-4026	137	22	plants	plant	NOUN
abc-4026	137	23	containing	contain	VERB
abc-4026	137	24	trol	trol	NOUN
abc-4026	137	25	at	at	ADP
abc-4026	137	26	this	this	DET
abc-4026	137	27	single	single	ADJ
abc-4026	137	28	location	location	NOUN
abc-4026	137	29	.	.	PUNCT
abc-4026	138	1	therefore	therefore	ADV
abc-4026	138	2	,	,	PUNCT
abc-4026	138	3	we	we	PRON
abc-4026	138	4	have	have	AUX
abc-4026	138	5	cloned	clone	VERB
abc-4026	138	6	the	the	DET
abc-4026	138	7	construct	construct	NOUN
abc-4026	138	8	of	of	ADP
abc-4026	138	9	trol	trol	NOUN
abc-4026	138	10	with	with	ADP
abc-4026	138	11	the	the	DET
abc-4026	138	12	ala67	ala67	NOUN
abc-4026	138	13	to	to	ADP
abc-4026	138	14	ile67	ile67	ADJ
abc-4026	138	15	amino	amino	NOUN
abc-4026	138	16	acid	acid	NOUN
abc-4026	138	17	exchange	exchange	NOUN
abc-4026	138	18	and	and	CCONJ
abc-4026	138	19	the	the	DET
abc-4026	138	20	c	c	NOUN
abc-4026	138	21	-	-	PUNCT
abc-4026	138	22	terminal	terminal	ADJ
abc-4026	138	23	flag	flag	NOUN
abc-4026	138	24	(	(	PUNCT
abc-4026	138	25	dykddddk	dykddddk	ADJ
abc-4026	138	26	)	)	PUNCT
abc-4026	138	27	and	and	CCONJ
abc-4026	138	28	ha	ha	INTJ
abc-4026	138	29	(	(	PUNCT
abc-4026	138	30	human	human	ADJ
abc-4026	138	31	influenza	influenza	NOUN
abc-4026	138	32	hemagglutinin	hemagglutinin	NOUN
abc-4026	138	33	,	,	PUNCT
abc-4026	138	34	ypydvpdya	ypydvpdya	NOUN
abc-4026	138	35	)	)	PUNCT
abc-4026	138	36	tags	tag	NOUN
abc-4026	138	37	in	in	ADP
abc-4026	138	38	the	the	DET
abc-4026	138	39	ph7wg2.0	ph7wg2.0	PROPN
abc-4026	138	40	vector	vector	NOUN
abc-4026	138	41	.	.	PUNCT
abc-4026	139	1	this	this	DET
abc-4026	139	2	construct	construct	NOUN
abc-4026	139	3	was	be	AUX
abc-4026	139	4	used	use	VERB
abc-4026	139	5	to	to	PART
abc-4026	139	6	transform	transform	VERB
abc-4026	139	7	trol	trol	NOUN
abc-4026	139	8	ko	ko	PROPN
abc-4026	139	9	arabidopsis	arabidopsis	NOUN
abc-4026	139	10	plants	plant	NOUN
abc-4026	139	11	.	.	PUNCT
abc-4026	140	1	seeds	seed	NOUN
abc-4026	140	2	from	from	ADP
abc-4026	140	3	transformed	transform	VERB
abc-4026	140	4	plants	plant	NOUN
abc-4026	140	5	were	be	AUX
abc-4026	140	6	collected	collect	VERB
abc-4026	140	7	(	(	PUNCT
abc-4026	140	8	t1	t1	NOUN
abc-4026	140	9	generation	generation	NOUN
abc-4026	140	10	)	)	PUNCT
abc-4026	140	11	and	and	CCONJ
abc-4026	140	12	homozygous	homozygous	ADJ
abc-4026	140	13	trol	trol	NOUN
abc-4026	140	14	-	-	PUNCT
abc-4026	140	15	ie	ie	X
abc-4026	140	16	plants	plant	NOUN
abc-4026	140	17	were	be	AUX
abc-4026	140	18	selected	select	VERB
abc-4026	140	19	up	up	ADP
abc-4026	140	20	to	to	ADP
abc-4026	140	21	the	the	DET
abc-4026	140	22	t3	t3	PROPN
abc-4026	140	23	generation	generation	NOUN
abc-4026	140	24	.	.	PUNCT
abc-4026	141	1	selection	selection	NOUN
abc-4026	141	2	for	for	ADP
abc-4026	141	3	hygromycin	hygromycin	PRON
abc-4026	141	4	resistance	resistance	NOUN
abc-4026	141	5	,	,	PUNCT
abc-4026	141	6	pcr	pcr	NOUN
abc-4026	141	7	,	,	PUNCT
abc-4026	141	8	and	and	CCONJ
abc-4026	141	9	testing	testing	NOUN
abc-4026	141	10	for	for	ADP
abc-4026	141	11	expression	expression	NOUN
abc-4026	141	12	of	of	ADP
abc-4026	141	13	recombinant	recombinant	ADJ
abc-4026	141	14	proteins	protein	NOUN
abc-4026	141	15	by	by	ADP
abc-4026	141	16	western	western	ADJ
abc-4026	141	17	blot	blot	NOUN
abc-4026	141	18	analysis	analysis	NOUN
abc-4026	141	19	,	,	PUNCT
abc-4026	141	20	in	in	ADP
abc-4026	141	21	combination	combination	NOUN
abc-4026	141	22	,	,	PUNCT
abc-4026	141	23	enabled	enable	VERB
abc-4026	141	24	us	we	PRON
abc-4026	141	25	to	to	PART
abc-4026	141	26	select	select	VERB
abc-4026	141	27	the	the	DET
abc-4026	141	28	homozygous	homozygous	ADJ
abc-4026	141	29	plants	plant	NOUN
abc-4026	141	30	carrying	carry	VERB
abc-4026	141	31	trol	trol	NOUN
abc-4026	141	32	only	only	ADV
abc-4026	141	33	in	in	ADP
abc-4026	141	34	the	the	DET
abc-4026	141	35	ie	ie	NOUN
abc-4026	141	36	of	of	ADP
abc-4026	141	37	chloroplasts	chloroplast	NOUN
abc-4026	141	38	.	.	PUNCT
abc-4026	142	1	the	the	DET
abc-4026	142	2	two	two	NUM
abc-4026	142	3	homozygous	homozygous	ADJ
abc-4026	142	4	mutant	mutant	ADJ
abc-4026	142	5	lines	line	NOUN
abc-4026	142	6	that	that	PRON
abc-4026	142	7	we	we	PRON
abc-4026	142	8	selected	select	VERB
abc-4026	142	9	for	for	ADP
abc-4026	142	10	future	future	ADJ
abc-4026	142	11	investigations	investigation	NOUN
abc-4026	142	12	were	be	AUX
abc-4026	142	13	named	name	VERB
abc-4026	142	14	trol	trol	NOUN
abc-4026	142	15	-	-	PUNCT
abc-4026	142	16	ie8	ie8	NOUN
abc-4026	142	17	and	and	CCONJ
abc-4026	142	18	trol	trol	NOUN
abc-4026	142	19	-	-	PUNCT
abc-4026	142	20	ie18	ie18	PROPN
abc-4026	142	21	.	.	PUNCT
abc-4026	143	1	as	as	ADP
abc-4026	143	2	controls	control	NOUN
abc-4026	143	3	,	,	PUNCT
abc-4026	143	4	we	we	PRON
abc-4026	143	5	used	use	VERB
abc-4026	143	6	attrol	attrol	NOUN
abc-4026	143	7	containing	contain	VERB
abc-4026	143	8	the	the	DET
abc-4026	143	9	entire	entire	ADJ
abc-4026	143	10	wildtype	wildtype	NOUN
abc-4026	143	11	sequence	sequence	NOUN
abc-4026	143	12	(	(	PUNCT
abc-4026	143	13	wt	wt	NOUN
abc-4026	143	14	)	)	PUNCT
abc-4026	143	15	,	,	PUNCT
abc-4026	143	16	as	as	ADV
abc-4026	143	17	well	well	ADV
abc-4026	143	18	as	as	ADP
abc-4026	143	19	plants	plant	NOUN
abc-4026	143	20	overexpressing	overexpresse	VERB
abc-4026	143	21	trol	trol	NOUN
abc-4026	143	22	,	,	PUNCT
abc-4026	143	23	with	with	ADP
abc-4026	143	24	c	c	NOUN
abc-4026	143	25	-	-	PUNCT
abc-4026	143	26	terminal	terminal	ADJ
abc-4026	143	27	flag	flag	NOUN
abc-4026	143	28	and	and	CCONJ
abc-4026	143	29	ha	ha	INTJ
abc-4026	143	30	tags	tag	NOUN
abc-4026	143	31	(	(	PUNCT
abc-4026	143	32	ox	ox	NOUN
abc-4026	143	33	)	)	PUNCT
abc-4026	143	34	.	.	PUNCT
abc-4026	144	1	whole	whole	ADJ
abc-4026	144	2	leaf	leaf	NOUN
abc-4026	144	3	extracts	extract	NOUN
abc-4026	144	4	,	,	PUNCT
abc-4026	144	5	isolated	isolated	ADJ
abc-4026	144	6	chloroplasts	chloroplast	NOUN
abc-4026	144	7	and	and	CCONJ
abc-4026	144	8	chloroplast	chloroplast	NOUN
abc-4026	144	9	membranes	membrane	NOUN
abc-4026	144	10	were	be	AUX
abc-4026	144	11	tested	test	VERB
abc-4026	144	12	for	for	ADP
abc-4026	144	13	the	the	DET
abc-4026	144	14	presence	presence	NOUN
abc-4026	144	15	of	of	ADP
abc-4026	144	16	trol	trol	NOUN
abc-4026	144	17	and	and	CCONJ
abc-4026	144	18	ha	ha	NOUN
abc-4026	144	19	-	-	NOUN
abc-4026	144	20	tags	tag	NOUN
abc-4026	144	21	in	in	ADP
abc-4026	144	22	these	these	DET
abc-4026	144	23	lines	line	NOUN
abc-4026	144	24	.	.	PUNCT
abc-4026	145	1	both	both	DET
abc-4026	145	2	antibodies	antibodie	VERB
abc-4026	145	3	(	(	PUNCT
abc-4026	145	4	anti	anti	ADJ
abc-4026	145	5	-	-	ADJ
abc-4026	145	6	trol	trol	ADJ
abc-4026	145	7	and	and	CCONJ
abc-4026	145	8	anti	anti	ADJ
abc-4026	145	9	-	-	ADJ
abc-4026	145	10	ha	ha	INTJ
abc-4026	145	11	)	)	PUNCT
abc-4026	145	12	could	could	AUX
abc-4026	145	13	detect	detect	VERB
abc-4026	145	14	the	the	DET
abc-4026	145	15	newly	newly	ADV
abc-4026	145	16	transformed	transform	VERB
abc-4026	145	17	protein	protein	NOUN
abc-4026	145	18	in	in	ADP
abc-4026	145	19	the	the	DET
abc-4026	145	20	inner	inner	ADJ
abc-4026	145	21	envelope	envelope	NOUN
abc-4026	145	22	membrane	membrane	NOUN
abc-4026	145	23	(	(	PUNCT
abc-4026	145	24	ie8	ie8	NOUN
abc-4026	145	25	and	and	CCONJ
abc-4026	145	26	ie18	ie18	PROPN
abc-4026	145	27	,	,	PUNCT
abc-4026	145	28	fig	fig	NOUN
abc-4026	145	29	.	.	PUNCT
abc-4026	146	1	1a	1a	PROPN
abc-4026	146	2	lanes	lane	VERB
abc-4026	146	3	6	6	NUM
abc-4026	146	4	-	-	SYM
abc-4026	146	5	9	9	NUM
abc-4026	146	6	and	and	CCONJ
abc-4026	146	7	17	17	NUM
abc-4026	146	8	-	-	SYM
abc-4026	146	9	20	20	NUM
abc-4026	146	10	)	)	PUNCT
abc-4026	146	11	.	.	PUNCT
abc-4026	147	1	also	also	ADV
abc-4026	147	2	,	,	PUNCT
abc-4026	147	3	trol	trol	PROPN
abc-4026	147	4	was	be	AUX
abc-4026	147	5	successfully	successfully	ADV
abc-4026	147	6	recognized	recognize	VERB
abc-4026	147	7	by	by	ADP
abc-4026	147	8	the	the	DET
abc-4026	147	9	anti	anti	ADJ
abc-4026	147	10	-	-	ADJ
abc-4026	147	11	trol	trol	ADJ
abc-4026	147	12	fig	fig	NOUN
abc-4026	147	13	.	.	PUNCT
abc-4026	148	1	1	1	X
abc-4026	148	2	.	.	X
abc-4026	148	3	western	western	ADJ
abc-4026	148	4	blot	blot	NOUN
abc-4026	148	5	analysis	analysis	NOUN
abc-4026	148	6	of	of	ADP
abc-4026	148	7	a.	a.	NOUN
abc-4026	148	8	thaliana	thaliana	PROPN
abc-4026	148	9	trol	trol	PROPN
abc-4026	148	10	ko	ko	PROPN
abc-4026	148	11	plants	plant	NOUN
abc-4026	148	12	transformed	transform	VERB
abc-4026	148	13	with	with	ADP
abc-4026	148	14	the	the	DET
abc-4026	148	15	trol(a	trol(a	NOUN
abc-4026	148	16	/	/	SYM
abc-4026	148	17	i)-flag	i)-flag	NOUN
abc-4026	148	18	-	-	PUNCT
abc-4026	148	19	ha	ha	INTJ
abc-4026	148	20	construct	construct	NOUN
abc-4026	148	21	.	.	PUNCT
abc-4026	149	1	(	(	PUNCT
abc-4026	149	2	a	a	X
abc-4026	149	3	)	)	PUNCT
abc-4026	149	4	wild	wild	ADJ
abc-4026	149	5	type	type	NOUN
abc-4026	149	6	(	(	PUNCT
abc-4026	149	7	wt	wt	NOUN
abc-4026	149	8	,	,	PUNCT
abc-4026	149	9	lanes	lane	VERB
abc-4026	149	10	1	1	NUM
abc-4026	149	11	-	-	SYM
abc-4026	149	12	5	5	NUM
abc-4026	149	13	)	)	PUNCT
abc-4026	149	14	,	,	PUNCT
abc-4026	149	15	trol	trol	PROPN
abc-4026	149	16	overexpressor	overexpressor	PROPN
abc-4026	149	17	(	(	PUNCT
abc-4026	149	18	ox	ox	PROPN
abc-4026	149	19	,	,	PUNCT
abc-4026	149	20	lanes	lane	VERB
abc-4026	149	21	11	11	NUM
abc-4026	149	22	-	-	SYM
abc-4026	149	23	15	15	NUM
abc-4026	149	24	)	)	PUNCT
abc-4026	149	25	and	and	CCONJ
abc-4026	149	26	trol	trol	VERB
abc-4026	149	27	inner	inner	ADJ
abc-4026	149	28	envelope	envelope	NOUN
abc-4026	149	29	lines	line	NOUN
abc-4026	149	30	of	of	ADP
abc-4026	149	31	arabidopsis	arabidopsis	NOUN
abc-4026	149	32	(	(	PUNCT
abc-4026	149	33	ie8	ie8	NOUN
abc-4026	149	34	,	,	PUNCT
abc-4026	149	35	lanes	lane	VERB
abc-4026	149	36	6	6	NUM
abc-4026	149	37	-	-	SYM
abc-4026	149	38	9	9	NUM
abc-4026	149	39	,	,	PUNCT
abc-4026	149	40	and	and	CCONJ
abc-4026	149	41	ie18	ie18	PROPN
abc-4026	149	42	,	,	PUNCT
abc-4026	149	43	lanes	lane	VERB
abc-4026	149	44	17	17	NUM
abc-4026	149	45	-	-	SYM
abc-4026	149	46	20	20	NUM
abc-4026	149	47	)	)	PUNCT
abc-4026	149	48	have	have	AUX
abc-4026	149	49	been	be	AUX
abc-4026	149	50	analyzed	analyze	VERB
abc-4026	149	51	.	.	PUNCT
abc-4026	150	1	total	total	ADJ
abc-4026	150	2	leaf	leaf	NOUN
abc-4026	150	3	extract	extract	NOUN
abc-4026	150	4	(	(	PUNCT
abc-4026	150	5	tot	tot	NOUN
abc-4026	150	6	)	)	PUNCT
abc-4026	150	7	,	,	PUNCT
abc-4026	150	8	intact	intact	ADJ
abc-4026	150	9	chloroplasts	chloroplast	NOUN
abc-4026	150	10	(	(	PUNCT
abc-4026	150	11	c	c	NOUN
abc-4026	150	12	)	)	PUNCT
abc-4026	150	13	and	and	CCONJ
abc-4026	150	14	total	total	ADJ
abc-4026	150	15	chloroplast	chloroplast	NOUN
abc-4026	150	16	membranes	membrane	NOUN
abc-4026	150	17	(	(	PUNCT
abc-4026	150	18	t	t	NOUN
abc-4026	150	19	)	)	PUNCT
abc-4026	150	20	in	in	ADP
abc-4026	150	21	the	the	DET
abc-4026	150	22	amount	amount	NOUN
abc-4026	150	23	corresponding	correspond	VERB
abc-4026	150	24	to	to	ADP
abc-4026	150	25	30	30	NUM
abc-4026	150	26	µg	µg	NOUN
abc-4026	150	27	chlorophyll	chlorophyll	NOUN
abc-4026	150	28	were	be	AUX
abc-4026	150	29	analyzed	analyze	VERB
abc-4026	150	30	by	by	ADP
abc-4026	150	31	12	12	NUM
abc-4026	150	32	%	%	NOUN
abc-4026	150	33	sds	sds	NOUN
abc-4026	150	34	-	-	PUNCT
abc-4026	150	35	page	page	NOUN
abc-4026	150	36	and	and	CCONJ
abc-4026	150	37	western	western	ADJ
abc-4026	150	38	blotting	blotting	NOUN
abc-4026	150	39	.	.	PUNCT
abc-4026	151	1	membranes	membrane	NOUN
abc-4026	151	2	were	be	AUX
abc-4026	151	3	immunodetected	immunodetecte	VERB
abc-4026	151	4	with	with	ADP
abc-4026	151	5	antitrol	antitrol	NOUN
abc-4026	151	6	(	(	PUNCT
abc-4026	151	7	α	α	NOUN
abc-4026	151	8	-	-	PUNCT
abc-4026	151	9	trol	trol	NOUN
abc-4026	151	10	)	)	PUNCT
abc-4026	151	11	and	and	CCONJ
abc-4026	151	12	anti	anti	ADJ
abc-4026	151	13	-	-	ADJ
abc-4026	151	14	ha	ha	INTJ
abc-4026	151	15	antibodies	antibody	NOUN
abc-4026	151	16	(	(	PUNCT
abc-4026	151	17	α	α	NOUN
abc-4026	151	18	-	-	PUNCT
abc-4026	151	19	ha	ha	INTJ
abc-4026	151	20	)	)	PUNCT
abc-4026	151	21	.	.	PUNCT
abc-4026	152	1	conjugated	conjugate	VERB
abc-4026	152	2	secondary	secondary	ADJ
abc-4026	152	3	antibodies	antibodie	VERB
abc-4026	152	4	anti	anti	ADJ
abc-4026	152	5	-	-	ADJ
abc-4026	152	6	rabbit	rabbit	ADJ
abc-4026	152	7	igg	igg	PROPN
abc-4026	152	8	peroxidase	peroxidase	NOUN
abc-4026	152	9	for	for	ADP
abc-4026	152	10	anti	anti	ADJ
abc-4026	152	11	-	-	NOUN
abc-4026	152	12	trol	trol	ADJ
abc-4026	152	13	,	,	PUNCT
abc-4026	152	14	and	and	CCONJ
abc-4026	152	15	anti	anti	ADJ
abc-4026	152	16	-	-	ADJ
abc-4026	152	17	rat	rat	ADJ
abc-4026	152	18	igg	igg	PROPN
abc-4026	152	19	peroxidase	peroxidase	NOUN
abc-4026	152	20	for	for	ADP
abc-4026	152	21	anti	anti	ADJ
abc-4026	152	22	-	-	ADJ
abc-4026	152	23	ha	ha	INTJ
abc-4026	152	24	,	,	PUNCT
abc-4026	152	25	have	have	AUX
abc-4026	152	26	been	be	AUX
abc-4026	152	27	used	use	VERB
abc-4026	152	28	.	.	PUNCT
abc-4026	153	1	results	result	NOUN
abc-4026	153	2	were	be	AUX
abc-4026	153	3	visualized	visualize	VERB
abc-4026	153	4	by	by	ADP
abc-4026	153	5	enhanced	enhanced	ADJ
abc-4026	153	6	chemiluminescence	chemiluminescence	NOUN
abc-4026	153	7	(	(	PUNCT
abc-4026	153	8	ecl	ecl	NOUN
abc-4026	153	9	)	)	PUNCT
abc-4026	153	10	and	and	CCONJ
abc-4026	153	11	exposure	exposure	NOUN
abc-4026	153	12	to	to	ADP
abc-4026	153	13	x	x	ADJ
abc-4026	153	14	-	-	NOUN
abc-4026	153	15	ray	ray	NOUN
abc-4026	153	16	films	film	NOUN
abc-4026	153	17	.	.	PUNCT
abc-4026	154	1	lanes	lane	NOUN
abc-4026	154	2	10	10	NUM
abc-4026	154	3	and	and	CCONJ
abc-4026	154	4	16	16	NUM
abc-4026	154	5	represent	represent	VERB
abc-4026	154	6	protein	protein	NOUN
abc-4026	154	7	markers	marker	NOUN
abc-4026	154	8	in	in	ADP
abc-4026	154	9	kda	kda	PROPN
abc-4026	154	10	.	.	PUNCT
abc-4026	155	1	arrows	arrow	NOUN
abc-4026	155	2	denote	denote	VERB
abc-4026	155	3	the	the	DET
abc-4026	155	4	positions	position	NOUN
abc-4026	155	5	of	of	ADP
abc-4026	155	6	trol	trol	PROPN
abc-4026	155	7	preprotein	preprotein	PROPN
abc-4026	155	8	(	(	PUNCT
abc-4026	155	9	ptrol	ptrol	NOUN
abc-4026	155	10	)	)	PUNCT
abc-4026	155	11	and	and	CCONJ
abc-4026	155	12	mature	mature	ADJ
abc-4026	155	13	trol	trol	NOUN
abc-4026	155	14	(	(	PUNCT
abc-4026	155	15	mtrol	mtrol	NOUN
abc-4026	155	16	)	)	PUNCT
abc-4026	155	17	.	.	PUNCT
abc-4026	156	1	(	(	PUNCT
abc-4026	156	2	b	b	X
abc-4026	156	3	)	)	PUNCT
abc-4026	156	4	intact	intact	ADJ
abc-4026	156	5	chloroplasts	chloroplast	NOUN
abc-4026	156	6	of	of	ADP
abc-4026	156	7	wt	wt	NOUN
abc-4026	156	8	,	,	PUNCT
abc-4026	156	9	ox	ox	NOUN
abc-4026	156	10	,	,	PUNCT
abc-4026	156	11	ie8	ie8	NOUN
abc-4026	156	12	and	and	CCONJ
abc-4026	156	13	ie18	ie18	PROPN
abc-4026	156	14	lines	line	NOUN
abc-4026	156	15	in	in	ADP
abc-4026	156	16	the	the	DET
abc-4026	156	17	amounts	amount	NOUN
abc-4026	156	18	corresponding	correspond	VERB
abc-4026	156	19	to	to	ADP
abc-4026	156	20	5	5	NUM
abc-4026	156	21	µg	µg	NOUN
abc-4026	156	22	chlorophyll	chlorophyll	NOUN
abc-4026	156	23	were	be	AUX
abc-4026	156	24	analyzed	analyze	VERB
abc-4026	156	25	by	by	ADP
abc-4026	156	26	12	12	NUM
abc-4026	156	27	%	%	NOUN
abc-4026	156	28	sds	sds	NOUN
abc-4026	156	29	-	-	PUNCT
abc-4026	156	30	page	page	NOUN
abc-4026	156	31	and	and	CCONJ
abc-4026	156	32	western	western	ADJ
abc-4026	156	33	blotting	blotting	NOUN
abc-4026	156	34	,	,	PUNCT
abc-4026	156	35	as	as	SCONJ
abc-4026	156	36	described	describe	VERB
abc-4026	156	37	for	for	ADP
abc-4026	156	38	a.	a.	NOUN
abc-4026	156	39	lane	lane	PROPN
abc-4026	156	40	5	5	NUM
abc-4026	156	41	represents	represent	VERB
abc-4026	156	42	protein	protein	NOUN
abc-4026	156	43	marker	marker	NOUN
abc-4026	156	44	in	in	ADP
abc-4026	156	45	kda	kda	PROPN
abc-4026	156	46	.	.	PUNCT
abc-4026	157	1	arrow	arrow	NOUN
abc-4026	157	2	denotes	denote	VERB
abc-4026	157	3	the	the	DET
abc-4026	157	4	position	position	NOUN
abc-4026	157	5	of	of	ADP
abc-4026	157	6	trol	trol	NOUN
abc-4026	157	7	(	(	PUNCT
abc-4026	157	8	since	since	SCONJ
abc-4026	157	9	there	there	PRON
abc-4026	157	10	is	be	VERB
abc-4026	157	11	less	less	ADJ
abc-4026	157	12	sample	sample	NOUN
abc-4026	157	13	loaded	load	VERB
abc-4026	157	14	on	on	ADP
abc-4026	157	15	gel	gel	NOUN
abc-4026	157	16	,	,	PUNCT
abc-4026	157	17	preprotein	preprotein	PROPN
abc-4026	157	18	is	be	AUX
abc-4026	157	19	not	not	PART
abc-4026	157	20	visible	visible	ADJ
abc-4026	157	21	)	)	PUNCT
abc-4026	157	22	.	.	PUNCT
abc-4026	158	1	dual	dual	ADJ
abc-4026	158	2	to	to	ADP
abc-4026	158	3	single	single	ADJ
abc-4026	158	4	localization	localization	NOUN
abc-4026	158	5	exchange	exchange	NOUN
abc-4026	158	6	of	of	ADP
abc-4026	158	7	trol	trol	NOUN
abc-4026	158	8	protein	protein	NOUN
abc-4026	158	9	acta	acta	PROPN
abc-4026	158	10	bot	bot	PROPN
abc-4026	158	11	.	.	PUNCT
abc-4026	159	1	croat	croat	PROPN
abc-4026	159	2	.	.	PUNCT
abc-4026	160	1	84	84	NUM
abc-4026	160	2	(	(	PUNCT
abc-4026	160	3	2	2	NUM
abc-4026	160	4	)	)	PUNCT
abc-4026	160	5	,	,	PUNCT
abc-4026	160	6	2025	2025	NUM
abc-4026	160	7	261	261	NUM
abc-4026	160	8	and	and	CCONJ
abc-4026	160	9	anti	anti	ADJ
abc-4026	160	10	-	-	ADJ
abc-4026	160	11	ha	ha	INTJ
abc-4026	160	12	in	in	ADP
abc-4026	160	13	the	the	DET
abc-4026	160	14	overexpressor	overexpressor	NOUN
abc-4026	160	15	line	line	NOUN
abc-4026	160	16	(	(	PUNCT
abc-4026	160	17	fig	fig	NOUN
abc-4026	160	18	.	.	PUNCT
abc-4026	161	1	1a	1a	NOUN
abc-4026	161	2	,	,	PUNCT
abc-4026	161	3	lanes	lane	VERB
abc-4026	161	4	11	11	NUM
abc-4026	161	5	-	-	SYM
abc-4026	161	6	15	15	NUM
abc-4026	161	7	)	)	PUNCT
abc-4026	161	8	.	.	PUNCT
abc-4026	162	1	anti	anti	ADJ
abc-4026	162	2	-	-	ADJ
abc-4026	162	3	ha	ha	ADJ
abc-4026	162	4	antibody	antibody	NOUN
abc-4026	162	5	did	do	AUX
abc-4026	162	6	not	not	PART
abc-4026	162	7	recognize	recognize	VERB
abc-4026	162	8	trol	trol	NOUN
abc-4026	162	9	or	or	CCONJ
abc-4026	162	10	any	any	DET
abc-4026	162	11	other	other	ADJ
abc-4026	162	12	protein	protein	NOUN
abc-4026	162	13	in	in	ADP
abc-4026	162	14	the	the	DET
abc-4026	162	15	wt	wt	NOUN
abc-4026	162	16	plants	plant	NOUN
abc-4026	162	17	,	,	PUNCT
abc-4026	162	18	since	since	SCONJ
abc-4026	162	19	in	in	ADP
abc-4026	162	20	those	those	DET
abc-4026	162	21	plants	plant	NOUN
abc-4026	162	22	there	there	PRON
abc-4026	162	23	was	be	VERB
abc-4026	162	24	no	no	DET
abc-4026	162	25	ha	ha	NOUN
abc-4026	162	26	-	-	PUNCT
abc-4026	162	27	epitope	epitope	NOUN
abc-4026	162	28	(	(	PUNCT
abc-4026	162	29	fig	fig	NOUN
abc-4026	162	30	.	.	PUNCT
abc-4026	163	1	1a	1a	NOUN
abc-4026	163	2	,	,	PUNCT
abc-4026	163	3	lanes	lane	VERB
abc-4026	163	4	3	3	NUM
abc-4026	163	5	-	-	SYM
abc-4026	163	6	5	5	NUM
abc-4026	163	7	)	)	PUNCT
abc-4026	163	8	.	.	PUNCT
abc-4026	164	1	due	due	ADP
abc-4026	164	2	to	to	ADP
abc-4026	164	3	a	a	DET
abc-4026	164	4	stronger	strong	ADJ
abc-4026	164	5	background	background	NOUN
abc-4026	164	6	in	in	ADP
abc-4026	164	7	all	all	DET
abc-4026	164	8	tested	test	VERB
abc-4026	164	9	extracts	extract	NOUN
abc-4026	164	10	,	,	PUNCT
abc-4026	164	11	we	we	PRON
abc-4026	164	12	attempted	attempt	VERB
abc-4026	164	13	to	to	PART
abc-4026	164	14	analyze	analyze	VERB
abc-4026	164	15	the	the	DET
abc-4026	164	16	lower	low	ADJ
abc-4026	164	17	amount	amount	NOUN
abc-4026	164	18	of	of	ADP
abc-4026	164	19	intact	intact	ADJ
abc-4026	164	20	chloroplast	chloroplast	ADJ
abc-4026	164	21	samples	sample	NOUN
abc-4026	164	22	(	(	PUNCT
abc-4026	164	23	fig	fig	NOUN
abc-4026	164	24	.	.	PUNCT
abc-4026	164	25	1b	1b	NUM
abc-4026	164	26	)	)	PUNCT
abc-4026	164	27	.	.	PUNCT
abc-4026	165	1	in	in	ADP
abc-4026	165	2	this	this	DET
abc-4026	165	3	way	way	NOUN
abc-4026	165	4	,	,	PUNCT
abc-4026	165	5	we	we	PRON
abc-4026	165	6	greatly	greatly	ADV
abc-4026	165	7	reduced	reduce	VERB
abc-4026	165	8	unnecessary	unnecessary	ADJ
abc-4026	165	9	background	background	NOUN
abc-4026	165	10	bands	band	NOUN
abc-4026	165	11	and	and	CCONJ
abc-4026	165	12	once	once	ADV
abc-4026	165	13	again	again	ADV
abc-4026	165	14	confirmed	confirm	VERB
abc-4026	165	15	that	that	SCONJ
abc-4026	165	16	the	the	DET
abc-4026	165	17	ie	ie	X
abc-4026	165	18	plants	plant	NOUN
abc-4026	165	19	express	express	VERB
abc-4026	165	20	the	the	DET
abc-4026	165	21	modified	modify	VERB
abc-4026	165	22	trol	trol	NOUN
abc-4026	165	23	.	.	PUNCT
abc-4026	166	1	although	although	SCONJ
abc-4026	166	2	we	we	PRON
abc-4026	166	3	have	have	AUX
abc-4026	166	4	successfully	successfully	ADV
abc-4026	166	5	confirmed	confirm	VERB
abc-4026	166	6	the	the	DET
abc-4026	166	7	presence	presence	NOUN
abc-4026	166	8	of	of	ADP
abc-4026	166	9	trol	trol	NOUN
abc-4026	166	10	in	in	ADP
abc-4026	166	11	the	the	DET
abc-4026	166	12	ie	ie	X
abc-4026	166	13	plants	plant	NOUN
abc-4026	166	14	,	,	PUNCT
abc-4026	166	15	we	we	PRON
abc-4026	166	16	did	do	AUX
abc-4026	166	17	not	not	PART
abc-4026	166	18	manage	manage	VERB
abc-4026	166	19	to	to	PART
abc-4026	166	20	confirm	confirm	VERB
abc-4026	166	21	the	the	DET
abc-4026	166	22	exact	exact	ADJ
abc-4026	166	23	molecular	molecular	ADJ
abc-4026	166	24	weight	weight	NOUN
abc-4026	166	25	of	of	ADP
abc-4026	166	26	these	these	DET
abc-4026	166	27	proteins	protein	NOUN
abc-4026	166	28	on	on	ADP
abc-4026	166	29	the	the	DET
abc-4026	166	30	sds	sds	NOUN
abc-4026	166	31	-	-	PUNCT
abc-4026	166	32	page	page	NOUN
abc-4026	166	33	,	,	PUNCT
abc-4026	166	34	even	even	ADV
abc-4026	166	35	when	when	SCONJ
abc-4026	166	36	using	use	VERB
abc-4026	166	37	strongly	strongly	ADV
abc-4026	166	38	denaturating	denaturate	VERB
abc-4026	166	39	urea	urea	NOUN
abc-4026	166	40	gels	gel	NOUN
abc-4026	166	41	(	(	PUNCT
abc-4026	166	42	data	datum	NOUN
abc-4026	166	43	not	not	PART
abc-4026	166	44	shown	show	VERB
abc-4026	166	45	,	,	PUNCT
abc-4026	166	46	sirpiö	sirpiö	PROPN
abc-4026	166	47	et	et	PROPN
abc-4026	166	48	al	al	PROPN
abc-4026	166	49	.	.	PROPN
abc-4026	166	50	2011	2011	NUM
abc-4026	166	51	)	)	PUNCT
abc-4026	166	52	.	.	PUNCT
abc-4026	167	1	the	the	DET
abc-4026	167	2	calculated	calculate	VERB
abc-4026	167	3	size	size	NOUN
abc-4026	167	4	difference	difference	NOUN
abc-4026	167	5	between	between	ADP
abc-4026	167	6	the	the	DET
abc-4026	167	7	precursor	precursor	NOUN
abc-4026	167	8	and	and	CCONJ
abc-4026	167	9	the	the	DET
abc-4026	167	10	mature	mature	ADJ
abc-4026	167	11	form	form	NOUN
abc-4026	167	12	of	of	ADP
abc-4026	167	13	the	the	DET
abc-4026	167	14	trol	trol	NOUN
abc-4026	167	15	is	be	AUX
abc-4026	167	16	only	only	ADV
abc-4026	167	17	4	4	NUM
abc-4026	167	18	kda	kda	NOUN
abc-4026	167	19	.	.	PUNCT
abc-4026	168	1	to	to	PART
abc-4026	168	2	prove	prove	VERB
abc-4026	168	3	that	that	SCONJ
abc-4026	168	4	the	the	DET
abc-4026	168	5	protein	protein	NOUN
abc-4026	168	6	trol	trol	NOUN
abc-4026	168	7	that	that	PRON
abc-4026	168	8	we	we	PRON
abc-4026	168	9	detected	detect	VERB
abc-4026	168	10	in	in	ADP
abc-4026	168	11	the	the	DET
abc-4026	168	12	ie	ie	X
abc-4026	168	13	plants	plant	NOUN
abc-4026	168	14	was	be	AUX
abc-4026	168	15	indeed	indeed	ADV
abc-4026	168	16	the	the	DET
abc-4026	168	17	precursor	precursor	NOUN
abc-4026	168	18	,	,	PUNCT
abc-4026	168	19	and	and	CCONJ
abc-4026	168	20	indeed	indeed	ADV
abc-4026	168	21	only	only	ADV
abc-4026	168	22	in	in	ADP
abc-4026	168	23	the	the	DET
abc-4026	168	24	inner	inner	ADJ
abc-4026	168	25	envelope	envelope	NOUN
abc-4026	168	26	membrane	membrane	NOUN
abc-4026	168	27	,	,	PUNCT
abc-4026	168	28	we	we	PRON
abc-4026	168	29	had	have	VERB
abc-4026	168	30	to	to	PART
abc-4026	168	31	develop	develop	VERB
abc-4026	168	32	a	a	DET
abc-4026	168	33	method	method	NOUN
abc-4026	168	34	that	that	PRON
abc-4026	168	35	would	would	AUX
abc-4026	168	36	recognize	recognize	VERB
abc-4026	168	37	only	only	ADV
abc-4026	168	38	the	the	DET
abc-4026	168	39	precursor	precursor	NOUN
abc-4026	168	40	of	of	ADP
abc-4026	168	41	the	the	DET
abc-4026	168	42	trol	trol	NOUN
abc-4026	168	43	and	and	CCONJ
abc-4026	168	44	not	not	PART
abc-4026	168	45	its	its	PRON
abc-4026	168	46	processed	process	VERB
abc-4026	168	47	form	form	NOUN
abc-4026	168	48	.	.	PUNCT
abc-4026	169	1	phenotype	phenotype	NOUN
abc-4026	169	2	of	of	ADP
abc-4026	169	3	trol	trol	NOUN
abc-4026	169	4	-	-	PUNCT
abc-4026	169	5	ie	ie	X
abc-4026	169	6	plants	plant	NOUN
abc-4026	169	7	arabidopsis	arabidopsis	VERB
abc-4026	169	8	ie8	ie8	NOUN
abc-4026	169	9	and	and	CCONJ
abc-4026	169	10	ie18	ie18	PROPN
abc-4026	169	11	lines	line	NOUN
abc-4026	169	12	grew	grow	VERB
abc-4026	169	13	well	well	ADV
abc-4026	169	14	under	under	ADP
abc-4026	169	15	the	the	DET
abc-4026	169	16	same	same	ADJ
abc-4026	169	17	conditions	condition	NOUN
abc-4026	169	18	as	as	ADP
abc-4026	169	19	the	the	DET
abc-4026	169	20	wt	wt	NOUN
abc-4026	169	21	plants	plant	NOUN
abc-4026	169	22	.	.	PUNCT
abc-4026	170	1	their	their	PRON
abc-4026	170	2	hypocotyls	hypocotyls	NOUN
abc-4026	170	3	developed	develop	VERB
abc-4026	170	4	later	later	ADV
abc-4026	170	5	(	(	PUNCT
abc-4026	170	6	fig	fig	NOUN
abc-4026	170	7	.	.	PUNCT
abc-4026	170	8	2a	2a	NUM
abc-4026	170	9	)	)	PUNCT
abc-4026	170	10	;	;	PUNCT
abc-4026	170	11	they	they	PRON
abc-4026	170	12	grew	grow	VERB
abc-4026	170	13	somewhat	somewhat	ADV
abc-4026	170	14	slower	slow	ADJ
abc-4026	170	15	due	due	ADP
abc-4026	170	16	to	to	ADP
abc-4026	170	17	the	the	DET
abc-4026	170	18	delayed	delay	VERB
abc-4026	170	19	germination	germination	NOUN
abc-4026	170	20	(	(	PUNCT
abc-4026	170	21	fig	fig	NOUN
abc-4026	170	22	.	.	PUNCT
abc-4026	171	1	2	2	NUM
abc-4026	171	2	)	)	PUNCT
abc-4026	171	3	.	.	PUNCT
abc-4026	172	1	at	at	ADP
abc-4026	172	2	3.5	3.5	NUM
abc-4026	172	3	to	to	PART
abc-4026	172	4	4	4	NUM
abc-4026	172	5	weeks	week	NOUN
abc-4026	172	6	of	of	ADP
abc-4026	172	7	age	age	NOUN
abc-4026	172	8	,	,	PUNCT
abc-4026	172	9	before	before	ADP
abc-4026	172	10	flowering	flowering	NOUN
abc-4026	172	11	starts	start	NOUN
abc-4026	172	12	,	,	PUNCT
abc-4026	172	13	the	the	DET
abc-4026	172	14	plants	plant	NOUN
abc-4026	172	15	are	be	AUX
abc-4026	172	16	most	most	ADV
abc-4026	172	17	suitable	suitable	ADJ
abc-4026	172	18	for	for	ADP
abc-4026	172	19	biochemical	biochemical	ADJ
abc-4026	172	20	experiments	experiment	NOUN
abc-4026	172	21	.	.	PUNCT
abc-4026	173	1	at	at	ADP
abc-4026	173	2	this	this	DET
abc-4026	173	3	stage	stage	NOUN
abc-4026	173	4	trol	trol	NOUN
abc-4026	173	5	-	-	PUNCT
abc-4026	173	6	ie	ie	X
abc-4026	173	7	plants	plant	NOUN
abc-4026	173	8	had	have	VERB
abc-4026	173	9	smaller	small	ADJ
abc-4026	173	10	rosettes	rosette	NOUN
abc-4026	173	11	than	than	ADP
abc-4026	173	12	the	the	DET
abc-4026	173	13	wt	wt	NOUN
abc-4026	173	14	,	,	PUNCT
abc-4026	173	15	and	and	CCONJ
abc-4026	173	16	smaller	small	ADJ
abc-4026	173	17	biomass	biomass	NOUN
abc-4026	173	18	.	.	PUNCT
abc-4026	174	1	as	as	SCONJ
abc-4026	174	2	they	they	PRON
abc-4026	174	3	grew	grow	VERB
abc-4026	174	4	,	,	PUNCT
abc-4026	174	5	their	their	PRON
abc-4026	174	6	stems	stem	NOUN
abc-4026	174	7	seemed	seem	VERB
abc-4026	174	8	to	to	PART
abc-4026	174	9	be	be	AUX
abc-4026	174	10	slightly	slightly	ADV
abc-4026	174	11	thinner	thin	ADJ
abc-4026	174	12	than	than	ADP
abc-4026	174	13	the	the	DET
abc-4026	174	14	stems	stem	NOUN
abc-4026	174	15	of	of	ADP
abc-4026	174	16	wt	wt	PROPN
abc-4026	174	17	.	.	PUNCT
abc-4026	175	1	the	the	DET
abc-4026	175	2	flowering	flowering	NOUN
abc-4026	175	3	was	be	AUX
abc-4026	175	4	slightly	slightly	ADV
abc-4026	175	5	delayed	delay	VERB
abc-4026	175	6	,	,	PUNCT
abc-4026	175	7	and	and	CCONJ
abc-4026	175	8	they	they	PRON
abc-4026	175	9	produced	produce	VERB
abc-4026	175	10	a	a	DET
abc-4026	175	11	significantly	significantly	ADV
abc-4026	175	12	smaller	small	ADJ
abc-4026	175	13	number	number	NOUN
abc-4026	175	14	of	of	ADP
abc-4026	175	15	siliques	silique	NOUN
abc-4026	175	16	and	and	CCONJ
abc-4026	175	17	seeds	seed	NOUN
abc-4026	175	18	than	than	ADP
abc-4026	175	19	the	the	DET
abc-4026	175	20	wt	wt	NOUN
abc-4026	175	21	.	.	PROPN
abc-4026	176	1	otherwise	otherwise	ADV
abc-4026	176	2	,	,	PUNCT
abc-4026	176	3	they	they	PRON
abc-4026	176	4	resembled	resemble	VERB
abc-4026	176	5	the	the	DET
abc-4026	176	6	phenotype	phenotype	NOUN
abc-4026	176	7	of	of	ADP
abc-4026	176	8	wt	wt	NOUN
abc-4026	176	9	arabidopsis	arabidopsis	NOUN
abc-4026	176	10	.	.	PUNCT
abc-4026	177	1	production	production	NOUN
abc-4026	177	2	of	of	ADP
abc-4026	177	3	the	the	DET
abc-4026	177	4	antibody	antibody	NOUN
abc-4026	177	5	against	against	ADP
abc-4026	177	6	the	the	DET
abc-4026	177	7	presequence	presequence	NOUN
abc-4026	177	8	of	of	ADP
abc-4026	177	9	trol	trol	NOUN
abc-4026	177	10	since	since	SCONJ
abc-4026	177	11	anti	anti	ADJ
abc-4026	177	12	-	-	ADJ
abc-4026	177	13	trol	trol	ADJ
abc-4026	177	14	antibody	antibody	NOUN
abc-4026	177	15	recognizes	recognize	VERB
abc-4026	177	16	both	both	CCONJ
abc-4026	177	17	the	the	DET
abc-4026	177	18	inner	inner	ADJ
abc-4026	177	19	envelope	envelope	NOUN
abc-4026	177	20	membrane	membrane	NOUN
abc-4026	177	21	(	(	PUNCT
abc-4026	177	22	precursor	precursor	NOUN
abc-4026	177	23	)	)	PUNCT
abc-4026	177	24	form	form	NOUN
abc-4026	177	25	and	and	CCONJ
abc-4026	177	26	the	the	DET
abc-4026	177	27	thylakoid	thylakoid	ADJ
abc-4026	177	28	membrane	membrane	NOUN
abc-4026	177	29	-	-	PUNCT
abc-4026	177	30	located	locate	VERB
abc-4026	177	31	(	(	PUNCT
abc-4026	177	32	mature	mature	NOUN
abc-4026	177	33	)	)	PUNCT
abc-4026	177	34	trol	trol	NOUN
abc-4026	177	35	protein	protein	NOUN
abc-4026	177	36	,	,	PUNCT
abc-4026	177	37	we	we	PRON
abc-4026	177	38	decided	decide	VERB
abc-4026	177	39	to	to	PART
abc-4026	177	40	produce	produce	VERB
abc-4026	177	41	additional	additional	ADJ
abc-4026	177	42	antibody	antibody	NOUN
abc-4026	177	43	against	against	ADP
abc-4026	177	44	the	the	DET
abc-4026	177	45	n	n	CCONJ
abc-4026	177	46	-	-	PUNCT
abc-4026	177	47	terminal	terminal	ADJ
abc-4026	177	48	presequence	presequence	NOUN
abc-4026	177	49	of	of	ADP
abc-4026	177	50	the	the	DET
abc-4026	177	51	protein	protein	NOUN
abc-4026	177	52	(	(	PUNCT
abc-4026	177	53	not	not	PART
abc-4026	177	54	recognized	recognize	VERB
abc-4026	177	55	by	by	ADP
abc-4026	177	56	existing	exist	VERB
abc-4026	177	57	anti	anti	ADJ
abc-4026	177	58	-	-	NOUN
abc-4026	177	59	trol	trol	NOUN
abc-4026	177	60	)	)	PUNCT
abc-4026	177	61	.	.	PUNCT
abc-4026	178	1	for	for	ADP
abc-4026	178	2	that	that	DET
abc-4026	178	3	purpose	purpose	NOUN
abc-4026	178	4	,	,	PUNCT
abc-4026	178	5	synthetic	synthetic	ADJ
abc-4026	178	6	polypeptide	polypeptide	NOUN
abc-4026	178	7	of	of	ADP
abc-4026	178	8	66	66	NUM
abc-4026	178	9	n	n	CCONJ
abc-4026	178	10	-	-	PUNCT
abc-4026	178	11	terminal	terminal	ADJ
abc-4026	178	12	amino	amino	ADJ
abc-4026	178	13	acids	acid	NOUN
abc-4026	178	14	of	of	ADP
abc-4026	178	15	trol	trol	NOUN
abc-4026	178	16	presequence	presequence	NOUN
abc-4026	178	17	was	be	AUX
abc-4026	178	18	produced	produce	VERB
abc-4026	178	19	by	by	ADP
abc-4026	178	20	custom	custom	NOUN
abc-4026	178	21	peptide	peptide	NOUN
abc-4026	178	22	synthesis	synthesis	NOUN
abc-4026	178	23	(	(	PUNCT
abc-4026	178	24	davids	davids	PROPN
abc-4026	178	25	biotechnologie	biotechnologie	PROPN
abc-4026	178	26	gmbh	gmbh	PROPN
abc-4026	178	27	.	.	PUNCT
abc-4026	179	1	,	,	PUNCT
abc-4026	179	2	regensburg	regensburg	PROPN
abc-4026	179	3	,	,	PUNCT
abc-4026	179	4	germany	germany	PROPN
abc-4026	179	5	)	)	PUNCT
abc-4026	179	6	.	.	PUNCT
abc-4026	180	1	there	there	PRON
abc-4026	180	2	were	be	VERB
abc-4026	180	3	two	two	NUM
abc-4026	180	4	sera	sera	NOUN
abc-4026	180	5	produced	produce	VERB
abc-4026	180	6	:	:	PUNCT
abc-4026	180	7	serum	serum	NOUN
abc-4026	180	8	1	1	NUM
abc-4026	180	9	(	(	PUNCT
abc-4026	180	10	anti	anti	ADJ
abc-4026	180	11	-	-	ADJ
abc-4026	180	12	pretrol1	pretrol1	ADJ
abc-4026	180	13	)	)	PUNCT
abc-4026	180	14	from	from	ADP
abc-4026	180	15	rabbit	rabbit	NOUN
abc-4026	180	16	1	1	NUM
abc-4026	180	17	and	and	CCONJ
abc-4026	180	18	serum	serum	NOUN
abc-4026	180	19	2	2	NUM
abc-4026	180	20	(	(	PUNCT
abc-4026	180	21	anti	anti	ADJ
abc-4026	180	22	-	-	ADJ
abc-4026	180	23	pretrol2	pretrol2	ADJ
abc-4026	180	24	)	)	PUNCT
abc-4026	180	25	from	from	ADP
abc-4026	180	26	rabbit	rabbit	NOUN
abc-4026	180	27	2	2	NUM
abc-4026	180	28	.	.	PUNCT
abc-4026	181	1	both	both	DET
abc-4026	181	2	sera	sera	NOUN
abc-4026	181	3	were	be	AUX
abc-4026	181	4	rather	rather	ADV
abc-4026	181	5	unspecific	unspecific	ADJ
abc-4026	181	6	with	with	ADP
abc-4026	181	7	strong	strong	ADJ
abc-4026	181	8	background	background	NOUN
abc-4026	181	9	(	(	PUNCT
abc-4026	181	10	fig	fig	NOUN
abc-4026	181	11	.	.	PUNCT
abc-4026	182	1	3	3	NUM
abc-4026	182	2	,	,	PUNCT
abc-4026	182	3	lanes	lane	VERB
abc-4026	182	4	3	3	NUM
abc-4026	182	5	,	,	PUNCT
abc-4026	182	6	4	4	NUM
abc-4026	182	7	,	,	PUNCT
abc-4026	182	8	10	10	NUM
abc-4026	182	9	,	,	PUNCT
abc-4026	182	10	11	11	NUM
abc-4026	182	11	)	)	PUNCT
abc-4026	182	12	.	.	PUNCT
abc-4026	183	1	therefore	therefore	ADV
abc-4026	183	2	,	,	PUNCT
abc-4026	183	3	both	both	DET
abc-4026	183	4	sera	sera	NOUN
abc-4026	183	5	were	be	AUX
abc-4026	183	6	purified	purify	VERB
abc-4026	183	7	on	on	ADP
abc-4026	183	8	affinity	affinity	NOUN
abc-4026	183	9	matrix	matrix	NOUN
abc-4026	183	10	with	with	ADP
abc-4026	183	11	the	the	DET
abc-4026	183	12	bound	bound	ADJ
abc-4026	183	13	antigen	antigen	NOUN
abc-4026	183	14	(	(	PUNCT
abc-4026	183	15	synthetic	synthetic	ADJ
abc-4026	183	16	polypeptide	polypeptide	NOUN
abc-4026	183	17	of	of	ADP
abc-4026	183	18	66	66	NUM
abc-4026	183	19	n	n	CCONJ
abc-4026	183	20	-	-	PUNCT
abc-4026	183	21	terminal	terminal	ADJ
abc-4026	183	22	amino	amino	ADJ
abc-4026	183	23	acids	acid	NOUN
abc-4026	183	24	of	of	ADP
abc-4026	183	25	trol	trol	NOUN
abc-4026	183	26	presequence	presequence	NOUN
abc-4026	183	27	)	)	PUNCT
abc-4026	183	28	.	.	PUNCT
abc-4026	184	1	final	final	ADJ
abc-4026	184	2	products	product	NOUN
abc-4026	184	3	after	after	ADP
abc-4026	184	4	purification	purification	NOUN
abc-4026	184	5	were	be	AUX
abc-4026	184	6	:	:	PUNCT
abc-4026	184	7	serum	serum	NOUN
abc-4026	184	8	1	1	NUM
abc-4026	184	9	affinity	affinity	NOUN
abc-4026	184	10	purified	purify	VERB
abc-4026	184	11	(	(	PUNCT
abc-4026	184	12	anti	anti	ADJ
abc-4026	184	13	-	-	ADJ
abc-4026	184	14	pretrol1ap	pretrol1ap	ADJ
abc-4026	184	15	)	)	PUNCT
abc-4026	184	16	and	and	CCONJ
abc-4026	184	17	serum	serum	NOUN
abc-4026	184	18	2	2	NUM
abc-4026	184	19	affinity	affinity	NOUN
abc-4026	184	20	purified	purify	VERB
abc-4026	184	21	(	(	PUNCT
abc-4026	184	22	antifig	antifig	ADJ
abc-4026	184	23	.	.	PUNCT
abc-4026	185	1	2	2	X
abc-4026	185	2	.	.	X
abc-4026	185	3	the	the	DET
abc-4026	185	4	phenotype	phenotype	NOUN
abc-4026	185	5	of	of	ADP
abc-4026	185	6	arabidopsis	arabidopsis	NOUN
abc-4026	185	7	plants	plant	NOUN
abc-4026	185	8	that	that	PRON
abc-4026	185	9	contain	contain	VERB
abc-4026	185	10	protein	protein	NOUN
abc-4026	185	11	trol	trol	NOUN
abc-4026	185	12	only	only	ADV
abc-4026	185	13	in	in	ADP
abc-4026	185	14	the	the	DET
abc-4026	185	15	inner	inner	ADJ
abc-4026	185	16	envelope	envelope	NOUN
abc-4026	185	17	membrane	membrane	NOUN
abc-4026	185	18	of	of	ADP
abc-4026	185	19	chloroplasts	chloroplast	NOUN
abc-4026	185	20	(	(	PUNCT
abc-4026	185	21	trol	trol	NOUN
abc-4026	185	22	-	-	PUNCT
abc-4026	185	23	ie	ie	ADJ
abc-4026	185	24	plants	plant	NOUN
abc-4026	185	25	)	)	PUNCT
abc-4026	185	26	.	.	PUNCT
abc-4026	186	1	(	(	PUNCT
abc-4026	186	2	a	a	X
abc-4026	186	3	)	)	PUNCT
abc-4026	186	4	12	12	NUM
abc-4026	186	5	days	day	NOUN
abc-4026	186	6	old	old	ADJ
abc-4026	186	7	trol	trol	NOUN
abc-4026	186	8	-	-	PUNCT
abc-4026	186	9	ie	ie	ADJ
abc-4026	186	10	plants	plant	NOUN
abc-4026	186	11	in	in	ADP
abc-4026	186	12	comparison	comparison	NOUN
abc-4026	186	13	to	to	ADP
abc-4026	186	14	the	the	DET
abc-4026	186	15	wt	wt	NOUN
abc-4026	186	16	and	and	CCONJ
abc-4026	186	17	trol	trol	PROPN
abc-4026	186	18	ko	ko	PROPN
abc-4026	186	19	.	.	PUNCT
abc-4026	187	1	(	(	PUNCT
abc-4026	187	2	b	b	X
abc-4026	187	3	)	)	PUNCT
abc-4026	187	4	and	and	CCONJ
abc-4026	187	5	(	(	PUNCT
abc-4026	187	6	c	c	NOUN
abc-4026	187	7	)	)	PUNCT
abc-4026	187	8	4	4	NUM
abc-4026	187	9	weeks	week	NOUN
abc-4026	187	10	old	old	ADJ
abc-4026	187	11	plants	plant	NOUN
abc-4026	187	12	.	.	PUNCT
abc-4026	188	1	(	(	PUNCT
abc-4026	188	2	d	d	X
abc-4026	188	3	)	)	PUNCT
abc-4026	188	4	5	5	NUM
abc-4026	188	5	weeks	week	NOUN
abc-4026	188	6	old	old	ADJ
abc-4026	188	7	plants	plant	NOUN
abc-4026	188	8	that	that	PRON
abc-4026	188	9	started	start	VERB
abc-4026	188	10	flowering	flower	VERB
abc-4026	188	11	.	.	PUNCT
abc-4026	189	1	(	(	PUNCT
abc-4026	189	2	e	e	NOUN
abc-4026	189	3	)	)	PUNCT
abc-4026	189	4	9	9	NUM
abc-4026	189	5	weeks	week	NOUN
abc-4026	189	6	old	old	ADJ
abc-4026	189	7	plants	plant	NOUN
abc-4026	189	8	.	.	PUNCT
abc-4026	190	1	wt	wt	NOUN
abc-4026	190	2	denotes	denote	NOUN
abc-4026	190	3	wild	wild	ADJ
abc-4026	190	4	-	-	PUNCT
abc-4026	190	5	type	type	NOUN
abc-4026	190	6	arabidopsis	arabidopsis	NOUN
abc-4026	190	7	plants	plant	NOUN
abc-4026	190	8	ecotype	ecotype	PROPN
abc-4026	190	9	columbia	columbia	PROPN
abc-4026	190	10	(	(	PUNCT
abc-4026	190	11	col-0	col-0	NUM
abc-4026	190	12	)	)	PUNCT
abc-4026	190	13	;	;	PUNCT
abc-4026	190	14	ko	ko	PROPN
abc-4026	190	15	denotes	denote	NOUN
abc-4026	190	16	arabidopsis	arabidopsis	NOUN
abc-4026	190	17	trol	trol	NOUN
abc-4026	190	18	knock	knock	VERB
abc-4026	190	19	-	-	PUNCT
abc-4026	190	20	out	out	ADP
abc-4026	190	21	mutant	mutant	NOUN
abc-4026	190	22	;	;	PUNCT
abc-4026	190	23	ie8	ie8	NOUN
abc-4026	190	24	and	and	CCONJ
abc-4026	190	25	ie18	ie18	PROPN
abc-4026	190	26	are	be	AUX
abc-4026	190	27	arabidopsis	arabidopsis	NOUN
abc-4026	190	28	mutant	mutant	ADJ
abc-4026	190	29	lines	line	NOUN
abc-4026	190	30	that	that	PRON
abc-4026	190	31	contain	contain	VERB
abc-4026	190	32	trol	trol	NOUN
abc-4026	190	33	only	only	ADV
abc-4026	190	34	in	in	ADP
abc-4026	190	35	the	the	DET
abc-4026	190	36	inner	inner	ADJ
abc-4026	190	37	envelope	envelope	NOUN
abc-4026	190	38	membrane	membrane	NOUN
abc-4026	190	39	of	of	ADP
abc-4026	190	40	chloroplasts	chloroplast	NOUN
abc-4026	190	41	.	.	PUNCT
abc-4026	191	1	vojta	vojta	PROPN
abc-4026	191	2	l.	l.	PROPN
abc-4026	191	3	,	,	PUNCT
abc-4026	191	4	fulgosi	fulgosi	PROPN
abc-4026	191	5	h.	h.	PROPN
abc-4026	191	6	,	,	PUNCT
abc-4026	191	7	tomašić	tomašić	PROPN
abc-4026	191	8	paić	paić	PROPN
abc-4026	191	9	a.	a.	PROPN
abc-4026	191	10	,	,	PUNCT
abc-4026	191	11	dumančić	dumančić	PROPN
abc-4026	191	12	e.	e.	PROPN
abc-4026	191	13	262	262	NUM
abc-4026	191	14	acta	acta	PROPN
abc-4026	191	15	bot	bot	PROPN
abc-4026	191	16	.	.	PUNCT
abc-4026	192	1	croat	croat	PROPN
abc-4026	192	2	.	.	PUNCT
abc-4026	193	1	84	84	NUM
abc-4026	193	2	(	(	PUNCT
abc-4026	193	3	2	2	NUM
abc-4026	193	4	)	)	PUNCT
abc-4026	193	5	,	,	PUNCT
abc-4026	193	6	2025	2025	NUM
abc-4026	193	7	pretrol2ap	pretrol2ap	NOUN
abc-4026	193	8	)	)	PUNCT
abc-4026	193	9	.	.	PUNCT
abc-4026	194	1	they	they	PRON
abc-4026	194	2	seem	seem	VERB
abc-4026	194	3	highly	highly	ADV
abc-4026	194	4	purified	purified	ADJ
abc-4026	194	5	and	and	CCONJ
abc-4026	194	6	specific	specific	ADJ
abc-4026	194	7	(	(	PUNCT
abc-4026	194	8	fig	fig	NOUN
abc-4026	194	9	.	.	PUNCT
abc-4026	195	1	3	3	NUM
abc-4026	195	2	,	,	PUNCT
abc-4026	195	3	lanes	lane	NOUN
abc-4026	195	4	5	5	NUM
abc-4026	195	5	,	,	PUNCT
abc-4026	195	6	6	6	NUM
abc-4026	195	7	,	,	PUNCT
abc-4026	195	8	12	12	NUM
abc-4026	195	9	,	,	PUNCT
abc-4026	195	10	13	13	NUM
abc-4026	195	11	)	)	PUNCT
abc-4026	195	12	,	,	PUNCT
abc-4026	195	13	just	just	ADV
abc-4026	195	14	of	of	ADP
abc-4026	195	15	a	a	DET
abc-4026	195	16	very	very	ADV
abc-4026	195	17	low	low	ADJ
abc-4026	195	18	titer	titer	NOUN
abc-4026	195	19	.	.	PUNCT
abc-4026	196	1	therefore	therefore	ADV
abc-4026	196	2	,	,	PUNCT
abc-4026	196	3	we	we	PRON
abc-4026	196	4	determined	determine	VERB
abc-4026	196	5	experimentally	experimentally	ADV
abc-4026	196	6	that	that	SCONJ
abc-4026	196	7	a	a	DET
abc-4026	196	8	dilution	dilution	NOUN
abc-4026	196	9	of	of	ADP
abc-4026	196	10	1:100	1:100	NUM
abc-4026	196	11	was	be	AUX
abc-4026	196	12	the	the	DET
abc-4026	196	13	highest	high	ADJ
abc-4026	196	14	required	require	VERB
abc-4026	196	15	for	for	ADP
abc-4026	196	16	the	the	DET
abc-4026	196	17	proper	proper	ADJ
abc-4026	196	18	detection	detection	NOUN
abc-4026	196	19	of	of	ADP
abc-4026	196	20	the	the	DET
abc-4026	196	21	trol	trol	NOUN
abc-4026	196	22	precursor	precursor	NOUN
abc-4026	196	23	.	.	PUNCT
abc-4026	197	1	between	between	ADP
abc-4026	197	2	those	those	DET
abc-4026	197	3	two	two	NUM
abc-4026	197	4	purified	purified	ADJ
abc-4026	197	5	sera	sera	NOUN
abc-4026	197	6	,	,	PUNCT
abc-4026	197	7	anti	anti	ADJ
abc-4026	197	8	-	-	ADJ
abc-4026	197	9	pretrol2ap	pretrol2ap	NOUN
abc-4026	197	10	proved	prove	VERB
abc-4026	197	11	to	to	PART
abc-4026	197	12	be	be	AUX
abc-4026	197	13	a	a	DET
abc-4026	197	14	bit	bit	NOUN
abc-4026	197	15	stronger	strong	ADJ
abc-4026	197	16	and	and	CCONJ
abc-4026	197	17	therefore	therefore	ADV
abc-4026	197	18	we	we	PRON
abc-4026	197	19	decided	decide	VERB
abc-4026	197	20	to	to	PART
abc-4026	197	21	use	use	VERB
abc-4026	197	22	it	it	PRON
abc-4026	197	23	in	in	ADP
abc-4026	197	24	further	further	ADJ
abc-4026	197	25	experiments	experiment	NOUN
abc-4026	197	26	.	.	PUNCT
abc-4026	198	1	after	after	SCONJ
abc-4026	198	2	the	the	DET
abc-4026	198	3	pretrol	pretrol	PROPN
abc-4026	198	4	antiserum	antiserum	NOUN
abc-4026	198	5	was	be	AUX
abc-4026	198	6	successfully	successfully	ADV
abc-4026	198	7	produced	produce	VERB
abc-4026	198	8	,	,	PUNCT
abc-4026	198	9	we	we	PRON
abc-4026	198	10	tested	test	VERB
abc-4026	198	11	the	the	DET
abc-4026	198	12	chloroplasts	chloroplast	NOUN
abc-4026	198	13	from	from	ADP
abc-4026	198	14	ox	ox	ADJ
abc-4026	198	15	and	and	CCONJ
abc-4026	198	16	ie	ie	ADJ
abc-4026	198	17	lines	line	NOUN
abc-4026	198	18	by	by	ADP
abc-4026	198	19	sdspage	sdspage	NOUN
abc-4026	198	20	and	and	CCONJ
abc-4026	198	21	western	western	ADJ
abc-4026	198	22	blot	blot	NOUN
abc-4026	198	23	analysis	analysis	NOUN
abc-4026	198	24	,	,	PUNCT
abc-4026	198	25	as	as	SCONJ
abc-4026	198	26	described	describe	VERB
abc-4026	198	27	previously	previously	ADV
abc-4026	198	28	.	.	PUNCT
abc-4026	199	1	we	we	PRON
abc-4026	199	2	used	use	VERB
abc-4026	199	3	anti	anti	ADJ
abc-4026	199	4	-	-	ADJ
abc-4026	199	5	ha	ha	INTJ
abc-4026	199	6	and	and	CCONJ
abc-4026	199	7	anti	anti	ADJ
abc-4026	199	8	-	-	ADJ
abc-4026	199	9	pretrol	pretrol	ADJ
abc-4026	199	10	antisera	antisera	NOUN
abc-4026	199	11	.	.	PUNCT
abc-4026	200	1	affinity	affinity	NOUN
abc-4026	200	2	purified	purify	VERB
abc-4026	200	3	anti	anti	ADJ
abc-4026	200	4	-	-	ADJ
abc-4026	200	5	pretrol	pretrol	NOUN
abc-4026	200	6	clearly	clearly	ADV
abc-4026	200	7	recognized	recognize	VERB
abc-4026	200	8	only	only	ADV
abc-4026	200	9	a	a	DET
abc-4026	200	10	single	single	ADJ
abc-4026	200	11	band	band	NOUN
abc-4026	200	12	in	in	ADP
abc-4026	200	13	trol	trol	NOUN
abc-4026	200	14	-	-	PUNCT
abc-4026	200	15	ie8	ie8	NOUN
abc-4026	200	16	and	and	CCONJ
abc-4026	200	17	trol	trol	NOUN
abc-4026	200	18	-	-	PUNCT
abc-4026	200	19	ie18	ie18	PROPN
abc-4026	200	20	lines	line	NOUN
abc-4026	200	21	(	(	PUNCT
abc-4026	200	22	fig	fig	NOUN
abc-4026	200	23	.	.	PUNCT
abc-4026	201	1	3	3	NUM
abc-4026	201	2	,	,	PUNCT
abc-4026	201	3	lanes	lane	VERB
abc-4026	201	4	6	6	NUM
abc-4026	201	5	and	and	CCONJ
abc-4026	201	6	13	13	NUM
abc-4026	201	7	;	;	PUNCT
abc-4026	201	8	fig	fig	NOUN
abc-4026	201	9	.	.	PUNCT
abc-4026	202	1	4	4	NUM
abc-4026	202	2	,	,	PUNCT
abc-4026	202	3	lanes	lane	VERB
abc-4026	202	4	2	2	NUM
abc-4026	202	5	and	and	CCONJ
abc-4026	202	6	3	3	NUM
abc-4026	202	7	)	)	PUNCT
abc-4026	202	8	and	and	CCONJ
abc-4026	202	9	not	not	PART
abc-4026	202	10	in	in	ADP
abc-4026	202	11	the	the	DET
abc-4026	202	12	trol	trol	NOUN
abc-4026	202	13	ox	ox	NOUN
abc-4026	202	14	line	line	NOUN
abc-4026	202	15	(	(	PUNCT
abc-4026	202	16	fig	fig	NOUN
abc-4026	202	17	.	.	PUNCT
abc-4026	203	1	3	3	NUM
abc-4026	203	2	,	,	PUNCT
abc-4026	203	3	lanes	lane	VERB
abc-4026	203	4	5	5	NUM
abc-4026	203	5	and	and	CCONJ
abc-4026	203	6	12	12	NUM
abc-4026	203	7	;	;	PUNCT
abc-4026	203	8	fig	fig	NOUN
abc-4026	203	9	.	.	PUNCT
abc-4026	204	1	4	4	NUM
abc-4026	204	2	,	,	PUNCT
abc-4026	204	3	lane	lane	NOUN
abc-4026	204	4	1	1	NUM
abc-4026	204	5	)	)	PUNCT
abc-4026	204	6	.	.	PUNCT
abc-4026	205	1	anti	anti	ADJ
abc-4026	205	2	-	-	NOUN
abc-4026	205	3	pretrol	pretrol	NOUN
abc-4026	205	4	that	that	PRON
abc-4026	205	5	was	be	AUX
abc-4026	205	6	not	not	PART
abc-4026	205	7	affinity	affinity	NOUN
abc-4026	205	8	purified	purify	VERB
abc-4026	205	9	did	do	AUX
abc-4026	205	10	not	not	PART
abc-4026	205	11	differentiate	differentiate	VERB
abc-4026	205	12	between	between	ADP
abc-4026	205	13	trol	trol	NOUN
abc-4026	205	14	-	-	PUNCT
abc-4026	205	15	ie	ie	X
abc-4026	205	16	and	and	CCONJ
abc-4026	205	17	trol	trol	PROPN
abc-4026	205	18	ox	ox	PROPN
abc-4026	205	19	lines	line	NOUN
abc-4026	205	20	(	(	PUNCT
abc-4026	205	21	fig	fig	NOUN
abc-4026	205	22	.	.	PUNCT
abc-4026	206	1	3	3	NUM
abc-4026	206	2	,	,	PUNCT
abc-4026	206	3	lanes	lane	VERB
abc-4026	206	4	3	3	NUM
abc-4026	206	5	,	,	PUNCT
abc-4026	206	6	4	4	NUM
abc-4026	206	7	,	,	PUNCT
abc-4026	206	8	10	10	NUM
abc-4026	206	9	,	,	PUNCT
abc-4026	206	10	11	11	NUM
abc-4026	206	11	)	)	PUNCT
abc-4026	206	12	,	,	PUNCT
abc-4026	206	13	except	except	SCONJ
abc-4026	206	14	that	that	SCONJ
abc-4026	206	15	the	the	DET
abc-4026	206	16	resulting	result	VERB
abc-4026	206	17	signal	signal	NOUN
abc-4026	206	18	/	/	SYM
abc-4026	206	19	band	band	NOUN
abc-4026	206	20	was	be	AUX
abc-4026	206	21	more	more	ADV
abc-4026	206	22	intensive	intensive	ADJ
abc-4026	206	23	in	in	ADP
abc-4026	206	24	trol	trol	NOUN
abc-4026	206	25	-	-	PUNCT
abc-4026	206	26	ie	ie	ADJ
abc-4026	206	27	line	line	NOUN
abc-4026	206	28	(	(	PUNCT
abc-4026	206	29	fig	fig	NOUN
abc-4026	206	30	.	.	PUNCT
abc-4026	207	1	3	3	NUM
abc-4026	207	2	,	,	PUNCT
abc-4026	207	3	lanes	lane	VERB
abc-4026	207	4	4	4	NUM
abc-4026	207	5	,	,	PUNCT
abc-4026	207	6	11	11	NUM
abc-4026	207	7	)	)	PUNCT
abc-4026	207	8	.	.	PUNCT
abc-4026	208	1	when	when	SCONJ
abc-4026	208	2	compared	compare	VERB
abc-4026	208	3	to	to	ADP
abc-4026	208	4	the	the	DET
abc-4026	208	5	anti	anti	ADJ
abc-4026	208	6	-	-	ADJ
abc-4026	208	7	ha	ha	ADJ
abc-4026	208	8	blots	blot	NOUN
abc-4026	208	9	on	on	ADP
abc-4026	208	10	trolie	trolie	NOUN
abc-4026	208	11	lines	line	NOUN
abc-4026	208	12	,	,	PUNCT
abc-4026	208	13	it	it	PRON
abc-4026	208	14	was	be	AUX
abc-4026	208	15	clear	clear	ADJ
abc-4026	208	16	that	that	SCONJ
abc-4026	208	17	the	the	DET
abc-4026	208	18	affinity	affinity	NOUN
abc-4026	208	19	purified	purify	VERB
abc-4026	208	20	anti	anti	ADJ
abc-4026	208	21	-	-	ADJ
abc-4026	208	22	pretrol	pretrol	NOUN
abc-4026	208	23	recognized	recognize	VERB
abc-4026	208	24	the	the	DET
abc-4026	208	25	precursor	precursor	NOUN
abc-4026	208	26	and	and	CCONJ
abc-4026	208	27	not	not	PART
abc-4026	208	28	the	the	DET
abc-4026	208	29	mature	mature	ADJ
abc-4026	208	30	form	form	NOUN
abc-4026	208	31	of	of	ADP
abc-4026	208	32	trol	trol	NOUN
abc-4026	208	33	.	.	PUNCT
abc-4026	209	1	a	a	DET
abc-4026	209	2	very	very	ADV
abc-4026	209	3	weak	weak	ADJ
abc-4026	209	4	signal	signal	NOUN
abc-4026	209	5	was	be	AUX
abc-4026	209	6	observed	observe	VERB
abc-4026	209	7	on	on	ADP
abc-4026	209	8	the	the	DET
abc-4026	209	9	trol	trol	NOUN
abc-4026	209	10	ox	ox	NOUN
abc-4026	209	11	line	line	NOUN
abc-4026	209	12	(	(	PUNCT
abc-4026	209	13	fig	fig	NOUN
abc-4026	209	14	.	.	PUNCT
abc-4026	210	1	3	3	NUM
abc-4026	210	2	,	,	PUNCT
abc-4026	210	3	lanes	lane	VERB
abc-4026	210	4	5	5	NUM
abc-4026	210	5	and	and	CCONJ
abc-4026	210	6	12	12	NUM
abc-4026	210	7	)	)	PUNCT
abc-4026	210	8	.	.	PUNCT
abc-4026	211	1	it	it	PRON
abc-4026	211	2	corresponded	correspond	VERB
abc-4026	211	3	to	to	ADP
abc-4026	211	4	the	the	DET
abc-4026	211	5	ie	ie	ADJ
abc-4026	211	6	form	form	NOUN
abc-4026	211	7	of	of	ADP
abc-4026	211	8	trol	trol	NOUN
abc-4026	211	9	in	in	ADP
abc-4026	211	10	this	this	DET
abc-4026	211	11	line	line	NOUN
abc-4026	211	12	,	,	PUNCT
abc-4026	211	13	which	which	PRON
abc-4026	211	14	was	be	AUX
abc-4026	211	15	in	in	ADP
abc-4026	211	16	the	the	DET
abc-4026	211	17	vast	vast	ADJ
abc-4026	211	18	minority	minority	NOUN
abc-4026	211	19	in	in	ADP
abc-4026	211	20	comparison	comparison	NOUN
abc-4026	211	21	to	to	ADP
abc-4026	211	22	the	the	DET
abc-4026	211	23	thylakoidal	thylakoidal	ADJ
abc-4026	211	24	form	form	NOUN
abc-4026	211	25	of	of	ADP
abc-4026	211	26	trol	trol	NOUN
abc-4026	211	27	.	.	PUNCT
abc-4026	212	1	this	this	DET
abc-4026	212	2	weak	weak	ADJ
abc-4026	212	3	signal	signal	NOUN
abc-4026	212	4	was	be	AUX
abc-4026	212	5	visible	visible	ADJ
abc-4026	212	6	in	in	ADP
abc-4026	212	7	trol	trol	NOUN
abc-4026	212	8	ox	ox	ADJ
abc-4026	212	9	extracts	extract	NOUN
abc-4026	212	10	only	only	ADV
abc-4026	212	11	when	when	SCONJ
abc-4026	212	12	a	a	DET
abc-4026	212	13	sample	sample	NOUN
abc-4026	212	14	corresponding	correspond	VERB
abc-4026	212	15	to	to	ADP
abc-4026	212	16	40	40	NUM
abc-4026	212	17	or	or	CCONJ
abc-4026	212	18	more	more	ADJ
abc-4026	212	19	mg	mg	NOUN
abc-4026	212	20	chlorophyll	chlorophyll	NOUN
abc-4026	212	21	was	be	AUX
abc-4026	212	22	loaded	load	VERB
abc-4026	212	23	on	on	ADP
abc-4026	212	24	gel	gel	NOUN
abc-4026	212	25	.	.	PUNCT
abc-4026	213	1	these	these	DET
abc-4026	213	2	experiments	experiment	NOUN
abc-4026	213	3	confirmed	confirm	VERB
abc-4026	213	4	that	that	SCONJ
abc-4026	213	5	trol	trol	NOUN
abc-4026	213	6	is	be	AUX
abc-4026	213	7	located	locate	VERB
abc-4026	213	8	exclusively	exclusively	ADV
abc-4026	213	9	in	in	ADP
abc-4026	213	10	the	the	DET
abc-4026	213	11	inner	inner	ADJ
abc-4026	213	12	envelope	envelope	NOUN
abc-4026	213	13	membrane	membrane	NOUN
abc-4026	213	14	in	in	ADP
abc-4026	213	15	trol	trol	NOUN
abc-4026	213	16	-	-	PUNCT
abc-4026	213	17	ie8	ie8	NOUN
abc-4026	213	18	and	and	CCONJ
abc-4026	213	19	trol	trol	NOUN
abc-4026	213	20	-	-	PUNCT
abc-4026	213	21	ie18	ie18	PROPN
abc-4026	213	22	arabidopsis	arabidopsis	NOUN
abc-4026	213	23	lines	line	NOUN
abc-4026	213	24	,	,	PUNCT
abc-4026	213	25	and	and	CCONJ
abc-4026	213	26	that	that	SCONJ
abc-4026	213	27	the	the	DET
abc-4026	213	28	affinity	affinity	NOUN
abc-4026	213	29	purified	purify	VERB
abc-4026	213	30	pretrol	pretrol	NOUN
abc-4026	213	31	antiserum	antiserum	NOUN
abc-4026	213	32	can	can	AUX
abc-4026	213	33	be	be	AUX
abc-4026	213	34	further	far	ADV
abc-4026	213	35	used	use	VERB
abc-4026	213	36	to	to	PART
abc-4026	213	37	exclusively	exclusively	ADV
abc-4026	213	38	detect	detect	VERB
abc-4026	213	39	the	the	DET
abc-4026	213	40	inner	inner	ADJ
abc-4026	213	41	envelope	envelope	NOUN
abc-4026	213	42	membrane	membrane	NOUN
abc-4026	213	43	form	form	NOUN
abc-4026	213	44	of	of	ADP
abc-4026	213	45	trol	trol	NOUN
abc-4026	213	46	.	.	PUNCT
abc-4026	214	1	fig	fig	NOUN
abc-4026	214	2	.	.	PUNCT
abc-4026	215	1	3	3	X
abc-4026	215	2	.	.	X
abc-4026	215	3	testing	test	VERB
abc-4026	215	4	the	the	DET
abc-4026	215	5	anti	anti	ADJ
abc-4026	215	6	-	-	ADJ
abc-4026	215	7	pretrol	pretrol	ADJ
abc-4026	215	8	sera	sera	NOUN
abc-4026	215	9	on	on	ADP
abc-4026	215	10	ox	ox	NOUN
abc-4026	215	11	and	and	CCONJ
abc-4026	215	12	ie18	ie18	PROPN
abc-4026	215	13	arabidopsis	arabidopsis	NOUN
abc-4026	215	14	lines	line	NOUN
abc-4026	215	15	by	by	ADP
abc-4026	215	16	western	western	ADJ
abc-4026	215	17	blot	blot	NOUN
abc-4026	215	18	analysis	analysis	NOUN
abc-4026	215	19	.	.	PUNCT
abc-4026	216	1	trol	trol	PROPN
abc-4026	216	2	overexpressor	overexpressor	PROPN
abc-4026	216	3	(	(	PUNCT
abc-4026	216	4	ox	ox	NOUN
abc-4026	216	5	)	)	PUNCT
abc-4026	216	6	and	and	CCONJ
abc-4026	216	7	trol	trol	VERB
abc-4026	216	8	inner	inner	ADJ
abc-4026	216	9	envelope	envelope	NOUN
abc-4026	216	10	membrane	membrane	NOUN
abc-4026	216	11	ie8	ie8	NOUN
abc-4026	216	12	lines	line	NOUN
abc-4026	216	13	of	of	ADP
abc-4026	216	14	arabidopsis	arabidopsis	NOUN
abc-4026	216	15	have	have	AUX
abc-4026	216	16	been	be	AUX
abc-4026	216	17	analyzed	analyze	VERB
abc-4026	216	18	.	.	PUNCT
abc-4026	217	1	intact	intact	ADJ
abc-4026	217	2	chloroplasts	chloroplast	NOUN
abc-4026	217	3	in	in	ADP
abc-4026	217	4	an	an	DET
abc-4026	217	5	amount	amount	NOUN
abc-4026	217	6	corresponding	correspond	VERB
abc-4026	217	7	to	to	ADP
abc-4026	217	8	10	10	NUM
abc-4026	217	9	µg	µg	ADV
abc-4026	217	10	chlorophyll	chlorophyll	NOUN
abc-4026	217	11	for	for	ADP
abc-4026	217	12	anti	anti	ADJ
abc-4026	217	13	-	-	ADJ
abc-4026	217	14	ha	ha	INTJ
abc-4026	217	15	analyses	analysis	NOUN
abc-4026	217	16	and	and	CCONJ
abc-4026	217	17	40	40	NUM
abc-4026	217	18	µg	µg	ADV
abc-4026	217	19	chlorophyll	chlorophyll	NOUN
abc-4026	217	20	for	for	ADP
abc-4026	217	21	anti	anti	ADJ
abc-4026	217	22	-	-	ADJ
abc-4026	217	23	pretrol	pretrol	ADJ
abc-4026	217	24	analyses	analysis	NOUN
abc-4026	217	25	were	be	AUX
abc-4026	217	26	separated	separate	VERB
abc-4026	217	27	by	by	ADP
abc-4026	217	28	10	10	NUM
abc-4026	217	29	%	%	NOUN
abc-4026	217	30	sds	sds	NOUN
abc-4026	217	31	-	-	PUNCT
abc-4026	217	32	page	page	NOUN
abc-4026	217	33	,	,	PUNCT
abc-4026	217	34	transferred	transfer	VERB
abc-4026	217	35	to	to	ADP
abc-4026	217	36	a	a	DET
abc-4026	217	37	nitrocellulose	nitrocellulose	NOUN
abc-4026	217	38	membrane	membrane	NOUN
abc-4026	217	39	,	,	PUNCT
abc-4026	217	40	and	and	CCONJ
abc-4026	217	41	immunodecorated	immunodecorate	VERB
abc-4026	217	42	with	with	ADP
abc-4026	217	43	the	the	DET
abc-4026	217	44	anti	anti	NOUN
abc-4026	217	45	-	-	NOUN
abc-4026	217	46	pretrol	pretrol	ADJ
abc-4026	217	47	(	(	PUNCT
abc-4026	217	48	α	α	NOUN
abc-4026	217	49	-	-	NOUN
abc-4026	217	50	pretrol	pretrol	NOUN
abc-4026	217	51	)	)	PUNCT
abc-4026	217	52	and	and	CCONJ
abc-4026	217	53	anti	anti	ADJ
abc-4026	217	54	-	-	ADJ
abc-4026	217	55	ha	ha	INTJ
abc-4026	217	56	antibodies	antibody	NOUN
abc-4026	217	57	(	(	PUNCT
abc-4026	217	58	α	α	NOUN
abc-4026	217	59	-	-	PUNCT
abc-4026	217	60	ha	ha	INTJ
abc-4026	217	61	)	)	PUNCT
abc-4026	217	62	,	,	PUNCT
abc-4026	217	63	as	as	ADP
abc-4026	217	64	a	a	DET
abc-4026	217	65	control	control	NOUN
abc-4026	217	66	.	.	PUNCT
abc-4026	218	1	conjugated	conjugate	VERB
abc-4026	218	2	secondary	secondary	ADJ
abc-4026	218	3	antibodies	antibodie	VERB
abc-4026	218	4	anti	anti	ADJ
abc-4026	218	5	-	-	ADJ
abc-4026	218	6	rabbit	rabbit	ADJ
abc-4026	218	7	igg	igg	PROPN
abc-4026	218	8	peroxidase	peroxidase	NOUN
abc-4026	218	9	for	for	ADP
abc-4026	218	10	anti	anti	ADJ
abc-4026	218	11	-	-	NOUN
abc-4026	218	12	pretrol	pretrol	NOUN
abc-4026	218	13	,	,	PUNCT
abc-4026	218	14	and	and	CCONJ
abc-4026	218	15	anti	anti	ADJ
abc-4026	218	16	-	-	ADJ
abc-4026	218	17	rat	rat	ADJ
abc-4026	218	18	igg	igg	PROPN
abc-4026	218	19	peroxidase	peroxidase	NOUN
abc-4026	218	20	for	for	ADP
abc-4026	218	21	anti	anti	ADJ
abc-4026	218	22	-	-	ADJ
abc-4026	218	23	ha	ha	INTJ
abc-4026	218	24	have	have	AUX
abc-4026	218	25	been	be	AUX
abc-4026	218	26	used	use	VERB
abc-4026	218	27	.	.	PUNCT
abc-4026	219	1	results	result	NOUN
abc-4026	219	2	were	be	AUX
abc-4026	219	3	visualized	visualize	VERB
abc-4026	219	4	by	by	ADP
abc-4026	219	5	enhanced	enhanced	ADJ
abc-4026	219	6	chemiluminescence	chemiluminescence	NOUN
abc-4026	219	7	(	(	PUNCT
abc-4026	219	8	ecl	ecl	NOUN
abc-4026	219	9	)	)	PUNCT
abc-4026	219	10	and	and	CCONJ
abc-4026	219	11	exposure	exposure	NOUN
abc-4026	219	12	to	to	ADP
abc-4026	219	13	x	x	ADJ
abc-4026	219	14	-	-	NOUN
abc-4026	219	15	ray	ray	NOUN
abc-4026	219	16	films	film	NOUN
abc-4026	219	17	.	.	PUNCT
abc-4026	220	1	lane	lane	NOUN
abc-4026	220	2	9	9	NUM
abc-4026	220	3	represents	represent	VERB
abc-4026	220	4	the	the	DET
abc-4026	220	5	protein	protein	NOUN
abc-4026	220	6	marker	marker	NOUN
abc-4026	220	7	in	in	ADP
abc-4026	220	8	kda	kda	PROPN
abc-4026	220	9	.	.	PUNCT
abc-4026	221	1	arrows	arrow	NOUN
abc-4026	221	2	denote	denote	VERB
abc-4026	221	3	the	the	DET
abc-4026	221	4	positions	position	NOUN
abc-4026	221	5	of	of	ADP
abc-4026	221	6	trol	trol	PROPN
abc-4026	221	7	preprotein	preprotein	PROPN
abc-4026	221	8	(	(	PUNCT
abc-4026	221	9	ptrol	ptrol	NOUN
abc-4026	221	10	)	)	PUNCT
abc-4026	221	11	and	and	CCONJ
abc-4026	221	12	mature	mature	ADJ
abc-4026	221	13	trol	trol	NOUN
abc-4026	221	14	(	(	PUNCT
abc-4026	221	15	mtrol	mtrol	NOUN
abc-4026	221	16	)	)	PUNCT
abc-4026	221	17	.	.	PUNCT
abc-4026	222	1	non	non	ADJ
abc-4026	222	2	-	-	ADJ
abc-4026	222	3	purified	purified	ADJ
abc-4026	222	4	anti	anti	ADJ
abc-4026	222	5	-	-	ADJ
abc-4026	222	6	pretrol	pretrol	ADJ
abc-4026	222	7	antisera	antisera	NOUN
abc-4026	222	8	(	(	PUNCT
abc-4026	222	9	α	α	NOUN
abc-4026	222	10	-	-	PUNCT
abc-4026	222	11	pretrol1	pretrol1	NOUN
abc-4026	222	12	and	and	CCONJ
abc-4026	222	13	α	α	NOUN
abc-4026	222	14	-	-	ADJ
abc-4026	222	15	pretrol2	pretrol2	ADJ
abc-4026	222	16	,	,	PUNCT
abc-4026	222	17	lanes	lane	NOUN
abc-4026	222	18	3	3	NUM
abc-4026	222	19	,	,	PUNCT
abc-4026	222	20	4	4	NUM
abc-4026	222	21	,	,	PUNCT
abc-4026	222	22	10	10	NUM
abc-4026	222	23	,	,	PUNCT
abc-4026	222	24	11	11	NUM
abc-4026	222	25	)	)	PUNCT
abc-4026	222	26	seem	seem	VERB
abc-4026	222	27	to	to	PART
abc-4026	222	28	be	be	AUX
abc-4026	222	29	unspecific	unspecific	ADJ
abc-4026	222	30	.	.	PUNCT
abc-4026	223	1	affinity	affinity	NOUN
abc-4026	223	2	purified	purify	VERB
abc-4026	223	3	anti	anti	ADJ
abc-4026	223	4	-	-	ADJ
abc-4026	223	5	pretrol	pretrol	ADJ
abc-4026	223	6	antisera	antisera	NOUN
abc-4026	223	7	(	(	PUNCT
abc-4026	223	8	α	α	NOUN
abc-4026	223	9	-	-	ADJ
abc-4026	223	10	pretrol1ap	pretrol1ap	NOUN
abc-4026	223	11	and	and	CCONJ
abc-4026	223	12	α	α	X
abc-4026	223	13	-	-	NOUN
abc-4026	223	14	pretrol2ap	pretrol2ap	NOUN
abc-4026	223	15	,	,	PUNCT
abc-4026	223	16	lanes	lane	NOUN
abc-4026	223	17	5	5	NUM
abc-4026	223	18	,	,	PUNCT
abc-4026	223	19	6	6	NUM
abc-4026	223	20	,	,	PUNCT
abc-4026	223	21	12	12	NUM
abc-4026	223	22	,	,	PUNCT
abc-4026	223	23	13	13	NUM
abc-4026	223	24	)	)	PUNCT
abc-4026	223	25	seem	seem	VERB
abc-4026	223	26	to	to	PART
abc-4026	223	27	be	be	AUX
abc-4026	223	28	very	very	ADV
abc-4026	223	29	specific	specific	ADJ
abc-4026	223	30	,	,	PUNCT
abc-4026	223	31	showing	show	VERB
abc-4026	223	32	a	a	DET
abc-4026	223	33	single	single	ADJ
abc-4026	223	34	clear	clear	ADJ
abc-4026	223	35	band	band	NOUN
abc-4026	223	36	in	in	ADP
abc-4026	223	37	trol	trol	NOUN
abc-4026	223	38	-	-	PUNCT
abc-4026	223	39	ie	ie	X
abc-4026	223	40	plants	plant	NOUN
abc-4026	223	41	,	,	PUNCT
abc-4026	223	42	indicating	indicate	VERB
abc-4026	223	43	trol	trol	NOUN
abc-4026	223	44	precursor	precursor	NOUN
abc-4026	223	45	.	.	PUNCT
abc-4026	224	1	fig	fig	NOUN
abc-4026	224	2	.	.	PUNCT
abc-4026	225	1	4	4	X
abc-4026	225	2	.	.	X
abc-4026	225	3	detection	detection	NOUN
abc-4026	225	4	of	of	ADP
abc-4026	225	5	trol	trol	NOUN
abc-4026	225	6	in	in	ADP
abc-4026	225	7	ox	ox	NOUN
abc-4026	225	8	,	,	PUNCT
abc-4026	225	9	ie8	ie8	NOUN
abc-4026	225	10	,	,	PUNCT
abc-4026	225	11	and	and	CCONJ
abc-4026	225	12	ie18	ie18	PROPN
abc-4026	225	13	arabidopsis	arabidopsis	NOUN
abc-4026	225	14	lines	line	NOUN
abc-4026	225	15	by	by	ADP
abc-4026	225	16	using	use	VERB
abc-4026	225	17	anti	anti	ADJ
abc-4026	225	18	-	-	ADJ
abc-4026	225	19	pretrol	pretrol	ADJ
abc-4026	225	20	serum	serum	NOUN
abc-4026	225	21	.	.	PUNCT
abc-4026	226	1	intact	intact	ADJ
abc-4026	226	2	chloroplasts	chloroplast	NOUN
abc-4026	226	3	in	in	ADP
abc-4026	226	4	an	an	DET
abc-4026	226	5	amount	amount	NOUN
abc-4026	226	6	corresponding	correspond	VERB
abc-4026	226	7	to	to	ADP
abc-4026	226	8	40	40	NUM
abc-4026	226	9	µg	µg	NOUN
abc-4026	226	10	chlorophyll	chlorophyll	NOUN
abc-4026	226	11	for	for	ADP
abc-4026	226	12	anti	anti	ADJ
abc-4026	226	13	-	-	ADJ
abc-4026	226	14	pretrol	pretrol	ADJ
abc-4026	226	15	analyses	analysis	NOUN
abc-4026	226	16	(	(	PUNCT
abc-4026	226	17	lanes	lane	NOUN
abc-4026	226	18	1	1	NUM
abc-4026	226	19	-	-	SYM
abc-4026	226	20	3	3	NUM
abc-4026	226	21	)	)	PUNCT
abc-4026	226	22	and	and	CCONJ
abc-4026	226	23	10	10	NUM
abc-4026	226	24	µg	µg	ADV
abc-4026	226	25	chlorophyll	chlorophyll	NOUN
abc-4026	226	26	for	for	ADP
abc-4026	226	27	anti	anti	ADJ
abc-4026	226	28	-	-	ADJ
abc-4026	226	29	ha	ha	INTJ
abc-4026	226	30	analyses	analysis	NOUN
abc-4026	226	31	(	(	PUNCT
abc-4026	226	32	lanes	lane	NOUN
abc-4026	226	33	5	5	NUM
abc-4026	226	34	-	-	SYM
abc-4026	226	35	7	7	NUM
abc-4026	226	36	)	)	PUNCT
abc-4026	226	37	were	be	AUX
abc-4026	226	38	separated	separate	VERB
abc-4026	226	39	by	by	ADP
abc-4026	226	40	10	10	NUM
abc-4026	226	41	%	%	NOUN
abc-4026	226	42	sds	sds	NOUN
abc-4026	226	43	-	-	PUNCT
abc-4026	226	44	page	page	NOUN
abc-4026	226	45	,	,	PUNCT
abc-4026	226	46	transferred	transfer	VERB
abc-4026	226	47	to	to	ADP
abc-4026	226	48	a	a	DET
abc-4026	226	49	nitrocellulose	nitrocellulose	NOUN
abc-4026	226	50	membrane	membrane	NOUN
abc-4026	226	51	and	and	CCONJ
abc-4026	226	52	immunodecorated	immunodecorate	VERB
abc-4026	226	53	with	with	ADP
abc-4026	226	54	anti	anti	ADJ
abc-4026	226	55	-	-	NOUN
abc-4026	226	56	pretrol	pretrol	ADJ
abc-4026	226	57	(	(	PUNCT
abc-4026	226	58	α	α	NOUN
abc-4026	226	59	-	-	NOUN
abc-4026	226	60	pretrol2ap	pretrol2ap	NOUN
abc-4026	226	61	)	)	PUNCT
abc-4026	226	62	and	and	CCONJ
abc-4026	226	63	anti	anti	ADJ
abc-4026	226	64	-	-	ADJ
abc-4026	226	65	ha	ha	INTJ
abc-4026	226	66	antibodies	antibody	NOUN
abc-4026	226	67	(	(	PUNCT
abc-4026	226	68	α	α	NOUN
abc-4026	226	69	-	-	PUNCT
abc-4026	226	70	ha	ha	INTJ
abc-4026	226	71	)	)	PUNCT
abc-4026	226	72	,	,	PUNCT
abc-4026	226	73	as	as	ADP
abc-4026	226	74	a	a	DET
abc-4026	226	75	control	control	NOUN
abc-4026	226	76	.	.	PUNCT
abc-4026	227	1	conjugated	conjugate	VERB
abc-4026	227	2	secondary	secondary	ADJ
abc-4026	227	3	antibodies	antibodie	VERB
abc-4026	227	4	anti	anti	ADJ
abc-4026	227	5	-	-	ADJ
abc-4026	227	6	rabbit	rabbit	ADJ
abc-4026	227	7	igg	igg	PROPN
abc-4026	227	8	peroxidase	peroxidase	NOUN
abc-4026	227	9	for	for	ADP
abc-4026	227	10	anti	anti	ADJ
abc-4026	227	11	-	-	NOUN
abc-4026	227	12	pretrol	pretrol	NOUN
abc-4026	227	13	,	,	PUNCT
abc-4026	227	14	and	and	CCONJ
abc-4026	227	15	anti	anti	ADJ
abc-4026	227	16	-	-	ADJ
abc-4026	227	17	rat	rat	ADJ
abc-4026	227	18	igg	igg	PROPN
abc-4026	227	19	peroxidase	peroxidase	NOUN
abc-4026	227	20	for	for	ADP
abc-4026	227	21	anti	anti	ADJ
abc-4026	227	22	-	-	ADJ
abc-4026	227	23	ha	ha	INTJ
abc-4026	227	24	,	,	PUNCT
abc-4026	227	25	have	have	AUX
abc-4026	227	26	been	be	AUX
abc-4026	227	27	used	use	VERB
abc-4026	227	28	.	.	PUNCT
abc-4026	228	1	results	result	NOUN
abc-4026	228	2	were	be	AUX
abc-4026	228	3	visualized	visualize	VERB
abc-4026	228	4	by	by	ADP
abc-4026	228	5	enhanced	enhanced	ADJ
abc-4026	228	6	chemiluminescence	chemiluminescence	NOUN
abc-4026	228	7	(	(	PUNCT
abc-4026	228	8	ecl	ecl	NOUN
abc-4026	228	9	)	)	PUNCT
abc-4026	228	10	and	and	CCONJ
abc-4026	228	11	exposure	exposure	NOUN
abc-4026	228	12	to	to	ADP
abc-4026	228	13	x	x	ADJ
abc-4026	228	14	-	-	NOUN
abc-4026	228	15	ray	ray	NOUN
abc-4026	228	16	films	film	NOUN
abc-4026	228	17	.	.	PUNCT
abc-4026	229	1	lanes	lane	NOUN
abc-4026	229	2	4	4	NUM
abc-4026	229	3	and	and	CCONJ
abc-4026	229	4	8	8	NUM
abc-4026	229	5	represent	represent	VERB
abc-4026	229	6	a	a	DET
abc-4026	229	7	protein	protein	NOUN
abc-4026	229	8	marker	marker	NOUN
abc-4026	229	9	in	in	ADP
abc-4026	229	10	kda	kda	PROPN
abc-4026	229	11	.	.	PUNCT
abc-4026	230	1	arrows	arrow	NOUN
abc-4026	230	2	denote	denote	VERB
abc-4026	230	3	the	the	DET
abc-4026	230	4	positions	position	NOUN
abc-4026	230	5	of	of	ADP
abc-4026	230	6	trol	trol	PROPN
abc-4026	230	7	preprotein	preprotein	PROPN
abc-4026	230	8	(	(	PUNCT
abc-4026	230	9	ptrol	ptrol	NOUN
abc-4026	230	10	)	)	PUNCT
abc-4026	230	11	and	and	CCONJ
abc-4026	230	12	mature	mature	ADJ
abc-4026	230	13	trol	trol	NOUN
abc-4026	230	14	(	(	PUNCT
abc-4026	230	15	mtrol	mtrol	NOUN
abc-4026	230	16	)	)	PUNCT
abc-4026	230	17	.	.	PUNCT
abc-4026	231	1	anti	anti	ADJ
abc-4026	231	2	-	-	ADJ
abc-4026	231	3	pretrol2ap	pretrol2ap	ADJ
abc-4026	231	4	serum	serum	NOUN
abc-4026	231	5	seems	seem	VERB
abc-4026	231	6	to	to	PART
abc-4026	231	7	be	be	AUX
abc-4026	231	8	very	very	ADV
abc-4026	231	9	specific	specific	ADJ
abc-4026	231	10	,	,	PUNCT
abc-4026	231	11	showing	show	VERB
abc-4026	231	12	the	the	DET
abc-4026	231	13	single	single	ADJ
abc-4026	231	14	clear	clear	ADJ
abc-4026	231	15	band	band	NOUN
abc-4026	231	16	in	in	ADP
abc-4026	231	17	trol	trol	NOUN
abc-4026	231	18	-	-	PUNCT
abc-4026	231	19	ie	ie	X
abc-4026	231	20	plants	plant	NOUN
abc-4026	231	21	(	(	PUNCT
abc-4026	231	22	lanes	lane	NOUN
abc-4026	231	23	2	2	NUM
abc-4026	231	24	and	and	CCONJ
abc-4026	231	25	3	3	NUM
abc-4026	231	26	)	)	PUNCT
abc-4026	231	27	,	,	PUNCT
abc-4026	231	28	indicating	indicate	VERB
abc-4026	231	29	trol	trol	NOUN
abc-4026	231	30	precursor	precursor	NOUN
abc-4026	231	31	.	.	PUNCT
abc-4026	232	1	anti	anti	ADJ
abc-4026	232	2	-	-	ADJ
abc-4026	232	3	pretrol	pretrol	ADJ
abc-4026	232	4	serum	serum	NOUN
abc-4026	232	5	does	do	AUX
abc-4026	232	6	not	not	PART
abc-4026	232	7	show	show	VERB
abc-4026	232	8	visible	visible	ADJ
abc-4026	232	9	signal	signal	NOUN
abc-4026	232	10	on	on	ADP
abc-4026	232	11	ox	ox	ADJ
abc-4026	232	12	line	line	NOUN
abc-4026	232	13	because	because	SCONJ
abc-4026	232	14	there	there	PRON
abc-4026	232	15	is	be	VERB
abc-4026	232	16	too	too	ADV
abc-4026	232	17	little	little	ADJ
abc-4026	232	18	amount	amount	NOUN
abc-4026	232	19	(	(	PUNCT
abc-4026	232	20	undetectable	undetectable	NOUN
abc-4026	232	21	)	)	PUNCT
abc-4026	232	22	of	of	ADP
abc-4026	232	23	the	the	DET
abc-4026	232	24	trol	trol	NOUN
abc-4026	232	25	precursor	precursor	NOUN
abc-4026	232	26	in	in	ADP
abc-4026	232	27	this	this	DET
abc-4026	232	28	sample	sample	NOUN
abc-4026	232	29	.	.	PUNCT
abc-4026	233	1	dual	dual	ADJ
abc-4026	233	2	to	to	ADP
abc-4026	233	3	single	single	ADJ
abc-4026	233	4	localization	localization	NOUN
abc-4026	233	5	exchange	exchange	NOUN
abc-4026	233	6	of	of	ADP
abc-4026	233	7	trol	trol	NOUN
abc-4026	233	8	protein	protein	NOUN
abc-4026	233	9	acta	acta	PROPN
abc-4026	233	10	bot	bot	PROPN
abc-4026	233	11	.	.	PUNCT
abc-4026	234	1	croat	croat	PROPN
abc-4026	234	2	.	.	PUNCT
abc-4026	235	1	84	84	NUM
abc-4026	235	2	(	(	PUNCT
abc-4026	235	3	2	2	NUM
abc-4026	235	4	)	)	PUNCT
abc-4026	235	5	,	,	PUNCT
abc-4026	235	6	2025	2025	NUM
abc-4026	235	7	263	263	NUM
abc-4026	235	8	analysis	analysis	NOUN
abc-4026	235	9	of	of	ADP
abc-4026	235	10	trol	trol	NOUN
abc-4026	235	11	localization	localization	NOUN
abc-4026	235	12	in	in	ADP
abc-4026	235	13	trol	trol	NOUN
abc-4026	235	14	-	-	PUNCT
abc-4026	235	15	ie	ie	X
abc-4026	235	16	plants	plant	NOUN
abc-4026	235	17	by	by	ADP
abc-4026	235	18	newly	newly	ADV
abc-4026	235	19	produced	produce	VERB
abc-4026	235	20	anti	anti	ADJ
abc-4026	235	21	-	-	ADJ
abc-4026	235	22	pretrol	pretrol	ADJ
abc-4026	235	23	affinity	affinity	NOUN
abc-4026	235	24	purified	purify	VERB
abc-4026	235	25	sera	sera	NOUN
abc-4026	235	26	we	we	PRON
abc-4026	235	27	confirmed	confirm	VERB
abc-4026	235	28	that	that	SCONJ
abc-4026	235	29	the	the	DET
abc-4026	235	30	trol	trol	NOUN
abc-4026	235	31	in	in	ADP
abc-4026	235	32	trol	trol	NOUN
abc-4026	235	33	-	-	PUNCT
abc-4026	235	34	ie	ie	X
abc-4026	235	35	plants	plant	NOUN
abc-4026	235	36	was	be	AUX
abc-4026	235	37	found	find	VERB
abc-4026	235	38	only	only	ADV
abc-4026	235	39	in	in	ADP
abc-4026	235	40	precursor	precursor	NOUN
abc-4026	235	41	form	form	NOUN
abc-4026	235	42	in	in	ADP
abc-4026	235	43	the	the	DET
abc-4026	235	44	inner	inner	ADJ
abc-4026	235	45	envelope	envelope	NOUN
abc-4026	235	46	membrane	membrane	NOUN
abc-4026	235	47	(	(	PUNCT
abc-4026	235	48	fig	fig	NOUN
abc-4026	235	49	.	.	PUNCT
abc-4026	235	50	4	4	NUM
abc-4026	235	51	)	)	PUNCT
abc-4026	235	52	.	.	PUNCT
abc-4026	236	1	trol	trol	PROPN
abc-4026	236	2	ox	ox	ADJ
abc-4026	236	3	line	line	NOUN
abc-4026	236	4	was	be	AUX
abc-4026	236	5	a	a	DET
abc-4026	236	6	good	good	ADJ
abc-4026	236	7	control	control	NOUN
abc-4026	236	8	for	for	ADP
abc-4026	236	9	determination	determination	NOUN
abc-4026	236	10	of	of	ADP
abc-4026	236	11	the	the	DET
abc-4026	236	12	localization	localization	NOUN
abc-4026	236	13	of	of	ADP
abc-4026	236	14	trol	trol	NOUN
abc-4026	236	15	since	since	ADV
abc-4026	236	16	,	,	PUNCT
abc-4026	236	17	just	just	ADV
abc-4026	236	18	as	as	SCONJ
abc-4026	236	19	trol	trol	NOUN
abc-4026	236	20	-	-	PUNCT
abc-4026	236	21	ie8	ie8	NOUN
abc-4026	236	22	and	and	CCONJ
abc-4026	236	23	trol	trol	NOUN
abc-4026	236	24	-	-	PUNCT
abc-4026	236	25	ie18	ie18	PROPN
abc-4026	236	26	lines	line	NOUN
abc-4026	236	27	,	,	PUNCT
abc-4026	236	28	it	it	PRON
abc-4026	236	29	was	be	AUX
abc-4026	236	30	under	under	ADP
abc-4026	236	31	the	the	DET
abc-4026	236	32	control	control	NOUN
abc-4026	236	33	of	of	ADP
abc-4026	236	34	a	a	DET
abc-4026	236	35	strong	strong	ADJ
abc-4026	236	36	constitutive	constitutive	ADJ
abc-4026	236	37	promotor	promotor	NOUN
abc-4026	236	38	35s	35	NOUN
abc-4026	236	39	and	and	CCONJ
abc-4026	236	40	has	have	VERB
abc-4026	236	41	c	c	ADV
abc-4026	236	42	-	-	PUNCT
abc-4026	236	43	terminally	terminally	ADV
abc-4026	236	44	added	add	VERB
abc-4026	236	45	flag	flag	NOUN
abc-4026	236	46	and	and	CCONJ
abc-4026	236	47	ha	ha	INTJ
abc-4026	236	48	tags	tag	NOUN
abc-4026	236	49	for	for	ADP
abc-4026	236	50	easier	easy	ADJ
abc-4026	236	51	detection	detection	NOUN
abc-4026	236	52	and	and	CCONJ
abc-4026	236	53	purification	purification	NOUN
abc-4026	236	54	.	.	PUNCT
abc-4026	237	1	therefore	therefore	ADV
abc-4026	237	2	,	,	PUNCT
abc-4026	237	3	when	when	SCONJ
abc-4026	237	4	using	use	VERB
abc-4026	237	5	anti	anti	ADJ
abc-4026	237	6	-	-	ADJ
abc-4026	237	7	ha	ha	ADJ
abc-4026	237	8	antibody	antibody	NOUN
abc-4026	237	9	,	,	PUNCT
abc-4026	237	10	we	we	PRON
abc-4026	237	11	managed	manage	VERB
abc-4026	237	12	to	to	PART
abc-4026	237	13	detect	detect	VERB
abc-4026	237	14	trol	trol	NOUN
abc-4026	237	15	in	in	ADP
abc-4026	237	16	all	all	DET
abc-4026	237	17	three	three	NUM
abc-4026	237	18	lines	line	NOUN
abc-4026	237	19	(	(	PUNCT
abc-4026	237	20	ox	ox	NOUN
abc-4026	237	21	,	,	PUNCT
abc-4026	237	22	ie8	ie8	NOUN
abc-4026	237	23	,	,	PUNCT
abc-4026	237	24	and	and	CCONJ
abc-4026	237	25	ie18	ie18	PROPN
abc-4026	237	26	,	,	PUNCT
abc-4026	237	27	fig	fig	NOUN
abc-4026	237	28	.	.	PUNCT
abc-4026	238	1	4	4	NUM
abc-4026	238	2	,	,	PUNCT
abc-4026	238	3	lanes	lane	VERB
abc-4026	238	4	5	5	NUM
abc-4026	238	5	-	-	SYM
abc-4026	238	6	7	7	NUM
abc-4026	238	7	)	)	PUNCT
abc-4026	238	8	.	.	PUNCT
abc-4026	239	1	however	however	ADV
abc-4026	239	2	,	,	PUNCT
abc-4026	239	3	when	when	SCONJ
abc-4026	239	4	using	use	VERB
abc-4026	239	5	anti	anti	ADJ
abc-4026	239	6	-	-	ADJ
abc-4026	239	7	pretrol	pretrol	ADJ
abc-4026	239	8	serum	serum	NOUN
abc-4026	239	9	,	,	PUNCT
abc-4026	239	10	trol	trol	PROPN
abc-4026	239	11	was	be	AUX
abc-4026	239	12	detected	detect	VERB
abc-4026	239	13	only	only	ADV
abc-4026	239	14	in	in	ADP
abc-4026	239	15	the	the	DET
abc-4026	239	16	ie	ie	X
abc-4026	239	17	lines	line	NOUN
abc-4026	239	18	(	(	PUNCT
abc-4026	239	19	fig	fig	NOUN
abc-4026	239	20	.	.	PUNCT
abc-4026	240	1	4	4	NUM
abc-4026	240	2	,	,	PUNCT
abc-4026	240	3	lanes	lane	VERB
abc-4026	240	4	2	2	NUM
abc-4026	240	5	and	and	CCONJ
abc-4026	240	6	3	3	NUM
abc-4026	240	7	)	)	PUNCT
abc-4026	240	8	.	.	PUNCT
abc-4026	241	1	this	this	DET
abc-4026	241	2	observation	observation	NOUN
abc-4026	241	3	confirmed	confirm	VERB
abc-4026	241	4	that	that	SCONJ
abc-4026	241	5	the	the	DET
abc-4026	241	6	accumulation	accumulation	NOUN
abc-4026	241	7	of	of	ADP
abc-4026	241	8	the	the	DET
abc-4026	241	9	precursor	precursor	NOUN
abc-4026	241	10	due	due	ADP
abc-4026	241	11	to	to	ADP
abc-4026	241	12	mutagenesis	mutagenesis	NOUN
abc-4026	241	13	occurred	occur	VERB
abc-4026	241	14	in	in	ADP
abc-4026	241	15	the	the	DET
abc-4026	241	16	inner	inner	ADJ
abc-4026	241	17	envelope	envelope	NOUN
abc-4026	241	18	membrane	membrane	NOUN
abc-4026	241	19	.	.	PUNCT
abc-4026	242	1	ox	ox	ADJ
abc-4026	242	2	line	line	NOUN
abc-4026	242	3	lacks	lack	VERB
abc-4026	242	4	the	the	DET
abc-4026	242	5	signal	signal	NOUN
abc-4026	242	6	because	because	SCONJ
abc-4026	242	7	the	the	DET
abc-4026	242	8	majority	majority	NOUN
abc-4026	242	9	of	of	ADP
abc-4026	242	10	the	the	DET
abc-4026	242	11	trol	trol	NOUN
abc-4026	242	12	in	in	ADP
abc-4026	242	13	this	this	DET
abc-4026	242	14	line	line	NOUN
abc-4026	242	15	is	be	AUX
abc-4026	242	16	in	in	ADP
abc-4026	242	17	the	the	DET
abc-4026	242	18	thylakoids	thylakoid	NOUN
abc-4026	242	19	,	,	PUNCT
abc-4026	242	20	as	as	ADP
abc-4026	242	21	a	a	DET
abc-4026	242	22	mature	mature	ADJ
abc-4026	242	23	form	form	NOUN
abc-4026	242	24	of	of	ADP
abc-4026	242	25	the	the	DET
abc-4026	242	26	protein	protein	NOUN
abc-4026	242	27	,	,	PUNCT
abc-4026	242	28	which	which	PRON
abc-4026	242	29	can	can	AUX
abc-4026	242	30	not	not	PART
abc-4026	242	31	be	be	AUX
abc-4026	242	32	recognized	recognize	VERB
abc-4026	242	33	using	use	VERB
abc-4026	242	34	antibodies	antibody	NOUN
abc-4026	242	35	against	against	ADP
abc-4026	242	36	the	the	DET
abc-4026	242	37	presequence	presequence	NOUN
abc-4026	242	38	.	.	PUNCT
abc-4026	243	1	discussion	discussion	NOUN
abc-4026	243	2	the	the	DET
abc-4026	243	3	role	role	NOUN
abc-4026	243	4	of	of	ADP
abc-4026	243	5	the	the	DET
abc-4026	243	6	trol	trol	NOUN
abc-4026	243	7	in	in	ADP
abc-4026	243	8	the	the	DET
abc-4026	243	9	thylakoid	thylakoid	ADJ
abc-4026	243	10	membranes	membrane	NOUN
abc-4026	243	11	has	have	AUX
abc-4026	243	12	been	be	AUX
abc-4026	243	13	investigated	investigate	VERB
abc-4026	243	14	for	for	ADP
abc-4026	243	15	more	more	ADJ
abc-4026	243	16	than	than	ADP
abc-4026	243	17	15	15	NUM
abc-4026	243	18	years	year	NOUN
abc-4026	243	19	,	,	PUNCT
abc-4026	243	20	since	since	SCONJ
abc-4026	243	21	the	the	DET
abc-4026	243	22	protein	protein	NOUN
abc-4026	243	23	was	be	AUX
abc-4026	243	24	characterized	characterize	VERB
abc-4026	243	25	in	in	ADP
abc-4026	243	26	2009	2009	NUM
abc-4026	243	27	(	(	PUNCT
abc-4026	243	28	jurić	jurić	VERB
abc-4026	243	29	et	et	PROPN
abc-4026	243	30	al	al	PROPN
abc-4026	243	31	.	.	PROPN
abc-4026	243	32	2009	2009	NUM
abc-4026	243	33	)	)	PUNCT
abc-4026	243	34	.	.	PUNCT
abc-4026	244	1	trol	trol	PROPN
abc-4026	244	2	has	have	AUX
abc-4026	244	3	been	be	AUX
abc-4026	244	4	shown	show	VERB
abc-4026	244	5	to	to	PART
abc-4026	244	6	be	be	AUX
abc-4026	244	7	involved	involve	VERB
abc-4026	244	8	in	in	ADP
abc-4026	244	9	photosynthetic	photosynthetic	ADJ
abc-4026	244	10	electron	electron	NOUN
abc-4026	244	11	distribution	distribution	NOUN
abc-4026	244	12	by	by	ADP
abc-4026	244	13	docking	dock	VERB
abc-4026	244	14	the	the	DET
abc-4026	244	15	fnr	fnr	NOUN
abc-4026	244	16	to	to	ADP
abc-4026	244	17	the	the	DET
abc-4026	244	18	thylakoid	thylakoid	ADJ
abc-4026	244	19	membranes	membrane	NOUN
abc-4026	244	20	and	and	CCONJ
abc-4026	244	21	therefore	therefore	ADV
abc-4026	244	22	bringing	bring	VERB
abc-4026	244	23	it	it	PRON
abc-4026	244	24	to	to	ADP
abc-4026	244	25	the	the	DET
abc-4026	244	26	vicinity	vicinity	NOUN
abc-4026	244	27	of	of	ADP
abc-4026	244	28	psi	psi	NOUN
abc-4026	244	29	,	,	PUNCT
abc-4026	244	30	namely	namely	ADV
abc-4026	244	31	ferredoxin	ferredoxin	ADJ
abc-4026	244	32	(	(	PUNCT
abc-4026	244	33	fd	fd	PROPN
abc-4026	244	34	)	)	PUNCT
abc-4026	244	35	(	(	PUNCT
abc-4026	244	36	jurić	jurić	VERB
abc-4026	244	37	et	et	PROPN
abc-4026	244	38	al	al	PROPN
abc-4026	244	39	.	.	PROPN
abc-4026	244	40	2009	2009	NUM
abc-4026	244	41	,	,	PUNCT
abc-4026	244	42	kekić	kekić	PROPN
abc-4026	244	43	et	et	PROPN
abc-4026	244	44	al	al	PROPN
abc-4026	244	45	.	.	PROPN
abc-4026	244	46	2020	2020	NUM
abc-4026	244	47	)	)	PUNCT
abc-4026	244	48	.	.	PUNCT
abc-4026	245	1	fd	fd	PROPN
abc-4026	245	2	distributes	distribute	VERB
abc-4026	245	3	high	high	ADJ
abc-4026	245	4	-	-	PUNCT
abc-4026	245	5	energy	energy	NOUN
abc-4026	245	6	electrons	electron	NOUN
abc-4026	245	7	to	to	ADP
abc-4026	245	8	a	a	DET
abc-4026	245	9	multitude	multitude	NOUN
abc-4026	245	10	of	of	ADP
abc-4026	245	11	enzymes	enzyme	NOUN
abc-4026	245	12	involved	involve	VERB
abc-4026	245	13	in	in	ADP
abc-4026	245	14	chloroplast	chloroplast	ADJ
abc-4026	245	15	metabolism	metabolism	NOUN
abc-4026	245	16	.	.	PUNCT
abc-4026	246	1	by	by	ADP
abc-4026	246	2	the	the	DET
abc-4026	246	3	interaction	interaction	NOUN
abc-4026	246	4	of	of	ADP
abc-4026	246	5	trol	trol	NOUN
abc-4026	246	6	and	and	CCONJ
abc-4026	246	7	fnr	fnr	NOUN
abc-4026	246	8	,	,	PUNCT
abc-4026	246	9	electrons	electron	NOUN
abc-4026	246	10	are	be	AUX
abc-4026	246	11	preferentially	preferentially	ADV
abc-4026	246	12	directed	direct	VERB
abc-4026	246	13	to	to	ADP
abc-4026	246	14	carbon	carbon	NOUN
abc-4026	246	15	assimilation	assimilation	NOUN
abc-4026	246	16	,	,	PUNCT
abc-4026	246	17	which	which	PRON
abc-4026	246	18	requires	require	VERB
abc-4026	246	19	nadph	nadph	ADJ
abc-4026	246	20	,	,	PUNCT
abc-4026	246	21	and	and	CCONJ
abc-4026	246	22	so	so	ADV
abc-4026	246	23	the	the	DET
abc-4026	246	24	majority	majority	NOUN
abc-4026	246	25	of	of	ADP
abc-4026	246	26	fd	fd	PROPN
abc-4026	246	27	is	be	AUX
abc-4026	246	28	immediately	immediately	ADV
abc-4026	246	29	oxidized	oxidize	VERB
abc-4026	246	30	by	by	ADP
abc-4026	246	31	the	the	DET
abc-4026	246	32	enzyme	enzyme	NOUN
abc-4026	246	33	ferredoxin	ferredoxin	ADJ
abc-4026	246	34	:	:	PUNCT
abc-4026	246	35	nadp+	nadp+	X
abc-4026	246	36	oxidoreductase	oxidoreductase	PROPN
abc-4026	246	37	(	(	PUNCT
abc-4026	246	38	fnr	fnr	PROPN
abc-4026	246	39	)	)	PUNCT
abc-4026	246	40	,	,	PUNCT
abc-4026	246	41	which	which	PRON
abc-4026	246	42	associates	associate	VERB
abc-4026	246	43	with	with	ADP
abc-4026	246	44	the	the	DET
abc-4026	246	45	thylakoid	thylakoid	ADJ
abc-4026	246	46	membrane	membrane	NOUN
abc-4026	246	47	(	(	PUNCT
abc-4026	246	48	jurić	jurić	VERB
abc-4026	246	49	et	et	PROPN
abc-4026	246	50	al	al	PROPN
abc-4026	246	51	.	.	PROPN
abc-4026	246	52	2013	2013	NUM
abc-4026	246	53	)	)	PUNCT
abc-4026	246	54	.	.	PUNCT
abc-4026	247	1	apart	apart	ADV
abc-4026	247	2	from	from	ADP
abc-4026	247	3	thylakoids	thylakoid	NOUN
abc-4026	247	4	,	,	PUNCT
abc-4026	247	5	trol	trol	NOUN
abc-4026	247	6	resides	reside	VERB
abc-4026	247	7	in	in	ADP
abc-4026	247	8	the	the	DET
abc-4026	247	9	inner	inner	ADJ
abc-4026	247	10	envelope	envelope	NOUN
abc-4026	247	11	membrane	membrane	NOUN
abc-4026	247	12	(	(	PUNCT
abc-4026	247	13	ie	ie	X
abc-4026	247	14	)	)	PUNCT
abc-4026	247	15	and	and	CCONJ
abc-4026	247	16	its	its	PRON
abc-4026	247	17	role	role	NOUN
abc-4026	247	18	in	in	ADP
abc-4026	247	19	this	this	DET
abc-4026	247	20	compartment	compartment	NOUN
abc-4026	247	21	has	have	AUX
abc-4026	247	22	remained	remain	VERB
abc-4026	247	23	unexplored	unexplored	ADJ
abc-4026	247	24	to	to	ADP
abc-4026	247	25	date	date	NOUN
abc-4026	247	26	.	.	PUNCT
abc-4026	248	1	this	this	PRON
abc-4026	248	2	is	be	AUX
abc-4026	248	3	because	because	SCONJ
abc-4026	248	4	the	the	DET
abc-4026	248	5	smaller	small	ADJ
abc-4026	248	6	portion	portion	NOUN
abc-4026	248	7	of	of	ADP
abc-4026	248	8	trol	trol	NOUN
abc-4026	248	9	precursor	precursor	NOUN
abc-4026	248	10	in	in	ADP
abc-4026	248	11	the	the	DET
abc-4026	248	12	ie	ie	X
abc-4026	248	13	is	be	AUX
abc-4026	248	14	being	be	AUX
abc-4026	248	15	masked	mask	VERB
abc-4026	248	16	by	by	ADP
abc-4026	248	17	the	the	DET
abc-4026	248	18	majority	majority	NOUN
abc-4026	248	19	of	of	ADP
abc-4026	248	20	the	the	DET
abc-4026	248	21	mature	mature	ADJ
abc-4026	248	22	form	form	NOUN
abc-4026	248	23	of	of	ADP
abc-4026	248	24	trol	trol	NOUN
abc-4026	248	25	located	locate	VERB
abc-4026	248	26	in	in	ADP
abc-4026	248	27	the	the	DET
abc-4026	248	28	thylakoids	thylakoid	NOUN
abc-4026	248	29	.	.	PUNCT
abc-4026	249	1	dual	dual	ADJ
abc-4026	249	2	localization	localization	NOUN
abc-4026	249	3	has	have	AUX
abc-4026	249	4	been	be	AUX
abc-4026	249	5	shown	show	VERB
abc-4026	249	6	for	for	ADP
abc-4026	249	7	other	other	ADJ
abc-4026	249	8	chloroplast	chloroplast	ADJ
abc-4026	249	9	proteins	protein	NOUN
abc-4026	249	10	of	of	ADP
abc-4026	249	11	various	various	ADJ
abc-4026	249	12	functions	function	NOUN
abc-4026	249	13	(	(	PUNCT
abc-4026	249	14	klasek	klasek	PROPN
abc-4026	249	15	and	and	CCONJ
abc-4026	249	16	inoue	inoue	PROPN
abc-4026	249	17	2016	2016	NUM
abc-4026	249	18	)	)	PUNCT
abc-4026	249	19	.	.	PUNCT
abc-4026	250	1	in	in	ADP
abc-4026	250	2	some	some	DET
abc-4026	250	3	cases	case	NOUN
abc-4026	250	4	,	,	PUNCT
abc-4026	250	5	protein	protein	NOUN
abc-4026	250	6	is	be	AUX
abc-4026	250	7	dually	dually	ADV
abc-4026	250	8	localized	localize	VERB
abc-4026	250	9	because	because	SCONJ
abc-4026	250	10	its	its	PRON
abc-4026	250	11	activity	activity	NOUN
abc-4026	250	12	is	be	AUX
abc-4026	250	13	needed	need	VERB
abc-4026	250	14	in	in	ADP
abc-4026	250	15	more	more	ADJ
abc-4026	250	16	than	than	ADP
abc-4026	250	17	one	one	NUM
abc-4026	250	18	location	location	NOUN
abc-4026	250	19	.	.	PUNCT
abc-4026	251	1	cells	cell	NOUN
abc-4026	251	2	usually	usually	ADV
abc-4026	251	3	either	either	CCONJ
abc-4026	251	4	use	use	VERB
abc-4026	251	5	multiple	multiple	ADJ
abc-4026	251	6	gene	gene	NOUN
abc-4026	251	7	products	product	NOUN
abc-4026	251	8	(	(	PUNCT
abc-4026	251	9	differently	differently	ADV
abc-4026	251	10	located	locate	VERB
abc-4026	251	11	isoforms	isoform	NOUN
abc-4026	251	12	)	)	PUNCT
abc-4026	251	13	or	or	CCONJ
abc-4026	251	14	target	target	VERB
abc-4026	251	15	a	a	DET
abc-4026	251	16	single	single	ADJ
abc-4026	251	17	gene	gene	NOUN
abc-4026	251	18	product	product	NOUN
abc-4026	251	19	to	to	ADP
abc-4026	251	20	multiple	multiple	ADJ
abc-4026	251	21	locations	location	NOUN
abc-4026	251	22	by	by	ADP
abc-4026	251	23	various	various	ADJ
abc-4026	251	24	mechanisms	mechanism	NOUN
abc-4026	251	25	(	(	PUNCT
abc-4026	251	26	klasek	klasek	PROPN
abc-4026	251	27	and	and	CCONJ
abc-4026	251	28	inoue	inoue	PROPN
abc-4026	251	29	2016	2016	NUM
abc-4026	251	30	)	)	PUNCT
abc-4026	251	31	.	.	PUNCT
abc-4026	252	1	at	at	ADP
abc-4026	252	2	this	this	DET
abc-4026	252	3	stage	stage	NOUN
abc-4026	252	4	we	we	PRON
abc-4026	252	5	can	can	AUX
abc-4026	252	6	only	only	ADV
abc-4026	252	7	speculate	speculate	VERB
abc-4026	252	8	on	on	ADP
abc-4026	252	9	the	the	DET
abc-4026	252	10	role	role	NOUN
abc-4026	252	11	of	of	ADP
abc-4026	252	12	trol	trol	NOUN
abc-4026	252	13	in	in	ADP
abc-4026	252	14	the	the	DET
abc-4026	252	15	ie	ie	ADJ
abc-4026	252	16	membrane	membrane	NOUN
abc-4026	252	17	.	.	PUNCT
abc-4026	253	1	it	it	PRON
abc-4026	253	2	might	might	AUX
abc-4026	253	3	represent	represent	VERB
abc-4026	253	4	a	a	DET
abc-4026	253	5	“	"	PUNCT
abc-4026	253	6	storage	storage	NOUN
abc-4026	253	7	”	"	PUNCT
abc-4026	253	8	from	from	ADP
abc-4026	253	9	which	which	PRON
abc-4026	253	10	trol	trol	NOUN
abc-4026	253	11	is	be	AUX
abc-4026	253	12	mobilized	mobilize	VERB
abc-4026	253	13	to	to	ADP
abc-4026	253	14	thylakoids	thylakoid	NOUN
abc-4026	253	15	when	when	SCONJ
abc-4026	253	16	needed	need	VERB
abc-4026	253	17	.	.	PUNCT
abc-4026	254	1	there	there	PRON
abc-4026	254	2	is	be	VERB
abc-4026	254	3	also	also	ADV
abc-4026	254	4	a	a	DET
abc-4026	254	5	possibility	possibility	NOUN
abc-4026	254	6	that	that	SCONJ
abc-4026	254	7	trol	trol	NOUN
abc-4026	254	8	in	in	ADP
abc-4026	254	9	the	the	DET
abc-4026	254	10	ie	ie	X
abc-4026	254	11	membrane	membrane	NOUN
abc-4026	254	12	is	be	AUX
abc-4026	254	13	someway	someway	ADV
abc-4026	254	14	involved	involve	VERB
abc-4026	254	15	in	in	ADP
abc-4026	254	16	the	the	DET
abc-4026	254	17	electron	electron	NOUN
abc-4026	254	18	transfer	transfer	NOUN
abc-4026	254	19	at	at	ADP
abc-4026	254	20	this	this	DET
abc-4026	254	21	membrane	membrane	NOUN
abc-4026	254	22	.	.	PUNCT
abc-4026	255	1	mass	mass	NOUN
abc-4026	255	2	spectroscopy	spectroscopy	NOUN
abc-4026	255	3	analyses	analysis	NOUN
abc-4026	255	4	(	(	PUNCT
abc-4026	255	5	vojta	vojta	NOUN
abc-4026	255	6	et	et	PROPN
abc-4026	255	7	al	al	PROPN
abc-4026	255	8	.	.	PROPN
abc-4026	255	9	2023	2023	NUM
abc-4026	255	10	)	)	PUNCT
abc-4026	255	11	indicated	indicate	VERB
abc-4026	255	12	its	its	PRON
abc-4026	255	13	possible	possible	ADJ
abc-4026	255	14	interaction	interaction	NOUN
abc-4026	255	15	with	with	ADP
abc-4026	255	16	tic62	tic62	PROPN
abc-4026	255	17	and	and	CCONJ
abc-4026	255	18	tic20	tic20	NOUN
abc-4026	255	19	,	,	PUNCT
abc-4026	255	20	proteins	protein	NOUN
abc-4026	255	21	that	that	PRON
abc-4026	255	22	build	build	VERB
abc-4026	255	23	a	a	DET
abc-4026	255	24	translocon	translocon	NOUN
abc-4026	255	25	at	at	ADP
abc-4026	255	26	the	the	DET
abc-4026	255	27	chloroplastic	chloroplastic	ADJ
abc-4026	255	28	inner	inner	ADJ
abc-4026	255	29	envelope	envelope	NOUN
abc-4026	255	30	membrane	membrane	NOUN
abc-4026	255	31	.	.	PUNCT
abc-4026	256	1	this	this	PRON
abc-4026	256	2	might	might	AUX
abc-4026	256	3	indicate	indicate	VERB
abc-4026	256	4	involvement	involvement	NOUN
abc-4026	256	5	of	of	ADP
abc-4026	256	6	trol	trol	NOUN
abc-4026	256	7	in	in	ADP
abc-4026	256	8	a	a	DET
abc-4026	256	9	protein	protein	NOUN
abc-4026	256	10	translocation	translocation	NOUN
abc-4026	256	11	process	process	NOUN
abc-4026	256	12	across	across	ADP
abc-4026	256	13	the	the	DET
abc-4026	256	14	chloroplast	chloroplast	NOUN
abc-4026	256	15	envelope	envelope	NOUN
abc-4026	256	16	,	,	PUNCT
abc-4026	256	17	probably	probably	ADV
abc-4026	256	18	as	as	ADP
abc-4026	256	19	a	a	DET
abc-4026	256	20	possible	possible	ADJ
abc-4026	256	21	additional	additional	ADJ
abc-4026	256	22	redox	redox	ADJ
abc-4026	256	23	regulator	regulator	NOUN
abc-4026	256	24	through	through	ADP
abc-4026	256	25	interaction	interaction	NOUN
abc-4026	256	26	with	with	ADP
abc-4026	256	27	fnr	fnr	PROPN
abc-4026	256	28	.	.	PUNCT
abc-4026	257	1	there	there	PRON
abc-4026	257	2	is	be	VERB
abc-4026	257	3	also	also	ADV
abc-4026	257	4	a	a	DET
abc-4026	257	5	possibility	possibility	NOUN
abc-4026	257	6	that	that	SCONJ
abc-4026	257	7	ie	ie	ADJ
abc-4026	257	8	membrane	membrane	NOUN
abc-4026	257	9	trol	trol	NOUN
abc-4026	257	10	is	be	AUX
abc-4026	257	11	involved	involve	VERB
abc-4026	257	12	in	in	ADP
abc-4026	257	13	metabolic	metabolic	NOUN
abc-4026	257	14	regulation	regulation	NOUN
abc-4026	257	15	by	by	ADP
abc-4026	257	16	docking	dock	VERB
abc-4026	257	17	fnr	fnr	PROPN
abc-4026	257	18	and	and	CCONJ
abc-4026	257	19	regulating	regulate	VERB
abc-4026	257	20	nadph	nadph	ADJ
abc-4026	257	21	production	production	NOUN
abc-4026	257	22	in	in	ADP
abc-4026	257	23	this	this	DET
abc-4026	257	24	compartment	compartment	NOUN
abc-4026	257	25	.	.	PUNCT
abc-4026	258	1	to	to	PART
abc-4026	258	2	test	test	VERB
abc-4026	258	3	these	these	DET
abc-4026	258	4	hypotheses	hypothesis	NOUN
abc-4026	258	5	and	and	CCONJ
abc-4026	258	6	to	to	PART
abc-4026	258	7	investigate	investigate	VERB
abc-4026	258	8	its	its	PRON
abc-4026	258	9	role	role	NOUN
abc-4026	258	10	in	in	ADP
abc-4026	258	11	the	the	DET
abc-4026	258	12	inner	inner	ADJ
abc-4026	258	13	envelope	envelope	NOUN
abc-4026	258	14	membrane	membrane	NOUN
abc-4026	258	15	of	of	ADP
abc-4026	258	16	chloroplasts	chloroplast	NOUN
abc-4026	258	17	in	in	ADP
abc-4026	258	18	vivo	vivo	NOUN
abc-4026	258	19	,	,	PUNCT
abc-4026	258	20	we	we	PRON
abc-4026	258	21	had	have	VERB
abc-4026	258	22	to	to	PART
abc-4026	258	23	“	"	PUNCT
abc-4026	258	24	remove	remove	VERB
abc-4026	258	25	”	"	PUNCT
abc-4026	258	26	trol	trol	NOUN
abc-4026	258	27	from	from	ADP
abc-4026	258	28	the	the	DET
abc-4026	258	29	thylakoids	thylakoid	NOUN
abc-4026	258	30	.	.	PUNCT
abc-4026	259	1	in	in	ADP
abc-4026	259	2	our	our	PRON
abc-4026	259	3	previous	previous	ADJ
abc-4026	259	4	research	research	NOUN
abc-4026	259	5	,	,	PUNCT
abc-4026	259	6	by	by	ADP
abc-4026	259	7	western	western	ADJ
abc-4026	259	8	blotting	blotting	NOUN
abc-4026	259	9	of	of	ADP
abc-4026	259	10	isolated	isolated	ADJ
abc-4026	259	11	outer	outer	ADJ
abc-4026	259	12	and	and	CCONJ
abc-4026	259	13	inner	inner	ADJ
abc-4026	259	14	chloroplast	chloroplast	NOUN
abc-4026	259	15	envelope	envelope	NOUN
abc-4026	259	16	membranes	membrane	NOUN
abc-4026	259	17	,	,	PUNCT
abc-4026	259	18	thylakoids	thylakoid	NOUN
abc-4026	259	19	,	,	PUNCT
abc-4026	259	20	and	and	CCONJ
abc-4026	259	21	stroma	stroma	NOUN
abc-4026	259	22	,	,	PUNCT
abc-4026	259	23	we	we	PRON
abc-4026	259	24	confirmed	confirm	VERB
abc-4026	259	25	that	that	SCONJ
abc-4026	259	26	trol	trol	PROPN
abc-4026	259	27	preprotein	preprotein	PROPN
abc-4026	259	28	is	be	AUX
abc-4026	259	29	associated	associate	VERB
abc-4026	259	30	almost	almost	ADV
abc-4026	259	31	exclusively	exclusively	ADV
abc-4026	259	32	with	with	ADP
abc-4026	259	33	the	the	DET
abc-4026	259	34	inner	inner	ADJ
abc-4026	259	35	envelope	envelope	NOUN
abc-4026	259	36	membrane	membrane	NOUN
abc-4026	259	37	and	and	CCONJ
abc-4026	259	38	that	that	SCONJ
abc-4026	259	39	the	the	DET
abc-4026	259	40	mature	mature	ADJ
abc-4026	259	41	part	part	NOUN
abc-4026	259	42	is	be	AUX
abc-4026	259	43	located	locate	VERB
abc-4026	259	44	in	in	ADP
abc-4026	259	45	the	the	DET
abc-4026	259	46	thylakoids	thylakoid	NOUN
abc-4026	259	47	(	(	PUNCT
abc-4026	259	48	jurić	jurić	VERB
abc-4026	259	49	et	et	PROPN
abc-4026	259	50	al	al	PROPN
abc-4026	259	51	.	.	PROPN
abc-4026	259	52	2009	2009	NUM
abc-4026	259	53	)	)	PUNCT
abc-4026	259	54	.	.	PUNCT
abc-4026	260	1	we	we	PRON
abc-4026	260	2	managed	manage	VERB
abc-4026	260	3	to	to	PART
abc-4026	260	4	find	find	VERB
abc-4026	260	5	the	the	DET
abc-4026	260	6	determinants	determinant	NOUN
abc-4026	260	7	for	for	ADP
abc-4026	260	8	the	the	DET
abc-4026	260	9	dual	dual	ADJ
abc-4026	260	10	localization	localization	NOUN
abc-4026	260	11	of	of	ADP
abc-4026	260	12	trol	trol	NOUN
abc-4026	260	13	around	around	ADP
abc-4026	260	14	its	its	PRON
abc-4026	260	15	presequence	presequence	NOUN
abc-4026	260	16	protease	protease	NOUN
abc-4026	260	17	processing	processing	NOUN
abc-4026	260	18	site	site	NOUN
abc-4026	260	19	(	(	PUNCT
abc-4026	260	20	vojta	vojta	NOUN
abc-4026	260	21	et	et	PROPN
abc-4026	260	22	al	al	PROPN
abc-4026	260	23	.	.	PROPN
abc-4026	260	24	2018	2018	NUM
abc-4026	260	25	)	)	PUNCT
abc-4026	260	26	.	.	PUNCT
abc-4026	261	1	we	we	PRON
abc-4026	261	2	mutated	mutate	VERB
abc-4026	261	3	ala	ala	PROPN
abc-4026	261	4	to	to	ADP
abc-4026	261	5	ile	ile	PROPN
abc-4026	261	6	at	at	ADP
abc-4026	261	7	the	the	DET
abc-4026	261	8	position	position	NOUN
abc-4026	261	9	67	67	NUM
abc-4026	261	10	in	in	ADP
abc-4026	261	11	trol	trol	NOUN
abc-4026	261	12	precursor	precursor	NOUN
abc-4026	261	13	and	and	CCONJ
abc-4026	261	14	by	by	ADP
abc-4026	261	15	performing	perform	VERB
abc-4026	261	16	in	in	ADP
abc-4026	261	17	vitro	vitro	X
abc-4026	261	18	protein	protein	NOUN
abc-4026	261	19	import	import	NOUN
abc-4026	261	20	experiments	experiment	NOUN
abc-4026	261	21	we	we	PRON
abc-4026	261	22	proved	prove	VERB
abc-4026	261	23	that	that	SCONJ
abc-4026	261	24	the	the	DET
abc-4026	261	25	majority	majority	NOUN
abc-4026	261	26	of	of	ADP
abc-4026	261	27	such	such	ADJ
abc-4026	261	28	preprotein	preprotein	NOUN
abc-4026	261	29	was	be	AUX
abc-4026	261	30	not	not	PART
abc-4026	261	31	processed	process	VERB
abc-4026	261	32	and	and	CCONJ
abc-4026	261	33	transferred	transfer	VERB
abc-4026	261	34	to	to	ADP
abc-4026	261	35	its	its	PRON
abc-4026	261	36	destination	destination	NOUN
abc-4026	261	37	in	in	ADP
abc-4026	261	38	the	the	DET
abc-4026	261	39	thylakoid	thylakoid	ADJ
abc-4026	261	40	membrane	membrane	NOUN
abc-4026	261	41	(	(	PUNCT
abc-4026	261	42	vojta	vojta	NOUN
abc-4026	261	43	et	et	PROPN
abc-4026	261	44	al	al	PROPN
abc-4026	261	45	.	.	PROPN
abc-4026	261	46	2018	2018	NUM
abc-4026	261	47	)	)	PUNCT
abc-4026	261	48	.	.	PUNCT
abc-4026	262	1	these	these	DET
abc-4026	262	2	results	result	NOUN
abc-4026	262	3	provided	provide	VERB
abc-4026	262	4	us	we	PRON
abc-4026	262	5	with	with	ADP
abc-4026	262	6	the	the	DET
abc-4026	262	7	tool	tool	NOUN
abc-4026	262	8	to	to	PART
abc-4026	262	9	“	"	PUNCT
abc-4026	262	10	remove	remove	VERB
abc-4026	262	11	”	"	PUNCT
abc-4026	262	12	trol	trol	NOUN
abc-4026	262	13	from	from	ADP
abc-4026	262	14	the	the	DET
abc-4026	262	15	thylakoids	thylakoid	NOUN
abc-4026	262	16	for	for	ADP
abc-4026	262	17	the	the	DET
abc-4026	262	18	purpose	purpose	NOUN
abc-4026	262	19	of	of	ADP
abc-4026	262	20	studying	study	VERB
abc-4026	262	21	its	its	PRON
abc-4026	262	22	function	function	NOUN
abc-4026	262	23	in	in	ADP
abc-4026	262	24	the	the	DET
abc-4026	262	25	inner	inner	ADJ
abc-4026	262	26	envelope	envelope	NOUN
abc-4026	262	27	membrane	membrane	NOUN
abc-4026	262	28	.	.	PUNCT
abc-4026	263	1	by	by	ADP
abc-4026	263	2	applying	apply	VERB
abc-4026	263	3	the	the	DET
abc-4026	263	4	“	"	PUNCT
abc-4026	263	5	floral	floral	ADJ
abc-4026	263	6	dip	dip	NOUN
abc-4026	263	7	”	"	PUNCT
abc-4026	263	8	method	method	NOUN
abc-4026	263	9	of	of	ADP
abc-4026	263	10	agrobacterial	agrobacterial	ADJ
abc-4026	263	11	transformation	transformation	NOUN
abc-4026	263	12	of	of	ADP
abc-4026	263	13	arabidopsis	arabidopsis	NOUN
abc-4026	263	14	plants	plant	NOUN
abc-4026	263	15	with	with	ADP
abc-4026	263	16	the	the	DET
abc-4026	263	17	trol	trol	NOUN
abc-4026	263	18	knock	knock	VERB
abc-4026	263	19	-	-	PUNCT
abc-4026	263	20	out	out	ADP
abc-4026	263	21	background	background	NOUN
abc-4026	263	22	with	with	ADP
abc-4026	263	23	the	the	DET
abc-4026	263	24	mutated	mutate	VERB
abc-4026	263	25	construct	construct	NOUN
abc-4026	263	26	trol(a	trol(a	NUM
abc-4026	263	27	/	/	SYM
abc-4026	263	28	i)-flag	i)-flag	NOUN
abc-4026	263	29	-	-	PUNCT
abc-4026	263	30	ha	ha	INTJ
abc-4026	263	31	in	in	ADP
abc-4026	263	32	ph7wg2.0	ph7wg2.0	PROPN
abc-4026	263	33	vector	vector	NOUN
abc-4026	263	34	we	we	PRON
abc-4026	263	35	successfully	successfully	ADV
abc-4026	263	36	managed	manage	VERB
abc-4026	263	37	to	to	PART
abc-4026	263	38	create	create	VERB
abc-4026	263	39	plants	plant	NOUN
abc-4026	263	40	that	that	PRON
abc-4026	263	41	contain	contain	VERB
abc-4026	263	42	trol	trol	NOUN
abc-4026	263	43	only	only	ADV
abc-4026	263	44	in	in	ADP
abc-4026	263	45	the	the	DET
abc-4026	263	46	inner	inner	ADJ
abc-4026	263	47	envelope	envelope	NOUN
abc-4026	263	48	membrane	membrane	NOUN
abc-4026	263	49	(	(	PUNCT
abc-4026	263	50	trol	trol	NOUN
abc-4026	263	51	-	-	PUNCT
abc-4026	263	52	ie	ie	ADJ
abc-4026	263	53	plants	plant	NOUN
abc-4026	263	54	)	)	PUNCT
abc-4026	263	55	.	.	PUNCT
abc-4026	264	1	these	these	DET
abc-4026	264	2	plants	plant	NOUN
abc-4026	264	3	were	be	AUX
abc-4026	264	4	selected	select	VERB
abc-4026	264	5	on	on	ADP
abc-4026	264	6	selective	selective	ADJ
abc-4026	264	7	growth	growth	NOUN
abc-4026	264	8	medium	medium	NOUN
abc-4026	264	9	with	with	ADP
abc-4026	264	10	the	the	DET
abc-4026	264	11	addition	addition	NOUN
abc-4026	264	12	of	of	ADP
abc-4026	264	13	specific	specific	ADJ
abc-4026	264	14	antibiotic	antibiotic	NOUN
abc-4026	264	15	and	and	CCONJ
abc-4026	264	16	tested	test	VERB
abc-4026	264	17	by	by	ADP
abc-4026	264	18	pcr	pcr	PROPN
abc-4026	264	19	,	,	PUNCT
abc-4026	264	20	dna	dna	NOUN
abc-4026	264	21	sequencing	sequencing	NOUN
abc-4026	264	22	,	,	PUNCT
abc-4026	264	23	and	and	CCONJ
abc-4026	264	24	western	western	ADJ
abc-4026	264	25	blotting	blotting	NOUN
abc-4026	264	26	at	at	ADP
abc-4026	264	27	different	different	ADJ
abc-4026	264	28	stages	stage	NOUN
abc-4026	264	29	of	of	ADP
abc-4026	264	30	the	the	DET
abc-4026	264	31	selection	selection	NOUN
abc-4026	264	32	process	process	NOUN
abc-4026	264	33	(	(	PUNCT
abc-4026	264	34	fig	fig	NOUN
abc-4026	264	35	.	.	PUNCT
abc-4026	265	1	1	1	NUM
abc-4026	265	2	)	)	PUNCT
abc-4026	265	3	.	.	PUNCT
abc-4026	266	1	plants	plant	NOUN
abc-4026	266	2	that	that	PRON
abc-4026	266	3	were	be	AUX
abc-4026	266	4	selected	select	VERB
abc-4026	266	5	as	as	ADP
abc-4026	266	6	homozygous	homozygous	ADJ
abc-4026	266	7	were	be	AUX
abc-4026	266	8	named	name	VERB
abc-4026	266	9	trol	trol	NOUN
abc-4026	266	10	-	-	PUNCT
abc-4026	266	11	ie8	ie8	NOUN
abc-4026	266	12	and	and	CCONJ
abc-4026	266	13	trol	trol	NOUN
abc-4026	266	14	-	-	PUNCT
abc-4026	266	15	ie18	ie18	PROPN
abc-4026	266	16	.	.	PUNCT
abc-4026	267	1	trol	trol	NOUN
abc-4026	267	2	-	-	PUNCT
abc-4026	267	3	ie8	ie8	NOUN
abc-4026	267	4	and	and	CCONJ
abc-4026	267	5	trol	trol	NOUN
abc-4026	267	6	-	-	PUNCT
abc-4026	267	7	ie18	ie18	PROPN
abc-4026	267	8	plants	plant	NOUN
abc-4026	267	9	grow	grow	VERB
abc-4026	267	10	well	well	ADV
abc-4026	267	11	throughout	throughout	ADP
abc-4026	267	12	the	the	DET
abc-4026	267	13	whole	whole	ADJ
abc-4026	267	14	life	life	NOUN
abc-4026	267	15	cycle	cycle	NOUN
abc-4026	267	16	and	and	CCONJ
abc-4026	267	17	produce	produce	VERB
abc-4026	267	18	viable	viable	ADJ
abc-4026	267	19	seeds	seed	NOUN
abc-4026	267	20	.	.	PUNCT
abc-4026	268	1	in	in	ADP
abc-4026	268	2	comparison	comparison	NOUN
abc-4026	268	3	to	to	ADP
abc-4026	268	4	the	the	DET
abc-4026	268	5	wt	wt	NOUN
abc-4026	268	6	arabidopsis	arabidopsis	NOUN
abc-4026	268	7	,	,	PUNCT
abc-4026	268	8	their	their	PRON
abc-4026	268	9	development	development	NOUN
abc-4026	268	10	is	be	AUX
abc-4026	268	11	delayed	delay	VERB
abc-4026	268	12	.	.	PUNCT
abc-4026	269	1	their	their	PRON
abc-4026	269	2	hypocotyls	hypocotyls	NOUN
abc-4026	269	3	develop	develop	VERB
abc-4026	269	4	several	several	ADJ
abc-4026	269	5	days	day	NOUN
abc-4026	269	6	later	later	ADV
abc-4026	269	7	,	,	PUNCT
abc-4026	269	8	and	and	CCONJ
abc-4026	269	9	they	they	PRON
abc-4026	269	10	grow	grow	VERB
abc-4026	269	11	slower	slow	ADJ
abc-4026	269	12	due	due	ADJ
abc-4026	269	13	to	to	ADP
abc-4026	269	14	delayed	delay	VERB
abc-4026	269	15	germination	germination	NOUN
abc-4026	269	16	(	(	PUNCT
abc-4026	269	17	fig	fig	NOUN
abc-4026	269	18	.	.	PUNCT
abc-4026	270	1	2	2	NUM
abc-4026	270	2	)	)	PUNCT
abc-4026	270	3	.	.	PUNCT
abc-4026	271	1	trol	trol	PROPN
abc-4026	271	2	-	-	PUNCT
abc-4026	271	3	ie	ie	X
abc-4026	271	4	plants	plant	NOUN
abc-4026	271	5	have	have	VERB
abc-4026	271	6	smaller	small	ADJ
abc-4026	271	7	rosettes	rosette	NOUN
abc-4026	271	8	and	and	CCONJ
abc-4026	271	9	weaker	weak	ADJ
abc-4026	271	10	stems	stem	NOUN
abc-4026	271	11	,	,	PUNCT
abc-4026	271	12	and	and	CCONJ
abc-4026	271	13	their	their	PRON
abc-4026	271	14	flowering	flowering	NOUN
abc-4026	271	15	is	be	AUX
abc-4026	271	16	delayed	delay	VERB
abc-4026	271	17	.	.	PUNCT
abc-4026	272	1	otherwise	otherwise	ADV
abc-4026	272	2	,	,	PUNCT
abc-4026	272	3	they	they	PRON
abc-4026	272	4	resemble	resemble	VERB
abc-4026	272	5	the	the	DET
abc-4026	272	6	phenotype	phenotype	NOUN
abc-4026	272	7	of	of	ADP
abc-4026	272	8	the	the	DET
abc-4026	272	9	wild	wild	ADJ
abc-4026	272	10	type	type	NOUN
abc-4026	272	11	of	of	ADP
abc-4026	272	12	arabidopsis	arabidopsis	NOUN
abc-4026	272	13	.	.	PUNCT
abc-4026	273	1	the	the	DET
abc-4026	273	2	life	life	NOUN
abc-4026	273	3	cycle	cycle	NOUN
abc-4026	273	4	of	of	ADP
abc-4026	273	5	the	the	DET
abc-4026	273	6	trol	trol	NOUN
abc-4026	273	7	-	-	PUNCT
abc-4026	273	8	ie	ie	X
abc-4026	273	9	plants	plant	NOUN
abc-4026	273	10	surprisingly	surprisingly	ADV
abc-4026	273	11	does	do	AUX
abc-4026	273	12	not	not	PART
abc-4026	273	13	resemble	resemble	VERB
abc-4026	273	14	the	the	DET
abc-4026	273	15	trol	trol	NOUN
abc-4026	273	16	ko	ko	PROPN
abc-4026	273	17	plant	plant	NOUN
abc-4026	273	18	cycle	cycle	NOUN
abc-4026	273	19	.	.	PUNCT
abc-4026	274	1	trol	trol	PROPN
abc-4026	274	2	ko	ko	PROPN
abc-4026	274	3	plants	plant	NOUN
abc-4026	274	4	,	,	PUNCT
abc-4026	274	5	in	in	ADP
abc-4026	274	6	which	which	PRON
abc-4026	274	7	there	there	PRON
abc-4026	274	8	is	be	VERB
abc-4026	274	9	no	no	DET
abc-4026	274	10	production	production	NOUN
abc-4026	274	11	of	of	ADP
abc-4026	274	12	trol	trol	NOUN
abc-4026	274	13	,	,	PUNCT
abc-4026	274	14	follow	follow	VERB
abc-4026	274	15	the	the	DET
abc-4026	274	16	wt	wt	NOUN
abc-4026	274	17	developmental	developmental	ADJ
abc-4026	274	18	cycle	cycle	NOUN
abc-4026	274	19	,	,	PUNCT
abc-4026	274	20	and	and	CCONJ
abc-4026	274	21	their	their	PRON
abc-4026	274	22	hypocotyls	hypocotyls	NOUN
abc-4026	274	23	,	,	PUNCT
abc-4026	274	24	rosettes	rosette	NOUN
abc-4026	274	25	and	and	CCONJ
abc-4026	274	26	seeds	seed	NOUN
abc-4026	274	27	are	be	AUX
abc-4026	274	28	all	all	ADV
abc-4026	274	29	slightly	slightly	ADV
abc-4026	274	30	bigger	big	ADJ
abc-4026	274	31	than	than	ADP
abc-4026	274	32	the	the	DET
abc-4026	274	33	wt	wt	X
abc-4026	274	34	(	(	PUNCT
abc-4026	274	35	jurić	jurić	VERB
abc-4026	274	36	et	et	PROPN
abc-4026	274	37	al	al	PROPN
abc-4026	274	38	.	.	PROPN
abc-4026	274	39	2009	2009	NUM
abc-4026	274	40	,	,	PUNCT
abc-4026	274	41	vojta	vojta	NOUN
abc-4026	274	42	et	et	PROPN
abc-4026	274	43	al	al	PROPN
abc-4026	274	44	.	.	PROPN
abc-4026	274	45	2015	2015	NUM
abc-4026	274	46	)	)	PUNCT
abc-4026	274	47	.	.	PUNCT
abc-4026	275	1	although	although	SCONJ
abc-4026	275	2	we	we	PRON
abc-4026	275	3	confirmed	confirm	VERB
abc-4026	275	4	which	which	DET
abc-4026	275	5	plants	plant	NOUN
abc-4026	275	6	were	be	AUX
abc-4026	275	7	successfully	successfully	ADV
abc-4026	275	8	transformed	transform	VERB
abc-4026	275	9	,	,	PUNCT
abc-4026	275	10	by	by	ADP
abc-4026	275	11	using	use	VERB
abc-4026	275	12	sds	sds	NOUN
abc-4026	275	13	-	-	PUNCT
abc-4026	275	14	page	page	NOUN
abc-4026	275	15	and	and	CCONJ
abc-4026	275	16	subsequent	subsequent	ADJ
abc-4026	275	17	western	western	ADJ
abc-4026	275	18	blotting	blotting	NOUN
abc-4026	275	19	using	use	VERB
abc-4026	275	20	anti	anti	ADJ
abc-4026	275	21	-	-	ADJ
abc-4026	275	22	trol	trol	ADJ
abc-4026	275	23	or	or	CCONJ
abc-4026	275	24	anti	anti	ADJ
abc-4026	275	25	-	-	ADJ
abc-4026	275	26	ha	ha	INTJ
abc-4026	275	27	antibodies	antibody	NOUN
abc-4026	275	28	,	,	PUNCT
abc-4026	275	29	it	it	PRON
abc-4026	275	30	was	be	AUX
abc-4026	275	31	not	not	PART
abc-4026	275	32	possible	possible	ADJ
abc-4026	275	33	to	to	PART
abc-4026	275	34	differentiate	differentiate	VERB
abc-4026	275	35	the	the	DET
abc-4026	275	36	precursor	precursor	NOUN
abc-4026	275	37	and	and	CCONJ
abc-4026	275	38	the	the	DET
abc-4026	275	39	mature	mature	ADJ
abc-4026	275	40	form	form	NOUN
abc-4026	275	41	of	of	ADP
abc-4026	275	42	trol	trol	NOUN
abc-4026	275	43	according	accord	VERB
abc-4026	275	44	to	to	ADP
abc-4026	275	45	the	the	DET
abc-4026	275	46	difference	difference	NOUN
abc-4026	275	47	in	in	ADP
abc-4026	275	48	size	size	NOUN
abc-4026	275	49	and	and	CCONJ
abc-4026	275	50	therefore	therefore	ADV
abc-4026	275	51	not	not	PART
abc-4026	275	52	possible	possible	ADJ
abc-4026	275	53	to	to	PART
abc-4026	275	54	determine	determine	VERB
abc-4026	275	55	whether	whether	SCONJ
abc-4026	275	56	it	it	PRON
abc-4026	275	57	was	be	AUX
abc-4026	275	58	localized	localize	VERB
abc-4026	275	59	in	in	ADP
abc-4026	275	60	the	the	DET
abc-4026	275	61	inner	inner	ADJ
abc-4026	275	62	envelope	envelope	NOUN
abc-4026	275	63	membrane	membrane	NOUN
abc-4026	275	64	or	or	CCONJ
abc-4026	275	65	/	/	SYM
abc-4026	275	66	and	and	CCONJ
abc-4026	275	67	in	in	ADP
abc-4026	275	68	thylakoids	thylakoid	NOUN
abc-4026	275	69	.	.	PUNCT
abc-4026	276	1	the	the	DET
abc-4026	276	2	reason	reason	NOUN
abc-4026	276	3	for	for	ADP
abc-4026	276	4	this	this	PRON
abc-4026	276	5	is	be	AUX
abc-4026	276	6	that	that	SCONJ
abc-4026	276	7	when	when	SCONJ
abc-4026	276	8	using	use	VERB
abc-4026	276	9	anti	anti	ADJ
abc-4026	276	10	-	-	ADJ
abc-4026	276	11	trol	trol	ADJ
abc-4026	276	12	or	or	CCONJ
abc-4026	276	13	anti	anti	ADJ
abc-4026	276	14	-	-	ADJ
abc-4026	276	15	ha	ha	INTJ
abc-4026	276	16	in	in	ADP
abc-4026	276	17	most	most	ADJ
abc-4026	276	18	cases	case	NOUN
abc-4026	276	19	a	a	DET
abc-4026	276	20	bulky	bulky	ADJ
abc-4026	276	21	signal	signal	NOUN
abc-4026	276	22	was	be	AUX
abc-4026	276	23	visible	visible	ADJ
abc-4026	276	24	on	on	ADP
abc-4026	276	25	gel	gel	NOUN
abc-4026	276	26	.	.	PUNCT
abc-4026	277	1	the	the	DET
abc-4026	277	2	addition	addition	NOUN
abc-4026	277	3	of	of	ADP
abc-4026	277	4	8	8	NUM
abc-4026	277	5	m	m	NOUN
abc-4026	277	6	vojta	vojta	NOUN
abc-4026	277	7	l.	l.	PROPN
abc-4026	277	8	,	,	PUNCT
abc-4026	277	9	fulgosi	fulgosi	PROPN
abc-4026	277	10	h.	h.	PROPN
abc-4026	277	11	,	,	PUNCT
abc-4026	277	12	tomašić	tomašić	PROPN
abc-4026	277	13	paić	paić	PROPN
abc-4026	277	14	a.	a.	PROPN
abc-4026	277	15	,	,	PUNCT
abc-4026	277	16	dumančić	dumančić	PROPN
abc-4026	277	17	e.	e.	PROPN
abc-4026	277	18	264	264	NUM
abc-4026	277	19	acta	acta	PROPN
abc-4026	277	20	bot	bot	PROPN
abc-4026	277	21	.	.	PUNCT
abc-4026	278	1	croat	croat	PROPN
abc-4026	278	2	.	.	PUNCT
abc-4026	279	1	84	84	NUM
abc-4026	279	2	(	(	PUNCT
abc-4026	279	3	2	2	NUM
abc-4026	279	4	)	)	PUNCT
abc-4026	279	5	,	,	PUNCT
abc-4026	279	6	2025	2025	NUM
abc-4026	279	7	urea	urea	NOUN
abc-4026	279	8	in	in	ADP
abc-4026	279	9	the	the	DET
abc-4026	279	10	samples	sample	NOUN
abc-4026	279	11	and/or	and/or	CCONJ
abc-4026	279	12	in	in	ADP
abc-4026	279	13	the	the	DET
abc-4026	279	14	gel	gel	NOUN
abc-4026	279	15	itself	itself	PRON
abc-4026	279	16	(	(	PUNCT
abc-4026	279	17	data	datum	NOUN
abc-4026	279	18	not	not	PART
abc-4026	279	19	shown	show	VERB
abc-4026	279	20	)	)	PUNCT
abc-4026	279	21	also	also	ADV
abc-4026	279	22	did	do	AUX
abc-4026	279	23	not	not	PART
abc-4026	279	24	help	help	VERB
abc-4026	279	25	to	to	PART
abc-4026	279	26	reliably	reliably	ADV
abc-4026	279	27	differentiate	differentiate	VERB
abc-4026	279	28	the	the	DET
abc-4026	279	29	thylakoidal	thylakoidal	NOUN
abc-4026	279	30	(	(	PUNCT
abc-4026	279	31	66	66	NUM
abc-4026	279	32	kda	kda	NOUN
abc-4026	279	33	)	)	PUNCT
abc-4026	279	34	vs	vs	ADP
abc-4026	279	35	inner	inner	ADJ
abc-4026	279	36	envelope	envelope	NOUN
abc-4026	279	37	membrane	membrane	NOUN
abc-4026	279	38	form	form	NOUN
abc-4026	279	39	of	of	ADP
abc-4026	279	40	trol	trol	NOUN
abc-4026	279	41	(	(	PUNCT
abc-4026	279	42	70	70	NUM
abc-4026	279	43	kda	kda	NOUN
abc-4026	279	44	)	)	PUNCT
abc-4026	279	45	.	.	PUNCT
abc-4026	280	1	therefore	therefore	ADV
abc-4026	280	2	,	,	PUNCT
abc-4026	280	3	it	it	PRON
abc-4026	280	4	was	be	AUX
abc-4026	280	5	essential	essential	ADJ
abc-4026	280	6	to	to	PART
abc-4026	280	7	produce	produce	VERB
abc-4026	280	8	the	the	DET
abc-4026	280	9	antiserum	antiserum	NOUN
abc-4026	280	10	that	that	PRON
abc-4026	280	11	would	would	AUX
abc-4026	280	12	recognize	recognize	VERB
abc-4026	280	13	only	only	ADV
abc-4026	280	14	the	the	DET
abc-4026	280	15	precursor	precursor	NOUN
abc-4026	280	16	form	form	NOUN
abc-4026	280	17	of	of	ADP
abc-4026	280	18	trol	trol	NOUN
abc-4026	280	19	.	.	PUNCT
abc-4026	281	1	we	we	PRON
abc-4026	281	2	selected	select	VERB
abc-4026	281	3	n	n	CCONJ
abc-4026	281	4	-	-	PUNCT
abc-4026	281	5	terminal	terminal	ADJ
abc-4026	281	6	66	66	NUM
abc-4026	281	7	amino	amino	ADJ
abc-4026	281	8	acids	acid	NOUN
abc-4026	281	9	of	of	ADP
abc-4026	281	10	trol	trol	NOUN
abc-4026	281	11	to	to	PART
abc-4026	281	12	custom	custom	NOUN
abc-4026	281	13	produce	produce	VERB
abc-4026	281	14	a	a	DET
abc-4026	281	15	polypeptide	polypeptide	NOUN
abc-4026	281	16	,	,	PUNCT
abc-4026	281	17	an	an	DET
abc-4026	281	18	antigen	antigen	NOUN
abc-4026	281	19	that	that	PRON
abc-4026	281	20	would	would	AUX
abc-4026	281	21	,	,	PUNCT
abc-4026	281	22	by	by	ADP
abc-4026	281	23	immunizing	immunize	VERB
abc-4026	281	24	experimental	experimental	ADJ
abc-4026	281	25	animals	animal	NOUN
abc-4026	281	26	,	,	PUNCT
abc-4026	281	27	give	give	VERB
abc-4026	281	28	a	a	DET
abc-4026	281	29	specific	specific	ADJ
abc-4026	281	30	antiserum	antiserum	NOUN
abc-4026	281	31	.	.	PUNCT
abc-4026	282	1	anti	anti	ADJ
abc-4026	282	2	-	-	ADJ
abc-4026	282	3	pretrol	pretrol	ADJ
abc-4026	282	4	antiserum	antiserum	NOUN
abc-4026	282	5	(	(	PUNCT
abc-4026	282	6	antiserum	antiserum	VERB
abc-4026	282	7	against	against	ADP
abc-4026	282	8	the	the	DET
abc-4026	282	9	n	n	CCONJ
abc-4026	282	10	-	-	PUNCT
abc-4026	282	11	terminal	terminal	ADJ
abc-4026	282	12	presequence	presequence	NOUN
abc-4026	282	13	of	of	ADP
abc-4026	282	14	trol	trol	NOUN
abc-4026	282	15	)	)	PUNCT
abc-4026	282	16	was	be	AUX
abc-4026	282	17	successfully	successfully	ADV
abc-4026	282	18	produced	produce	VERB
abc-4026	282	19	(	(	PUNCT
abc-4026	282	20	by	by	ADP
abc-4026	282	21	davids	davids	PROPN
abc-4026	282	22	biotechnologie	biotechnologie	PROPN
abc-4026	282	23	gmbh	gmbh	PROPN
abc-4026	282	24	.	.	PUNCT
abc-4026	283	1	,	,	PUNCT
abc-4026	283	2	regensburg	regensburg	PROPN
abc-4026	283	3	,	,	PUNCT
abc-4026	283	4	germany	germany	PROPN
abc-4026	283	5	)	)	PUNCT
abc-4026	283	6	.	.	PUNCT
abc-4026	284	1	while	while	SCONJ
abc-4026	284	2	testing	test	VERB
abc-4026	284	3	it	it	PRON
abc-4026	284	4	,	,	PUNCT
abc-4026	284	5	it	it	PRON
abc-4026	284	6	was	be	AUX
abc-4026	284	7	clear	clear	ADJ
abc-4026	284	8	that	that	SCONJ
abc-4026	284	9	the	the	DET
abc-4026	284	10	antiserum	antiserum	NOUN
abc-4026	284	11	must	must	AUX
abc-4026	284	12	be	be	AUX
abc-4026	284	13	further	further	ADJ
abc-4026	284	14	affinity	affinity	NOUN
abc-4026	284	15	purified	purify	VERB
abc-4026	284	16	,	,	PUNCT
abc-4026	284	17	since	since	SCONJ
abc-4026	284	18	it	it	PRON
abc-4026	284	19	showed	show	VERB
abc-4026	284	20	a	a	DET
abc-4026	284	21	strong	strong	ADJ
abc-4026	284	22	background	background	NOUN
abc-4026	284	23	signal	signal	NOUN
abc-4026	284	24	when	when	SCONJ
abc-4026	284	25	we	we	PRON
abc-4026	284	26	assessed	assess	VERB
abc-4026	284	27	the	the	DET
abc-4026	284	28	plant	plant	NOUN
abc-4026	284	29	extracts	extract	NOUN
abc-4026	284	30	.	.	PUNCT
abc-4026	285	1	anti	anti	ADJ
abc-4026	285	2	-	-	ADJ
abc-4026	285	3	pretrol	pretrol	ADJ
abc-4026	285	4	serum	serum	NOUN
abc-4026	285	5	that	that	PRON
abc-4026	285	6	was	be	AUX
abc-4026	285	7	not	not	PART
abc-4026	285	8	affinity	affinity	NOUN
abc-4026	285	9	purified	purify	VERB
abc-4026	285	10	did	do	AUX
abc-4026	285	11	not	not	PART
abc-4026	285	12	differentiate	differentiate	VERB
abc-4026	285	13	between	between	ADP
abc-4026	285	14	trol	trol	NOUN
abc-4026	285	15	-	-	PUNCT
abc-4026	285	16	ie	ie	X
abc-4026	285	17	and	and	CCONJ
abc-4026	285	18	trol	trol	PROPN
abc-4026	285	19	ox	ox	ADJ
abc-4026	285	20	lines	line	NOUN
abc-4026	285	21	,	,	PUNCT
abc-4026	285	22	except	except	SCONJ
abc-4026	285	23	that	that	SCONJ
abc-4026	285	24	the	the	DET
abc-4026	285	25	resulting	result	VERB
abc-4026	285	26	signal	signal	NOUN
abc-4026	285	27	/	/	SYM
abc-4026	285	28	band	band	NOUN
abc-4026	285	29	was	be	AUX
abc-4026	285	30	more	more	ADV
abc-4026	285	31	intensive	intensive	ADJ
abc-4026	285	32	in	in	ADP
abc-4026	285	33	the	the	DET
abc-4026	285	34	trol	trol	NOUN
abc-4026	285	35	-	-	PUNCT
abc-4026	285	36	ie	ie	ADJ
abc-4026	285	37	line	line	NOUN
abc-4026	285	38	.	.	PUNCT
abc-4026	286	1	affinity	affinity	NOUN
abc-4026	286	2	purified	purify	VERB
abc-4026	286	3	antiserum	antiserum	NOUN
abc-4026	286	4	proved	prove	VERB
abc-4026	286	5	to	to	PART
abc-4026	286	6	be	be	AUX
abc-4026	286	7	highly	highly	ADV
abc-4026	286	8	specific	specific	ADJ
abc-4026	286	9	,	,	PUNCT
abc-4026	286	10	recognizing	recognize	VERB
abc-4026	286	11	a	a	DET
abc-4026	286	12	single	single	ADJ
abc-4026	286	13	clear	clear	ADJ
abc-4026	286	14	band	band	NOUN
abc-4026	286	15	in	in	ADP
abc-4026	286	16	trol	trol	NOUN
abc-4026	286	17	-	-	PUNCT
abc-4026	286	18	ie	ie	X
abc-4026	286	19	lines	line	NOUN
abc-4026	286	20	,	,	PUNCT
abc-4026	286	21	but	but	CCONJ
abc-4026	286	22	not	not	PART
abc-4026	286	23	in	in	ADP
abc-4026	286	24	the	the	DET
abc-4026	286	25	trol	trol	NOUN
abc-4026	286	26	ox	ox	ADJ
abc-4026	286	27	line	line	NOUN
abc-4026	286	28	.	.	PUNCT
abc-4026	287	1	a	a	DET
abc-4026	287	2	weak	weak	ADJ
abc-4026	287	3	visible	visible	ADJ
abc-4026	287	4	signal	signal	NOUN
abc-4026	287	5	in	in	ADP
abc-4026	287	6	the	the	DET
abc-4026	287	7	trol	trol	NOUN
abc-4026	287	8	ox	ox	NOUN
abc-4026	287	9	line	line	NOUN
abc-4026	287	10	was	be	AUX
abc-4026	287	11	present	present	ADJ
abc-4026	287	12	only	only	ADV
abc-4026	287	13	when	when	SCONJ
abc-4026	287	14	there	there	PRON
abc-4026	287	15	was	be	VERB
abc-4026	287	16	a	a	DET
abc-4026	287	17	lot	lot	NOUN
abc-4026	287	18	of	of	ADP
abc-4026	287	19	sample	sample	NOUN
abc-4026	287	20	loaded	load	VERB
abc-4026	287	21	on	on	ADP
abc-4026	287	22	gel	gel	NOUN
abc-4026	287	23	.	.	PUNCT
abc-4026	288	1	this	this	PRON
abc-4026	288	2	is	be	AUX
abc-4026	288	3	because	because	SCONJ
abc-4026	288	4	trol	trol	PROPN
abc-4026	288	5	preprotein	preprotein	PROPN
abc-4026	288	6	in	in	ADP
abc-4026	288	7	trol	trol	PROPN
abc-4026	288	8	ox	ox	NOUN
abc-4026	288	9	line	line	NOUN
abc-4026	288	10	was	be	AUX
abc-4026	288	11	present	present	ADJ
abc-4026	288	12	in	in	ADP
abc-4026	288	13	extremely	extremely	ADV
abc-4026	288	14	small	small	ADJ
abc-4026	288	15	amounts	amount	NOUN
abc-4026	288	16	,	,	PUNCT
abc-4026	288	17	while	while	SCONJ
abc-4026	288	18	the	the	DET
abc-4026	288	19	vast	vast	ADJ
abc-4026	288	20	majority	majority	NOUN
abc-4026	288	21	of	of	ADP
abc-4026	288	22	trol	trol	NOUN
abc-4026	288	23	was	be	AUX
abc-4026	288	24	in	in	ADP
abc-4026	288	25	thylakoids	thylakoid	NOUN
abc-4026	288	26	,	,	PUNCT
abc-4026	288	27	as	as	ADP
abc-4026	288	28	a	a	DET
abc-4026	288	29	mature	mature	ADJ
abc-4026	288	30	form	form	NOUN
abc-4026	288	31	.	.	PUNCT
abc-4026	289	1	we	we	PRON
abc-4026	289	2	analyzed	analyze	VERB
abc-4026	289	3	the	the	DET
abc-4026	289	4	chloroplasts	chloroplast	NOUN
abc-4026	289	5	from	from	ADP
abc-4026	289	6	wt	wt	PROPN
abc-4026	289	7	,	,	PUNCT
abc-4026	289	8	trol	trol	PROPN
abc-4026	289	9	ox	ox	PROPN
abc-4026	289	10	,	,	PUNCT
abc-4026	289	11	trol	trol	PROPN
abc-4026	289	12	ko	ko	PROPN
abc-4026	289	13	,	,	PUNCT
abc-4026	289	14	and	and	CCONJ
abc-4026	289	15	trol	trol	NOUN
abc-4026	289	16	-	-	PUNCT
abc-4026	289	17	ie	ie	X
abc-4026	289	18	lines	line	NOUN
abc-4026	289	19	by	by	ADP
abc-4026	289	20	sds	sds	NOUN
abc-4026	289	21	-	-	PUNCT
abc-4026	289	22	page	page	NOUN
abc-4026	289	23	and	and	CCONJ
abc-4026	289	24	western	western	ADJ
abc-4026	289	25	blotting	blotting	NOUN
abc-4026	289	26	,	,	PUNCT
abc-4026	289	27	as	as	SCONJ
abc-4026	289	28	described	describe	VERB
abc-4026	289	29	in	in	ADP
abc-4026	289	30	materials	material	NOUN
abc-4026	289	31	and	and	CCONJ
abc-4026	289	32	methods	method	NOUN
abc-4026	289	33	section	section	NOUN
abc-4026	289	34	.	.	PUNCT
abc-4026	290	1	we	we	PRON
abc-4026	290	2	used	use	VERB
abc-4026	290	3	anti	anti	ADJ
abc-4026	290	4	-	-	NOUN
abc-4026	290	5	trol	trol	ADJ
abc-4026	290	6	,	,	PUNCT
abc-4026	290	7	anti	anti	ADJ
abc-4026	290	8	-	-	ADJ
abc-4026	290	9	ha	ha	ADJ
abc-4026	290	10	,	,	PUNCT
abc-4026	290	11	and	and	CCONJ
abc-4026	290	12	anti	anti	ADJ
abc-4026	290	13	-	-	ADJ
abc-4026	290	14	pretrol	pretrol	ADJ
abc-4026	290	15	sera	sera	NOUN
abc-4026	290	16	.	.	PUNCT
abc-4026	291	1	it	it	PRON
abc-4026	291	2	was	be	AUX
abc-4026	291	3	clearly	clearly	ADV
abc-4026	291	4	visible	visible	ADJ
abc-4026	291	5	that	that	SCONJ
abc-4026	291	6	there	there	PRON
abc-4026	291	7	was	be	VERB
abc-4026	291	8	no	no	DET
abc-4026	291	9	signal	signal	NOUN
abc-4026	291	10	using	use	VERB
abc-4026	291	11	any	any	PRON
abc-4026	291	12	of	of	ADP
abc-4026	291	13	the	the	DET
abc-4026	291	14	antisera	antisera	NOUN
abc-4026	291	15	in	in	ADP
abc-4026	291	16	trol	trol	PROPN
abc-4026	291	17	ko	ko	PROPN
abc-4026	291	18	plants	plant	NOUN
abc-4026	291	19	(	(	PUNCT
abc-4026	291	20	data	datum	NOUN
abc-4026	291	21	not	not	PART
abc-4026	291	22	shown	show	VERB
abc-4026	291	23	)	)	PUNCT
abc-4026	291	24	.	.	PUNCT
abc-4026	292	1	affinity	affinity	NOUN
abc-4026	292	2	purified	purify	VERB
abc-4026	292	3	anti	anti	ADJ
abc-4026	292	4	-	-	ADJ
abc-4026	292	5	pretrol	pretrol	NOUN
abc-4026	292	6	clearly	clearly	ADV
abc-4026	292	7	recognized	recognize	VERB
abc-4026	292	8	only	only	ADV
abc-4026	292	9	a	a	DET
abc-4026	292	10	single	single	ADJ
abc-4026	292	11	band	band	NOUN
abc-4026	292	12	in	in	ADP
abc-4026	292	13	trol	trol	NOUN
abc-4026	292	14	-	-	PUNCT
abc-4026	292	15	ie	ie	X
abc-4026	292	16	8	8	NUM
abc-4026	292	17	and	and	CCONJ
abc-4026	292	18	trol	trol	NOUN
abc-4026	292	19	-	-	PUNCT
abc-4026	292	20	ie	ie	X
abc-4026	292	21	18	18	NUM
abc-4026	292	22	lines	line	NOUN
abc-4026	292	23	and	and	CCONJ
abc-4026	292	24	not	not	PART
abc-4026	292	25	in	in	ADP
abc-4026	292	26	the	the	DET
abc-4026	292	27	trol	trol	NOUN
abc-4026	292	28	overexpression	overexpression	NOUN
abc-4026	292	29	line	line	NOUN
abc-4026	292	30	(	(	PUNCT
abc-4026	292	31	fig	fig	NOUN
abc-4026	292	32	.	.	NOUN
abc-4026	292	33	3	3	NUM
abc-4026	292	34	and	and	CCONJ
abc-4026	292	35	fig	fig	NOUN
abc-4026	292	36	.	.	PUNCT
abc-4026	293	1	4	4	NUM
abc-4026	293	2	)	)	PUNCT
abc-4026	293	3	.	.	PUNCT
abc-4026	294	1	when	when	SCONJ
abc-4026	294	2	compared	compare	VERB
abc-4026	294	3	to	to	ADP
abc-4026	294	4	the	the	DET
abc-4026	294	5	anti	anti	ADJ
abc-4026	294	6	-	-	ADJ
abc-4026	294	7	ha	ha	ADJ
abc-4026	294	8	blots	blot	NOUN
abc-4026	294	9	on	on	ADP
abc-4026	294	10	trol	trol	NOUN
abc-4026	294	11	-	-	PUNCT
abc-4026	294	12	ie	ie	X
abc-4026	294	13	lines	line	NOUN
abc-4026	294	14	,	,	PUNCT
abc-4026	294	15	it	it	PRON
abc-4026	294	16	was	be	AUX
abc-4026	294	17	clear	clear	ADJ
abc-4026	294	18	that	that	SCONJ
abc-4026	294	19	affinity	affinity	NOUN
abc-4026	294	20	purified	purify	VERB
abc-4026	294	21	anti	anti	ADJ
abc-4026	294	22	-	-	ADJ
abc-4026	294	23	pretrol	pretrol	NOUN
abc-4026	294	24	recognized	recognize	VERB
abc-4026	294	25	the	the	DET
abc-4026	294	26	precursor	precursor	NOUN
abc-4026	294	27	form	form	NOUN
abc-4026	294	28	of	of	ADP
abc-4026	294	29	trol	trol	NOUN
abc-4026	294	30	and	and	CCONJ
abc-4026	294	31	not	not	PART
abc-4026	294	32	the	the	DET
abc-4026	294	33	mature	mature	ADJ
abc-4026	294	34	one	one	NUM
abc-4026	294	35	(	(	PUNCT
abc-4026	294	36	fig	fig	NOUN
abc-4026	294	37	.	.	PUNCT
abc-4026	295	1	4	4	NUM
abc-4026	295	2	)	)	PUNCT
abc-4026	295	3	.	.	PUNCT
abc-4026	296	1	when	when	SCONJ
abc-4026	296	2	using	use	VERB
abc-4026	296	3	the	the	DET
abc-4026	296	4	anti	anti	ADJ
abc-4026	296	5	-	-	ADJ
abc-4026	296	6	ha	ha	ADJ
abc-4026	296	7	antibody	antibody	NOUN
abc-4026	296	8	,	,	PUNCT
abc-4026	296	9	mature	mature	ADJ
abc-4026	296	10	form	form	NOUN
abc-4026	296	11	of	of	ADP
abc-4026	296	12	trol	trol	NOUN
abc-4026	296	13	could	could	AUX
abc-4026	296	14	be	be	AUX
abc-4026	296	15	detected	detect	VERB
abc-4026	296	16	also	also	ADV
abc-4026	296	17	in	in	ADP
abc-4026	296	18	the	the	DET
abc-4026	296	19	ie	ie	X
abc-4026	296	20	lines	line	NOUN
abc-4026	296	21	(	(	PUNCT
abc-4026	296	22	fig	fig	NOUN
abc-4026	296	23	.	.	PUNCT
abc-4026	297	1	4	4	NUM
abc-4026	297	2	lanes	lane	NOUN
abc-4026	297	3	6	6	NUM
abc-4026	297	4	and	and	CCONJ
abc-4026	297	5	7	7	NUM
abc-4026	297	6	)	)	PUNCT
abc-4026	297	7	,	,	PUNCT
abc-4026	297	8	however	however	ADV
abc-4026	297	9	in	in	ADP
abc-4026	297	10	lesser	less	ADJ
abc-4026	297	11	amount	amount	NOUN
abc-4026	297	12	than	than	ADP
abc-4026	297	13	in	in	ADP
abc-4026	297	14	the	the	DET
abc-4026	297	15	ox	ox	NOUN
abc-4026	297	16	(	(	PUNCT
abc-4026	297	17	fig	fig	NOUN
abc-4026	297	18	.	.	PUNCT
abc-4026	297	19	4	4	NUM
abc-4026	297	20	lane	lane	NOUN
abc-4026	297	21	5	5	NUM
abc-4026	297	22	)	)	PUNCT
abc-4026	297	23	.	.	PUNCT
abc-4026	298	1	in	in	ADP
abc-4026	298	2	the	the	DET
abc-4026	298	3	ie	ie	X
abc-4026	298	4	lines	line	NOUN
abc-4026	298	5	processing	processing	NOUN
abc-4026	298	6	of	of	ADP
abc-4026	298	7	trol	trol	NOUN
abc-4026	298	8	still	still	ADV
abc-4026	298	9	occurred	occur	VERB
abc-4026	298	10	to	to	ADP
abc-4026	298	11	some	some	DET
abc-4026	298	12	extent	extent	NOUN
abc-4026	298	13	(	(	PUNCT
abc-4026	298	14	vojta	vojta	NOUN
abc-4026	298	15	et	et	PROPN
abc-4026	298	16	al	al	PROPN
abc-4026	298	17	.	.	PROPN
abc-4026	298	18	2018	2018	NUM
abc-4026	298	19	)	)	PUNCT
abc-4026	298	20	and	and	CCONJ
abc-4026	298	21	mature	mature	ADJ
abc-4026	298	22	trol	trol	NOUN
abc-4026	298	23	was	be	AUX
abc-4026	298	24	visible	visible	ADJ
abc-4026	298	25	because	because	SCONJ
abc-4026	298	26	of	of	ADP
abc-4026	298	27	the	the	DET
abc-4026	298	28	much	much	ADV
abc-4026	298	29	larger	large	ADJ
abc-4026	298	30	amount	amount	NOUN
abc-4026	298	31	of	of	ADP
abc-4026	298	32	thylakoids	thylakoid	NOUN
abc-4026	298	33	,	,	PUNCT
abc-4026	298	34	although	although	SCONJ
abc-4026	298	35	the	the	DET
abc-4026	298	36	prevailing	prevail	VERB
abc-4026	298	37	amount	amount	NOUN
abc-4026	298	38	of	of	ADP
abc-4026	298	39	trol	trol	NOUN
abc-4026	298	40	was	be	AUX
abc-4026	298	41	in	in	ADP
abc-4026	298	42	the	the	DET
abc-4026	298	43	inner	inner	ADJ
abc-4026	298	44	envelope	envelope	NOUN
abc-4026	298	45	membrane	membrane	NOUN
abc-4026	298	46	.	.	PUNCT
abc-4026	299	1	therefore	therefore	ADV
abc-4026	299	2	,	,	PUNCT
abc-4026	299	3	when	when	SCONJ
abc-4026	299	4	taken	take	VERB
abc-4026	299	5	together	together	ADV
abc-4026	299	6	with	with	ADP
abc-4026	299	7	the	the	DET
abc-4026	299	8	previous	previous	ADJ
abc-4026	299	9	localization	localization	NOUN
abc-4026	299	10	results	result	NOUN
abc-4026	299	11	(	(	PUNCT
abc-4026	299	12	jurić	jurić	VERB
abc-4026	299	13	et	et	PROPN
abc-4026	299	14	al	al	PROPN
abc-4026	299	15	.	.	PROPN
abc-4026	299	16	2009	2009	NUM
abc-4026	299	17	,	,	PUNCT
abc-4026	299	18	vojta	vojta	NOUN
abc-4026	299	19	et	et	PROPN
abc-4026	299	20	al	al	PROPN
abc-4026	299	21	.	.	PROPN
abc-4026	299	22	2018	2018	NUM
abc-4026	299	23	)	)	PUNCT
abc-4026	299	24	,	,	PUNCT
abc-4026	299	25	these	these	DET
abc-4026	299	26	experiments	experiment	NOUN
abc-4026	299	27	confirmed	confirm	VERB
abc-4026	299	28	that	that	SCONJ
abc-4026	299	29	in	in	ADP
abc-4026	299	30	the	the	DET
abc-4026	299	31	trol	trol	NOUN
abc-4026	299	32	-	-	PUNCT
abc-4026	299	33	ie8	ie8	NOUN
abc-4026	299	34	and	and	CCONJ
abc-4026	299	35	trol	trol	NOUN
abc-4026	299	36	-	-	PUNCT
abc-4026	299	37	ie18	ie18	PROPN
abc-4026	299	38	arabidopsis	arabidopsis	NOUN
abc-4026	299	39	lines	line	NOUN
abc-4026	299	40	trol	trol	NOUN
abc-4026	299	41	is	be	AUX
abc-4026	299	42	located	locate	VERB
abc-4026	299	43	almost	almost	ADV
abc-4026	299	44	exclusively	exclusively	ADV
abc-4026	299	45	in	in	ADP
abc-4026	299	46	the	the	DET
abc-4026	299	47	inner	inner	ADJ
abc-4026	299	48	envelope	envelope	NOUN
abc-4026	299	49	membrane	membrane	NOUN
abc-4026	299	50	,	,	PUNCT
abc-4026	299	51	and	and	CCONJ
abc-4026	299	52	that	that	SCONJ
abc-4026	299	53	the	the	DET
abc-4026	299	54	affinity	affinity	NOUN
abc-4026	299	55	purified	purify	VERB
abc-4026	299	56	anti	anti	ADJ
abc-4026	299	57	-	-	ADJ
abc-4026	299	58	pretrol	pretrol	ADJ
abc-4026	299	59	antiserum	antiserum	NOUN
abc-4026	299	60	can	can	AUX
abc-4026	299	61	be	be	AUX
abc-4026	299	62	further	far	ADV
abc-4026	299	63	used	use	VERB
abc-4026	299	64	to	to	PART
abc-4026	299	65	exclusively	exclusively	ADV
abc-4026	299	66	detect	detect	VERB
abc-4026	299	67	the	the	DET
abc-4026	299	68	inner	inner	ADJ
abc-4026	299	69	envelope	envelope	NOUN
abc-4026	299	70	form	form	NOUN
abc-4026	299	71	of	of	ADP
abc-4026	299	72	trol	trol	NOUN
abc-4026	299	73	.	.	PUNCT
abc-4026	300	1	by	by	ADP
abc-4026	300	2	these	these	DET
abc-4026	300	3	experiments	experiment	NOUN
abc-4026	300	4	we	we	PRON
abc-4026	300	5	provided	provide	VERB
abc-4026	300	6	the	the	DET
abc-4026	300	7	tool	tool	NOUN
abc-4026	300	8	to	to	PART
abc-4026	300	9	investigate	investigate	VERB
abc-4026	300	10	trol	trol	NOUN
abc-4026	300	11	in	in	ADP
abc-4026	300	12	the	the	DET
abc-4026	300	13	inner	inner	ADJ
abc-4026	300	14	envelope	envelope	NOUN
abc-4026	300	15	membrane	membrane	NOUN
abc-4026	300	16	of	of	ADP
abc-4026	300	17	chloroplasts	chloroplast	NOUN
abc-4026	300	18	:	:	PUNCT
abc-4026	300	19	its	its	PRON
abc-4026	300	20	role	role	NOUN
abc-4026	300	21	in	in	ADP
abc-4026	300	22	organelle	organelle	NOUN
abc-4026	300	23	metabolism	metabolism	NOUN
abc-4026	300	24	and	and	CCONJ
abc-4026	300	25	energetics	energetic	NOUN
abc-4026	300	26	,	,	PUNCT
abc-4026	300	27	abiotic	abiotic	ADJ
abc-4026	300	28	stress	stress	NOUN
abc-4026	300	29	response	response	NOUN
abc-4026	300	30	,	,	PUNCT
abc-4026	300	31	its	its	PRON
abc-4026	300	32	interaction	interaction	NOUN
abc-4026	300	33	partners	partner	NOUN
abc-4026	300	34	,	,	PUNCT
abc-4026	300	35	and	and	CCONJ
abc-4026	300	36	finally	finally	ADV
abc-4026	300	37	,	,	PUNCT
abc-4026	300	38	its	its	PRON
abc-4026	300	39	possible	possible	ADJ
abc-4026	300	40	role	role	NOUN
abc-4026	300	41	in	in	ADP
abc-4026	300	42	electron	electron	NOUN
abc-4026	300	43	transfer	transfer	NOUN
abc-4026	300	44	at	at	ADP
abc-4026	300	45	the	the	DET
abc-4026	300	46	level	level	NOUN
abc-4026	300	47	of	of	ADP
abc-4026	300	48	the	the	DET
abc-4026	300	49	ie	ie	X
abc-4026	300	50	.	.	PUNCT
abc-4026	300	51	acknowledgements	acknowledgement	NOUN
abc-4026	300	52	this	this	DET
abc-4026	300	53	paper	paper	NOUN
abc-4026	300	54	was	be	AUX
abc-4026	300	55	published	publish	VERB
abc-4026	300	56	on	on	ADP
abc-4026	300	57	the	the	DET
abc-4026	300	58	occasion	occasion	NOUN
abc-4026	300	59	of	of	ADP
abc-4026	300	60	the	the	DET
abc-4026	300	61	100th	100th	ADJ
abc-4026	300	62	anniversary	anniversary	NOUN
abc-4026	300	63	of	of	ADP
abc-4026	300	64	acta	acta	PROPN
abc-4026	300	65	botanica	botanica	PROPN
abc-4026	300	66	croatica	croatica	PROPN
abc-4026	300	67	.	.	PUNCT
abc-4026	301	1	this	this	DET
abc-4026	301	2	work	work	NOUN
abc-4026	301	3	has	have	AUX
abc-4026	301	4	been	be	AUX
abc-4026	301	5	funded	fund	VERB
abc-4026	301	6	by	by	ADP
abc-4026	301	7	the	the	DET
abc-4026	301	8	icgeb	icgeb	NOUN
abc-4026	301	9	grant	grant	NOUN
abc-4026	301	10	crp/	crp/	PROPN
abc-4026	301	11	hrv20	hrv20	PROPN
abc-4026	301	12	-	-	PUNCT
abc-4026	301	13	03	03	NUM
abc-4026	301	14	to	to	ADP
abc-4026	301	15	l.	l.	PROPN
abc-4026	301	16	v.	v.	PROPN
abc-4026	301	17	author	author	PROPN
abc-4026	301	18	contribution	contribution	NOUN
abc-4026	301	19	statement	statement	NOUN
abc-4026	301	20	l.	l.	PROPN
abc-4026	301	21	v.	v.	CCONJ
abc-4026	301	22	devised	devise	VERB
abc-4026	301	23	the	the	DET
abc-4026	301	24	research	research	NOUN
abc-4026	301	25	concept	concept	NOUN
abc-4026	301	26	,	,	PUNCT
abc-4026	301	27	acquired	acquire	VERB
abc-4026	301	28	funding	funding	NOUN
abc-4026	301	29	,	,	PUNCT
abc-4026	301	30	designed	design	VERB
abc-4026	301	31	,	,	PUNCT
abc-4026	301	32	and	and	CCONJ
abc-4026	301	33	performed	perform	VERB
abc-4026	301	34	all	all	DET
abc-4026	301	35	experiments	experiment	NOUN
abc-4026	301	36	except	except	SCONJ
abc-4026	301	37	the	the	DET
abc-4026	301	38	floral	floral	ADJ
abc-4026	301	39	dip	dip	NOUN
abc-4026	301	40	transformation	transformation	NOUN
abc-4026	301	41	,	,	PUNCT
abc-4026	301	42	analyzed	analyze	VERB
abc-4026	301	43	results	result	NOUN
abc-4026	301	44	,	,	PUNCT
abc-4026	301	45	and	and	CCONJ
abc-4026	301	46	wrote	write	VERB
abc-4026	301	47	the	the	DET
abc-4026	301	48	manuscript	manuscript	NOUN
abc-4026	301	49	.	.	PUNCT
abc-4026	302	1	h.	h.	PROPN
abc-4026	302	2	f.	f.	PROPN
abc-4026	302	3	co	co	VERB
abc-4026	302	4	-	-	VERB
abc-4026	302	5	designed	design	VERB
abc-4026	302	6	experiments	experiment	NOUN
abc-4026	302	7	and	and	CCONJ
abc-4026	302	8	discussed	discuss	VERB
abc-4026	302	9	results	result	NOUN
abc-4026	302	10	.	.	PUNCT
abc-4026	303	1	a.	a.	NOUN
abc-4026	303	2	t.	t.	PROPN
abc-4026	303	3	p.	p.	PROPN
abc-4026	303	4	performed	perform	VERB
abc-4026	303	5	floral	floral	ADJ
abc-4026	303	6	dip	dip	NOUN
abc-4026	303	7	transformation	transformation	NOUN
abc-4026	303	8	.	.	PUNCT
abc-4026	304	1	e.	e.	PROPN
abc-4026	304	2	d.	d.	PROPN
abc-4026	304	3	grew	grow	VERB
abc-4026	304	4	experimental	experimental	ADJ
abc-4026	304	5	plants	plant	NOUN
abc-4026	304	6	.	.	PUNCT
abc-4026	305	1	all	all	DET
abc-4026	305	2	authors	author	NOUN
abc-4026	305	3	reviewed	review	VERB
abc-4026	305	4	the	the	DET
abc-4026	305	5	paper	paper	NOUN
abc-4026	305	6	and	and	CCONJ
abc-4026	305	7	agreed	agree	VERB
abc-4026	305	8	to	to	ADP
abc-4026	305	9	the	the	DET
abc-4026	305	10	published	publish	VERB
abc-4026	305	11	version	version	NOUN
abc-4026	305	12	of	of	ADP
abc-4026	305	13	the	the	DET
abc-4026	305	14	manuscript	manuscript	NOUN
abc-4026	305	15	.	.	PUNCT
abc-4026	306	1	references	reference	NOUN
abc-4026	306	2	allen	allen	PROPN
abc-4026	306	3	,	,	PUNCT
abc-4026	306	4	j.	j.	PROPN
abc-4026	306	5	f.	f.	PROPN
abc-4026	306	6	,	,	PUNCT
abc-4026	306	7	2003	2003	NUM
abc-4026	306	8	:	:	PUNCT
abc-4026	307	1	cyclic	cyclic	ADJ
abc-4026	307	2	,	,	PUNCT
abc-4026	307	3	pseudocyclic	pseudocyclic	NOUN
abc-4026	307	4	and	and	CCONJ
abc-4026	307	5	noncyclic	noncyclic	ADJ
abc-4026	307	6	photophosphorylation	photophosphorylation	NOUN
abc-4026	307	7	:	:	PUNCT
abc-4026	307	8	new	new	ADJ
abc-4026	307	9	links	link	NOUN
abc-4026	307	10	in	in	ADP
abc-4026	307	11	the	the	DET
abc-4026	307	12	chain	chain	NOUN
abc-4026	307	13	.	.	PUNCT
abc-4026	308	1	trends	trend	NOUN
abc-4026	308	2	in	in	ADP
abc-4026	308	3	plant	plant	NOUN
abc-4026	308	4	science	science	NOUN
abc-4026	308	5	8(1	8(1	NOUN
abc-4026	308	6	)	)	PUNCT
abc-4026	308	7	,	,	PUNCT
abc-4026	308	8	15–19	15–19	NUM
abc-4026	308	9	.	.	PUNCT
abc-4026	309	1	https://doi.org/10.1016/s1360-1385(02)00006-7	https://doi.org/10.1016/s1360-1385(02)00006-7	PROPN
abc-4026	309	2	benz	benz	PROPN
abc-4026	309	3	,	,	PUNCT
abc-4026	309	4	j.	j.	PROPN
abc-4026	309	5	p.	p.	PROPN
abc-4026	309	6	,	,	PUNCT
abc-4026	309	7	lintala	lintala	NOUN
abc-4026	309	8	,	,	PUNCT
abc-4026	309	9	m.	m.	NOUN
abc-4026	309	10	,	,	PUNCT
abc-4026	309	11	soll	soll	PROPN
abc-4026	309	12	,	,	PUNCT
abc-4026	309	13	j.	j.	PROPN
abc-4026	309	14	,	,	PUNCT
abc-4026	309	15	mulo	mulo	NOUN
abc-4026	309	16	,	,	PUNCT
abc-4026	309	17	p.	p.	NOUN
abc-4026	309	18	,	,	PUNCT
abc-4026	309	19	bölter	bölter	ADV
abc-4026	309	20	,	,	PUNCT
abc-4026	309	21	b.	b.	PROPN
abc-4026	309	22	,	,	PUNCT
abc-4026	309	23	2010	2010	NUM
abc-4026	309	24	:	:	PUNCT
abc-4026	309	25	a	a	DET
abc-4026	309	26	new	new	ADJ
abc-4026	309	27	concept	concept	NOUN
abc-4026	309	28	for	for	ADP
abc-4026	309	29	ferredoxin	ferredoxin	NOUN
abc-4026	309	30	-	-	PUNCT
abc-4026	309	31	nadp(h	nadp(h	NOUN
abc-4026	309	32	)	)	PUNCT
abc-4026	309	33	oxidoreductase	oxidoreductase	NOUN
abc-4026	309	34	binding	bind	VERB
abc-4026	309	35	to	to	PART
abc-4026	309	36	plant	plant	NOUN
abc-4026	309	37	thylakoids	thylakoid	NOUN
abc-4026	309	38	.	.	PUNCT
abc-4026	310	1	trends	trend	NOUN
abc-4026	310	2	in	in	ADP
abc-4026	310	3	plant	plant	NOUN
abc-4026	310	4	science	science	NOUN
abc-4026	310	5	15(11	15(11	NUM
abc-4026	310	6	)	)	PUNCT
abc-4026	310	7	,	,	PUNCT
abc-4026	310	8	608–613	608–613	NUM
abc-4026	310	9	.	.	PUNCT
abc-4026	310	10	https://doi.org/10.1016/j.tplants.2010.08.008	https://doi.org/10.1016/j.tplants.2010.08.008	PROPN
abc-4026	310	11	buchanan	buchanan	PROPN
abc-4026	310	12	,	,	PUNCT
abc-4026	310	13	b.	b.	PROPN
abc-4026	310	14	b.	b.	PROPN
abc-4026	310	15	,	,	PUNCT
abc-4026	310	16	balmer	balmer	PROPN
abc-4026	310	17	,	,	PUNCT
abc-4026	310	18	y.	y.	NOUN
abc-4026	310	19	,	,	PUNCT
abc-4026	310	20	2005	2005	NUM
abc-4026	310	21	:	:	PUNCT
abc-4026	310	22	redox	redox	ADJ
abc-4026	310	23	regulation	regulation	NOUN
abc-4026	310	24	:	:	PUNCT
abc-4026	310	25	a	a	DET
abc-4026	310	26	broadening	broaden	VERB
abc-4026	310	27	horizon	horizon	NOUN
abc-4026	310	28	.	.	PUNCT
abc-4026	311	1	annual	annual	ADJ
abc-4026	311	2	review	review	NOUN
abc-4026	311	3	of	of	ADP
abc-4026	311	4	plant	plant	NOUN
abc-4026	311	5	biology	biology	NOUN
abc-4026	311	6	56	56	NUM
abc-4026	311	7	,	,	PUNCT
abc-4026	311	8	187–220	187–220	NUM
abc-4026	311	9	.	.	PUNCT
abc-4026	312	1	https://	https://	PROPN
abc-4026	312	2	doi.org/10.1146/annurev.arplant.56.032604.144246	doi.org/10.1146/annurev.arplant.56.032604.144246	PROPN
abc-4026	312	3	cline	cline	PROPN
abc-4026	312	4	,	,	PUNCT
abc-4026	312	5	k.	k.	PROPN
abc-4026	312	6	,	,	PUNCT
abc-4026	312	7	henry	henry	PROPN
abc-4026	312	8	,	,	PUNCT
abc-4026	312	9	r.	r.	PROPN
abc-4026	312	10	,	,	PUNCT
abc-4026	312	11	1996	1996	NUM
abc-4026	312	12	:	:	PUNCT
abc-4026	312	13	import	import	NOUN
abc-4026	312	14	and	and	CCONJ
abc-4026	312	15	routing	routing	NOUN
abc-4026	312	16	of	of	ADP
abc-4026	312	17	nucleus	nucleus	NOUN
abc-4026	312	18	-	-	PUNCT
abc-4026	312	19	encoded	encode	VERB
abc-4026	312	20	chloroplast	chloroplast	NOUN
abc-4026	312	21	proteins	protein	NOUN
abc-4026	312	22	.	.	PUNCT
abc-4026	313	1	annual	annual	ADJ
abc-4026	313	2	review	review	NOUN
abc-4026	313	3	of	of	ADP
abc-4026	313	4	cell	cell	NOUN
abc-4026	313	5	and	and	CCONJ
abc-4026	313	6	developmental	developmental	ADJ
abc-4026	313	7	biology	biology	NOUN
abc-4026	313	8	12	12	NUM
abc-4026	313	9	,	,	PUNCT
abc-4026	313	10	1–26	1–26	NOUN
abc-4026	313	11	.	.	PUNCT
abc-4026	314	1	https://doi.org/10.1146/annurev.cellbio.12.1.1	https://doi.org/10.1146/annurev.cellbio.12.1.1	ADP
abc-4026	314	2	clough	clough	PROPN
abc-4026	314	3	,	,	PUNCT
abc-4026	314	4	s.	s.	PROPN
abc-4026	314	5	j.	j.	PROPN
abc-4026	314	6	,	,	PUNCT
abc-4026	314	7	bent	bent	ADJ
abc-4026	314	8	,	,	PUNCT
abc-4026	314	9	a.	a.	PROPN
abc-4026	314	10	f.	f.	PROPN
abc-4026	314	11	,	,	PUNCT
abc-4026	314	12	1998	1998	NUM
abc-4026	314	13	:	:	PUNCT
abc-4026	314	14	floral	floral	ADJ
abc-4026	314	15	dip	dip	NOUN
abc-4026	314	16	:	:	PUNCT
abc-4026	314	17	a	a	DET
abc-4026	314	18	simplified	simplified	ADJ
abc-4026	314	19	method	method	NOUN
abc-4026	314	20	for	for	ADP
abc-4026	314	21	agrobacterium	agrobacterium	NOUN
abc-4026	314	22	-	-	PUNCT
abc-4026	314	23	mediated	mediate	VERB
abc-4026	314	24	transformation	transformation	NOUN
abc-4026	314	25	of	of	ADP
abc-4026	314	26	arabidopsis	arabidopsis	NOUN
abc-4026	314	27	thaliana	thaliana	NOUN
abc-4026	314	28	.	.	PUNCT
abc-4026	315	1	the	the	DET
abc-4026	315	2	plant	plant	NOUN
abc-4026	315	3	journal	journal	NOUN
abc-4026	315	4	16(6	16(6	NUM
abc-4026	315	5	)	)	PUNCT
abc-4026	315	6	,	,	PUNCT
abc-4026	315	7	735–743	735–743	NUM
abc-4026	315	8	.	.	PUNCT
abc-4026	316	1	https://doi	https://doi	PROPN
abc-4026	316	2	.	.	PUNCT
abc-4026	316	3	org/10.1046	org/10.1046	NOUN
abc-4026	316	4	/	/	SYM
abc-4026	316	5	j.1365	j.1365	NOUN
abc-4026	316	6	-	-	PUNCT
abc-4026	316	7	313x.1998.00343.x	313x.1998.00343.x	NUM
abc-4026	316	8	fulgosi	fulgosi	NOUN
abc-4026	316	9	,	,	PUNCT
abc-4026	316	10	h.	h.	PROPN
abc-4026	316	11	,	,	PUNCT
abc-4026	316	12	vojta	vojta	PROPN
abc-4026	316	13	,	,	PUNCT
abc-4026	316	14	l.	l.	PROPN
abc-4026	316	15	,	,	PUNCT
abc-4026	316	16	2020	2020	NUM
abc-4026	316	17	:	:	PUNCT
abc-4026	316	18	tweaking	tweak	VERB
abc-4026	316	19	photosynthesis	photosynthesis	NOUN
abc-4026	316	20	:	:	PUNCT
abc-4026	316	21	fnr	fnr	NOUN
abc-4026	316	22	-	-	PUNCT
abc-4026	316	23	trol	trol	NOUN
abc-4026	316	24	interaction	interaction	NOUN
abc-4026	316	25	as	as	ADP
abc-4026	316	26	potential	potential	ADJ
abc-4026	316	27	target	target	NOUN
abc-4026	316	28	for	for	ADP
abc-4026	316	29	crop	crop	NOUN
abc-4026	316	30	fortification	fortification	NOUN
abc-4026	316	31	.	.	PUNCT
abc-4026	317	1	frontiers	frontier	NOUN
abc-4026	317	2	in	in	ADP
abc-4026	317	3	plant	plant	NOUN
abc-4026	317	4	science	science	NOUN
abc-4026	317	5	11	11	NUM
abc-4026	317	6	,	,	PUNCT
abc-4026	317	7	318	318	NUM
abc-4026	317	8	.	.	PUNCT
abc-4026	318	1	https://doi.org/10.3389/fpls.2020.00318	https://doi.org/10.3389/fpls.2020.00318	PROPN
abc-4026	318	2	garcia	garcia	PROPN
abc-4026	318	3	,	,	PUNCT
abc-4026	318	4	c.	c.	PROPN
abc-4026	318	5	,	,	PUNCT
abc-4026	318	6	khan	khan	PROPN
abc-4026	318	7	,	,	PUNCT
abc-4026	318	8	n.	n.	PROPN
abc-4026	318	9	z.	z.	PROPN
abc-4026	318	10	,	,	PUNCT
abc-4026	318	11	nannmark	nannmark	PROPN
abc-4026	318	12	,	,	PUNCT
abc-4026	318	13	u.	u.	PROPN
abc-4026	318	14	,	,	PUNCT
abc-4026	318	15	aronsson	aronsson	PROPN
abc-4026	318	16	,	,	PUNCT
abc-4026	318	17	h.	h.	PROPN
abc-4026	318	18	,	,	PUNCT
abc-4026	318	19	2010	2010	NUM
abc-4026	318	20	:	:	PUNCT
abc-4026	318	21	the	the	DET
abc-4026	318	22	chloroplast	chloroplast	ADJ
abc-4026	318	23	protein	protein	NOUN
abc-4026	318	24	cpsar1	cpsar1	PROPN
abc-4026	318	25	,	,	PUNCT
abc-4026	318	26	dually	dually	ADV
abc-4026	318	27	localized	localize	VERB
abc-4026	318	28	in	in	ADP
abc-4026	318	29	the	the	DET
abc-4026	318	30	stroma	stroma	NOUN
abc-4026	318	31	and	and	CCONJ
abc-4026	318	32	the	the	DET
abc-4026	318	33	inner	inner	ADJ
abc-4026	318	34	envelope	envelope	NOUN
abc-4026	318	35	membrane	membrane	NOUN
abc-4026	318	36	,	,	PUNCT
abc-4026	318	37	is	be	AUX
abc-4026	318	38	involved	involve	VERB
abc-4026	318	39	in	in	ADP
abc-4026	318	40	thylakoid	thylakoid	ADJ
abc-4026	318	41	biogenesis	biogenesis	NOUN
abc-4026	318	42	.	.	PUNCT
abc-4026	319	1	the	the	DET
abc-4026	319	2	plant	plant	NOUN
abc-4026	319	3	journal	journal	NOUN
abc-4026	319	4	63(1	63(1	PROPN
abc-4026	319	5	)	)	PUNCT
abc-4026	319	6	,	,	PUNCT
abc-4026	319	7	73–85	73–85	PROPN
abc-4026	319	8	.	.	PUNCT
abc-4026	320	1	https://doi	https://doi	PROPN
abc-4026	320	2	.	.	PUNCT
abc-4026	320	3	org/10.1111	org/10.1111	PROPN
abc-4026	320	4	/	/	SYM
abc-4026	320	5	j.1365	j.1365	NOUN
abc-4026	320	6	-	-	PUNCT
abc-4026	320	7	313x.2010.04225.x	313x.2010.04225.x	NUM
abc-4026	320	8	hanke	hanke	NOUN
abc-4026	320	9	,	,	PUNCT
abc-4026	320	10	g.	g.	PROPN
abc-4026	320	11	,	,	PUNCT
abc-4026	320	12	mulo	mulo	NOUN
abc-4026	320	13	,	,	PUNCT
abc-4026	320	14	p.	p.	NOUN
abc-4026	320	15	,	,	PUNCT
abc-4026	320	16	2013	2013	NUM
abc-4026	320	17	:	:	PUNCT
abc-4026	320	18	plant	plant	NOUN
abc-4026	320	19	type	type	NOUN
abc-4026	320	20	ferredoxins	ferredoxin	NOUN
abc-4026	320	21	and	and	CCONJ
abc-4026	320	22	ferredoxin	ferredoxin	ADJ
abc-4026	320	23	-	-	PUNCT
abc-4026	320	24	dependent	dependent	ADJ
abc-4026	320	25	metabolism	metabolism	NOUN
abc-4026	320	26	.	.	PUNCT
abc-4026	321	1	plant	plant	NOUN
abc-4026	321	2	,	,	PUNCT
abc-4026	321	3	cell	cell	NOUN
abc-4026	321	4	&	&	CCONJ
abc-4026	321	5	environment	environment	NOUN
abc-4026	321	6	.	.	PUNCT
abc-4026	322	1	36(6	36(6	NUM
abc-4026	322	2	)	)	PUNCT
abc-4026	322	3	,	,	PUNCT
abc-4026	322	4	1071–1084	1071–1084	NOUN
abc-4026	322	5	.	.	PUNCT
abc-4026	323	1	https://doi.org/10.1111/pce.12046	https://doi.org/10.1111/pce.12046	NOUN
abc-4026	323	2	joliot	joliot	NOUN
abc-4026	323	3	,	,	PUNCT
abc-4026	323	4	p.	p.	NOUN
abc-4026	323	5	,	,	PUNCT
abc-4026	323	6	joliot	joliot	NOUN
abc-4026	323	7	,	,	PUNCT
abc-4026	323	8	a.	a.	NOUN
abc-4026	323	9	,	,	PUNCT
abc-4026	323	10	2006	2006	NUM
abc-4026	323	11	:	:	PUNCT
abc-4026	323	12	cyclic	cyclic	ADJ
abc-4026	323	13	electron	electron	NOUN
abc-4026	323	14	flow	flow	NOUN
abc-4026	323	15	in	in	ADP
abc-4026	323	16	c3	c3	PROPN
abc-4026	323	17	plants	plant	NOUN
abc-4026	323	18	.	.	PUNCT
abc-4026	324	1	biochimica	biochimica	PROPN
abc-4026	324	2	et	et	PROPN
abc-4026	324	3	biophysica	biophysica	PROPN
abc-4026	324	4	acta	acta	PROPN
abc-4026	324	5	1757(5–6	1757(5–6	PROPN
abc-4026	324	6	)	)	PUNCT
abc-4026	324	7	,	,	PUNCT
abc-4026	324	8	362–368	362–368	NUM
abc-4026	324	9	.	.	PUNCT
abc-4026	325	1	https://doi	https://doi	X
abc-4026	325	2	.	.	PUNCT
abc-4026	326	1	org/10.1016	org/10.1016	PROPN
abc-4026	326	2	/	/	SYM
abc-4026	326	3	j.bbabio.2006.02.018	j.bbabio.2006.02.018	ADV
abc-4026	326	4	jurić	jurić	PROPN
abc-4026	326	5	,	,	PUNCT
abc-4026	326	6	s.	s.	PROPN
abc-4026	326	7	,	,	PUNCT
abc-4026	326	8	hazler	hazler	NOUN
abc-4026	326	9	-	-	PUNCT
abc-4026	326	10	pilepić	pilepić	NOUN
abc-4026	326	11	,	,	PUNCT
abc-4026	326	12	k.	k.	PROPN
abc-4026	326	13	,	,	PUNCT
abc-4026	326	14	tomašić	tomašić	PROPN
abc-4026	326	15	,	,	PUNCT
abc-4026	326	16	a.	a.	NOUN
abc-4026	326	17	,	,	PUNCT
abc-4026	326	18	lepeduš	lepeduš	PROPN
abc-4026	326	19	,	,	PUNCT
abc-4026	326	20	h.	h.	PROPN
abc-4026	326	21	,	,	PUNCT
abc-4026	326	22	jeličić	jeličić	PROPN
abc-4026	326	23	,	,	PUNCT
abc-4026	326	24	b.	b.	PROPN
abc-4026	326	25	,	,	PUNCT
abc-4026	326	26	puthiyaveetil	puthiyaveetil	PROPN
abc-4026	326	27	,	,	PUNCT
abc-4026	326	28	s.	s.	PROPN
abc-4026	326	29	,	,	PUNCT
abc-4026	326	30	bionda	bionda	NOUN
abc-4026	326	31	,	,	PUNCT
abc-4026	326	32	t.	t.	PROPN
abc-4026	326	33	,	,	PUNCT
abc-4026	326	34	vojta	vojta	PROPN
abc-4026	326	35	,	,	PUNCT
abc-4026	326	36	l.	l.	PROPN
abc-4026	326	37	,	,	PUNCT
abc-4026	326	38	allen	allen	PROPN
abc-4026	326	39	,	,	PUNCT
abc-4026	326	40	j.	j.	PROPN
abc-4026	326	41	f.	f.	PROPN
abc-4026	326	42	,	,	PUNCT
abc-4026	326	43	schleiff	schleiff	PROPN
abc-4026	326	44	,	,	PUNCT
abc-4026	326	45	e.	e.	PROPN
abc-4026	326	46	,	,	PUNCT
abc-4026	326	47	fulgosi	fulgosi	PROPN
abc-4026	326	48	,	,	PUNCT
abc-4026	326	49	h.	h.	PROPN
abc-4026	326	50	,	,	PUNCT
abc-4026	326	51	2009	2009	NUM
abc-4026	326	52	:	:	PUNCT
abc-4026	326	53	tethering	tethering	NOUN
abc-4026	326	54	of	of	ADP
abc-4026	326	55	ferredoxin	ferredoxin	PROPN
abc-4026	326	56	:	:	PUNCT
abc-4026	326	57	nadp+	nadp+	NOUN
abc-4026	326	58	oxidoreductase	oxidoreductase	NOUN
abc-4026	326	59	to	to	ADP
abc-4026	326	60	thylakoid	thylakoid	ADJ
abc-4026	326	61	membranes	membrane	NOUN
abc-4026	326	62	is	be	AUX
abc-4026	326	63	mediated	mediate	VERB
abc-4026	326	64	by	by	ADP
abc-4026	326	65	novel	novel	ADJ
abc-4026	326	66	chloroplast	chloroplast	NOUN
abc-4026	326	67	protein	protein	NOUN
abc-4026	326	68	trol	trol	NOUN
abc-4026	326	69	.	.	PUNCT
abc-4026	327	1	the	the	DET
abc-4026	327	2	plant	plant	NOUN
abc-4026	327	3	journal	journal	NOUN
abc-4026	327	4	60(5	60(5	NOUN
abc-4026	327	5	)	)	PUNCT
abc-4026	327	6	,	,	PUNCT
abc-4026	327	7	783–794	783–794	NUM
abc-4026	327	8	.	.	PUNCT
abc-4026	328	1	https://doi	https://doi	PROPN
abc-4026	328	2	.	.	PUNCT
abc-4026	328	3	org/10.1111	org/10.1111	PROPN
abc-4026	328	4	/	/	SYM
abc-4026	328	5	j.1365	j.1365	NOUN
abc-4026	328	6	-	-	PUNCT
abc-4026	328	7	313x.2009.03999.x	313x.2009.03999.x	PROPN
abc-4026	328	8	jurić	jurić	NOUN
abc-4026	328	9	,	,	PUNCT
abc-4026	328	10	s.	s.	PROPN
abc-4026	328	11	,	,	PUNCT
abc-4026	328	12	vojta	vojta	PROPN
abc-4026	328	13	,	,	PUNCT
abc-4026	328	14	l.	l.	PROPN
abc-4026	328	15	,	,	PUNCT
abc-4026	328	16	fulgosi	fulgosi	PROPN
abc-4026	328	17	,	,	PUNCT
abc-4026	328	18	h.	h.	PROPN
abc-4026	328	19	,	,	PUNCT
abc-4026	328	20	2013	2013	NUM
abc-4026	328	21	:	:	PUNCT
abc-4026	328	22	electron	electron	NOUN
abc-4026	328	23	transfer	transfer	NOUN
abc-4026	328	24	routes	route	NOUN
abc-4026	328	25	in	in	ADP
abc-4026	328	26	oxygenic	oxygenic	ADJ
abc-4026	328	27	photosynthesis	photosynthesis	NOUN
abc-4026	328	28	:	:	PUNCT
abc-4026	328	29	regulatory	regulatory	ADJ
abc-4026	328	30	mechanisms	mechanism	NOUN
abc-4026	328	31	and	and	CCONJ
abc-4026	328	32	new	new	ADJ
abc-4026	328	33	perspectives	perspective	NOUN
abc-4026	328	34	.	.	PUNCT
abc-4026	329	1	photosynthesis	photosynthesis	NOUN
abc-4026	329	2	,	,	PUNCT
abc-4026	329	3	23	23	NUM
abc-4026	329	4	-	-	SYM
abc-4026	329	5	46	46	NUM
abc-4026	329	6	.	.	PUNCT
abc-4026	330	1	intech	intech	PROPN
abc-4026	330	2	,	,	PUNCT
abc-4026	330	3	rijeka	rijeka	PROPN
abc-4026	330	4	.	.	PUNCT
abc-4026	331	1	kekić	kekić	PROPN
abc-4026	331	2	,	,	PUNCT
abc-4026	331	3	t.	t.	PROPN
abc-4026	331	4	,	,	PUNCT
abc-4026	331	5	fulgosi	fulgosi	PROPN
abc-4026	331	6	,	,	PUNCT
abc-4026	331	7	h.	h.	PROPN
abc-4026	331	8	,	,	PUNCT
abc-4026	331	9	vojta	vojta	PROPN
abc-4026	331	10	,	,	PUNCT
abc-4026	331	11	l.	l.	PROPN
abc-4026	331	12	,	,	PUNCT
abc-4026	331	13	bertoša	bertoša	NOUN
abc-4026	331	14	,	,	PUNCT
abc-4026	331	15	b.	b.	PROPN
abc-4026	331	16	,	,	PUNCT
abc-4026	331	17	2020	2020	NUM
abc-4026	331	18	:	:	PUNCT
abc-4026	331	19	molecular	molecular	ADJ
abc-4026	331	20	basis	basis	NOUN
abc-4026	331	21	of	of	ADP
abc-4026	331	22	ferredoxin	ferredoxin	NOUN
abc-4026	331	23	:	:	PUNCT
abc-4026	331	24	nadp(+	nadp(+	ADJ
abc-4026	331	25	)	)	PUNCT
abc-4026	331	26	reductase	reductase	NOUN
abc-4026	331	27	interactions	interaction	NOUN
abc-4026	331	28	with	with	ADP
abc-4026	331	29	fnr	fnr	NOUN
abc-4026	331	30	binding	bind	VERB
abc-4026	331	31	domains	domain	NOUN
abc-4026	331	32	from	from	ADP
abc-4026	331	33	trol	trol	NOUN
abc-4026	331	34	and	and	CCONJ
abc-4026	331	35	tic62	tic62	PROPN
abc-4026	331	36	proteins	protein	NOUN
abc-4026	331	37	.	.	PUNCT
abc-4026	332	1	journal	journal	NOUN
abc-4026	332	2	of	of	ADP
abc-4026	332	3	https://onlinelibrary.wiley.com/authored-by/garcia/christel	https://onlinelibrary.wiley.com/authored-by/garcia/christel	PROPN
abc-4026	332	4	https://onlinelibrary.wiley.com/authored-by/nannmark/ulf	https://onlinelibrary.wiley.com/authored-by/nannmark/ulf	PROPN
abc-4026	332	5	https://onlinelibrary.wiley.com/authored-by/aronsson/henrik	https://onlinelibrary.wiley.com/authored-by/aronsson/henrik	PROPN
abc-4026	332	6	dual	dual	ADJ
abc-4026	332	7	to	to	ADP
abc-4026	332	8	single	single	ADJ
abc-4026	332	9	localization	localization	NOUN
abc-4026	332	10	exchange	exchange	NOUN
abc-4026	332	11	of	of	ADP
abc-4026	332	12	trol	trol	NOUN
abc-4026	332	13	protein	protein	NOUN
abc-4026	332	14	acta	acta	PROPN
abc-4026	332	15	bot	bot	PROPN
abc-4026	332	16	.	.	PUNCT
abc-4026	333	1	croat	croat	PROPN
abc-4026	333	2	.	.	PUNCT
abc-4026	334	1	84	84	NUM
abc-4026	334	2	(	(	PUNCT
abc-4026	334	3	2	2	NUM
abc-4026	334	4	)	)	PUNCT
abc-4026	334	5	,	,	PUNCT
abc-4026	334	6	2025	2025	NUM
abc-4026	334	7	265	265	NUM
abc-4026	334	8	molecular	molecular	ADJ
abc-4026	334	9	structure	structure	NOUN
abc-4026	334	10	1215	1215	NUM
abc-4026	334	11	,	,	PUNCT
abc-4026	334	12	128281	128281	NUM
abc-4026	334	13	.	.	PUNCT
abc-4026	335	1	https://doi.org/10.1016/j	https://doi.org/10.1016/j	NOUN
abc-4026	335	2	.	.	PUNCT
abc-4026	336	1	molstruc.2020.128281	molstruc.2020.128281	PROPN
abc-4026	336	2	klasek	klasek	PROPN
abc-4026	336	3	,	,	PUNCT
abc-4026	336	4	l.	l.	PROPN
abc-4026	336	5	,	,	PUNCT
abc-4026	336	6	inoue	inoue	PROPN
abc-4026	336	7	,	,	PUNCT
abc-4026	336	8	k.	k.	PROPN
abc-4026	336	9	,	,	PUNCT
abc-4026	336	10	2016	2016	NUM
abc-4026	336	11	:	:	PUNCT
abc-4026	336	12	dual	dual	ADJ
abc-4026	336	13	protein	protein	NOUN
abc-4026	336	14	localization	localization	NOUN
abc-4026	336	15	to	to	ADP
abc-4026	336	16	the	the	DET
abc-4026	336	17	envelope	envelope	NOUN
abc-4026	336	18	and	and	CCONJ
abc-4026	336	19	thylakoid	thylakoid	ADJ
abc-4026	336	20	membranes	membrane	NOUN
abc-4026	336	21	within	within	ADP
abc-4026	336	22	the	the	DET
abc-4026	336	23	chloroplast	chloroplast	NOUN
abc-4026	336	24	.	.	PUNCT
abc-4026	337	1	international	international	ADJ
abc-4026	337	2	review	review	NOUN
abc-4026	337	3	of	of	ADP
abc-4026	337	4	cell	cell	NOUN
abc-4026	337	5	and	and	CCONJ
abc-4026	337	6	molecular	molecular	ADJ
abc-4026	337	7	biology	biology	NOUN
abc-4026	337	8	323	323	NUM
abc-4026	337	9	,	,	PUNCT
abc-4026	337	10	231–263	231–263	NUM
abc-4026	337	11	.	.	PUNCT
abc-4026	338	1	https://doi.org/10.1016/bs.ircmb.2015.12.008	https://doi.org/10.1016/bs.ircmb.2015.12.008	NOUN
abc-4026	338	2	küchler	küchler	NOUN
abc-4026	338	3	,	,	PUNCT
abc-4026	338	4	m.	m.	NOUN
abc-4026	338	5	,	,	PUNCT
abc-4026	338	6	decker	decker	PROPN
abc-4026	338	7	,	,	PUNCT
abc-4026	338	8	s.	s.	PROPN
abc-4026	338	9	,	,	PUNCT
abc-4026	338	10	hörmann	hörmann	PROPN
abc-4026	338	11	,	,	PUNCT
abc-4026	338	12	f.	f.	PROPN
abc-4026	338	13	,	,	PUNCT
abc-4026	338	14	soll	soll	PROPN
abc-4026	338	15	,	,	PUNCT
abc-4026	338	16	j.	j.	PROPN
abc-4026	338	17	,	,	PUNCT
abc-4026	338	18	heins	heins	PROPN
abc-4026	338	19	,	,	PUNCT
abc-4026	338	20	l.	l.	PROPN
abc-4026	338	21	,	,	PUNCT
abc-4026	338	22	2002	2002	NUM
abc-4026	338	23	:	:	PUNCT
abc-4026	338	24	protein	protein	NOUN
abc-4026	338	25	import	import	NOUN
abc-4026	338	26	into	into	ADP
abc-4026	338	27	chloroplasts	chloroplast	NOUN
abc-4026	338	28	involves	involve	VERB
abc-4026	338	29	redox	redox	ADJ
abc-4026	338	30	-	-	PUNCT
abc-4026	338	31	regulated	regulate	VERB
abc-4026	338	32	proteins	protein	NOUN
abc-4026	338	33	.	.	PUNCT
abc-4026	339	1	the	the	DET
abc-4026	339	2	embo	embo	PROPN
abc-4026	339	3	journal	journal	PROPN
abc-4026	339	4	21(22	21(22	NUM
abc-4026	339	5	)	)	PUNCT
abc-4026	339	6	,	,	PUNCT
abc-4026	339	7	6136–6145	6136–6145	NUM
abc-4026	339	8	.	.	PUNCT
abc-4026	340	1	https://doi	https://doi	NOUN
abc-4026	340	2	.	.	PUNCT
abc-4026	341	1	org/10.1093	org/10.1093	ADJ
abc-4026	341	2	/	/	SYM
abc-4026	341	3	emboj	emboj	NOUN
abc-4026	341	4	/	/	SYM
abc-4026	341	5	cdf621	cdf621	PROPN
abc-4026	341	6	laemmli	laemmli	NOUN
abc-4026	341	7	,	,	PUNCT
abc-4026	341	8	u.	u.	PROPN
abc-4026	341	9	k.	k.	PROPN
abc-4026	341	10	,	,	PUNCT
abc-4026	341	11	1970	1970	NUM
abc-4026	341	12	:	:	PUNCT
abc-4026	341	13	cleavage	cleavage	NOUN
abc-4026	341	14	of	of	ADP
abc-4026	341	15	structural	structural	ADJ
abc-4026	341	16	proteins	protein	NOUN
abc-4026	341	17	during	during	ADP
abc-4026	341	18	the	the	DET
abc-4026	341	19	assembly	assembly	NOUN
abc-4026	341	20	of	of	ADP
abc-4026	341	21	the	the	DET
abc-4026	341	22	head	head	NOUN
abc-4026	341	23	of	of	ADP
abc-4026	341	24	bacteriophage	bacteriophage	PROPN
abc-4026	341	25	t4	t4	PROPN
abc-4026	341	26	.	.	PUNCT
abc-4026	341	27	nature	nature	PROPN
abc-4026	341	28	227	227	NUM
abc-4026	341	29	,	,	PUNCT
abc-4026	341	30	680	680	NUM
abc-4026	341	31	–	–	PUNCT
abc-4026	341	32	685	685	NUM
abc-4026	341	33	.	.	PUNCT
abc-4026	342	1	https://doi.org/10.1038/227680a0	https://doi.org/10.1038/227680a0	NUM
abc-4026	342	2	lamppa	lamppa	PROPN
abc-4026	342	3	,	,	PUNCT
abc-4026	342	4	g.	g.	PROPN
abc-4026	342	5	k.	k.	PROPN
abc-4026	342	6	,	,	PUNCT
abc-4026	342	7	1988	1988	NUM
abc-4026	342	8	:	:	PUNCT
abc-4026	342	9	the	the	DET
abc-4026	342	10	chlorophyll	chlorophyll	NOUN
abc-4026	342	11	a	a	DET
abc-4026	342	12	/	/	SYM
abc-4026	342	13	b	b	NOUN
abc-4026	342	14	-	-	PUNCT
abc-4026	342	15	binding	bind	VERB
abc-4026	342	16	protein	protein	NOUN
abc-4026	342	17	inserts	insert	NOUN
abc-4026	342	18	into	into	ADP
abc-4026	342	19	the	the	DET
abc-4026	342	20	thylakoids	thylakoid	NOUN
abc-4026	342	21	independent	independent	ADJ
abc-4026	342	22	of	of	ADP
abc-4026	342	23	its	its	PRON
abc-4026	342	24	cognate	cognate	NOUN
abc-4026	342	25	transit	transit	NOUN
abc-4026	342	26	peptide	peptide	NOUN
abc-4026	342	27	.	.	PUNCT
abc-4026	343	1	the	the	DET
abc-4026	343	2	journal	journal	NOUN
abc-4026	343	3	of	of	ADP
abc-4026	343	4	biological	biological	ADJ
abc-4026	343	5	chemistry	chemistry	NOUN
abc-4026	343	6	263(29	263(29	NUM
abc-4026	343	7	)	)	PUNCT
abc-4026	343	8	,	,	PUNCT
abc-4026	343	9	14996–14999	14996–14999	NUM
abc-4026	343	10	.	.	PUNCT
abc-4026	344	1	https://doi.org/10.1016/s0021-9258(18)68137-2	https://doi.org/10.1016/s0021-9258(18)68137-2	PROPN
abc-4026	344	2	mckenzie	mckenzie	PROPN
abc-4026	344	3	,	,	PUNCT
abc-4026	344	4	s.	s.	PROPN
abc-4026	344	5	d.	d.	PROPN
abc-4026	344	6	,	,	PUNCT
abc-4026	344	7	ibrahim	ibrahim	PROPN
abc-4026	344	8	,	,	PUNCT
abc-4026	344	9	i.	i.	PROPN
abc-4026	344	10	m.	m.	PROPN
abc-4026	344	11	,	,	PUNCT
abc-4026	344	12	aryal	aryal	PROPN
abc-4026	344	13	,	,	PUNCT
abc-4026	344	14	u.	u.	PROPN
abc-4026	344	15	k.	k.	PROPN
abc-4026	344	16	,	,	PUNCT
abc-4026	344	17	puthiyaveetil	puthiyaveetil	PROPN
abc-4026	344	18	,	,	PUNCT
abc-4026	344	19	s.	s.	PROPN
abc-4026	344	20	,	,	PUNCT
abc-4026	344	21	2020	2020	NUM
abc-4026	344	22	:	:	PUNCT
abc-4026	344	23	stoichiometry	stoichiometry	NOUN
abc-4026	344	24	of	of	ADP
abc-4026	344	25	protein	protein	NOUN
abc-4026	344	26	complexes	complex	NOUN
abc-4026	344	27	in	in	ADP
abc-4026	344	28	plant	plant	NOUN
abc-4026	344	29	photosynthe	photosynthe	PRON
abc-4026	344	30	tic	tic	ADJ
abc-4026	344	31	membranes	membrane	NOUN
abc-4026	344	32	.	.	PUNCT
abc-4026	345	1	biochimica	biochimica	PROPN
abc-4026	345	2	et	et	PROPN
abc-4026	345	3	biophysica	biophysica	PROPN
abc-4026	345	4	acta	acta	PROPN
abc-4026	345	5	bioenergetics	bioenergetics	PROPN
abc-4026	345	6	.	.	PUNCT
abc-4026	346	1	1861(2	1861(2	NUM
abc-4026	346	2	)	)	PUNCT
abc-4026	346	3	,	,	PUNCT
abc-4026	346	4	148141	148141	NUM
abc-4026	346	5	.	.	PUNCT
abc-4026	347	1	https://doi.org/10.1016/j	https://doi.org/10.1016/j	NOUN
abc-4026	347	2	.	.	PUNCT
abc-4026	348	1	bbabio.2019.148141	bbabio.2019.148141	ADJ
abc-4026	348	2	peltier	peltier	NOUN
abc-4026	348	3	,	,	PUNCT
abc-4026	348	4	j.-b	j.-b	PROPN
abc-4026	348	5	.	.	PROPN
abc-4026	348	6	,	,	PUNCT
abc-4026	348	7	ytterberg	ytterberg	PROPN
abc-4026	348	8	,	,	PUNCT
abc-4026	348	9	a.-j	a.-j	PROPN
abc-4026	348	10	.	.	PROPN
abc-4026	348	11	,	,	PUNCT
abc-4026	348	12	sun	sun	PROPN
abc-4026	348	13	,	,	PUNCT
abc-4026	348	14	q.	q.	PROPN
abc-4026	348	15	,	,	PUNCT
abc-4026	348	16	van	van	PROPN
abc-4026	348	17	wijk	wijk	PROPN
abc-4026	348	18	,	,	PUNCT
abc-4026	348	19	k.-j	k.-j	PROPN
abc-4026	348	20	.	.	PROPN
abc-4026	348	21	,	,	PUNCT
abc-4026	348	22	2004	2004	NUM
abc-4026	348	23	:	:	PUNCT
abc-4026	348	24	new	new	ADJ
abc-4026	348	25	functions	function	NOUN
abc-4026	348	26	of	of	ADP
abc-4026	348	27	the	the	DET
abc-4026	348	28	thylakoid	thylakoid	ADJ
abc-4026	348	29	membrane	membrane	NOUN
abc-4026	348	30	proteome	proteome	NOUN
abc-4026	348	31	of	of	ADP
abc-4026	348	32	arabidopsis	arabidopsis	NOUN
abc-4026	348	33	thaliana	thaliana	NOUN
abc-4026	348	34	revealed	reveal	VERB
abc-4026	348	35	by	by	ADP
abc-4026	348	36	a	a	DET
abc-4026	348	37	simple	simple	ADJ
abc-4026	348	38	,	,	PUNCT
abc-4026	348	39	fast	fast	ADJ
abc-4026	348	40	,	,	PUNCT
abc-4026	348	41	and	and	CCONJ
abc-4026	348	42	versatile	versatile	ADJ
abc-4026	348	43	fractionation	fractionation	NOUN
abc-4026	348	44	strategy	strategy	NOUN
abc-4026	348	45	.	.	PUNCT
abc-4026	349	1	journal	journal	NOUN
abc-4026	349	2	of	of	ADP
abc-4026	349	3	biological	biological	ADJ
abc-4026	349	4	chemistry	chemistry	NOUN
abc-4026	349	5	279(47	279(47	NUM
abc-4026	349	6	)	)	PUNCT
abc-4026	349	7	,	,	PUNCT
abc-4026	349	8	49367	49367	NUM
abc-4026	349	9	–	–	PUNCT
abc-4026	349	10	49383	49383	NUM
abc-4026	349	11	.	.	PUNCT
abc-4026	350	1	https://doi.org/10.1074/jbc.m406763200	https://doi.org/10.1074/jbc.m406763200	PROPN
abc-4026	350	2	sáiz	sáiz	PROPN
abc-4026	350	3	-	-	PUNCT
abc-4026	350	4	bonilla	bonilla	NOUN
abc-4026	350	5	,	,	PUNCT
abc-4026	350	6	m.	m.	NOUN
abc-4026	350	7	,	,	PUNCT
abc-4026	350	8	martín	martín	NOUN
abc-4026	350	9	-	-	PUNCT
abc-4026	350	10	merchán	merchán	NOUN
abc-4026	350	11	,	,	PUNCT
abc-4026	350	12	a.	a.	NOUN
abc-4026	350	13	,	,	PUNCT
abc-4026	350	14	pallás	pallás	PROPN
abc-4026	350	15	,	,	PUNCT
abc-4026	350	16	v.	v.	PROPN
abc-4026	350	17	,	,	PUNCT
abc-4026	350	18	navarro	navarro	PROPN
abc-4026	350	19	,	,	PUNCT
abc-4026	350	20	j.	j.	PROPN
abc-4026	350	21	a.	a.	PROPN
abc-4026	350	22	,	,	PUNCT
abc-4026	350	23	2023	2023	NUM
abc-4026	350	24	:	:	PUNCT
abc-4026	350	25	a	a	DET
abc-4026	350	26	viral	viral	ADJ
abc-4026	350	27	protein	protein	NOUN
abc-4026	350	28	targets	target	NOUN
abc-4026	350	29	mitochondria	mitochondria	NOUN
abc-4026	350	30	and	and	CCONJ
abc-4026	350	31	chloroplasts	chloroplast	NOUN
abc-4026	350	32	by	by	ADP
abc-4026	350	33	subverting	subvert	VERB
abc-4026	350	34	general	general	ADJ
abc-4026	350	35	import	import	NOUN
abc-4026	350	36	pathways	pathway	NOUN
abc-4026	350	37	and	and	CCONJ
abc-4026	350	38	specific	specific	ADJ
abc-4026	350	39	receptors	receptor	NOUN
abc-4026	350	40	.	.	PUNCT
abc-4026	351	1	journal	journal	NOUN
abc-4026	351	2	of	of	ADP
abc-4026	351	3	virology	virology	NOUN
abc-4026	351	4	97(10	97(10	NOUN
abc-4026	351	5	)	)	PUNCT
abc-4026	351	6	,	,	PUNCT
abc-4026	351	7	e0112423	e0112423	PROPN
abc-4026	351	8	.	.	PUNCT
abc-4026	352	1	https://doi.org/10.1128/	https://doi.org/10.1128/	PROPN
abc-4026	352	2	jvi.01124	jvi.01124	PROPN
abc-4026	352	3	-	-	PUNCT
abc-4026	352	4	23	23	NUM
abc-4026	352	5	schnell	schnell	PROPN
abc-4026	352	6	,	,	PUNCT
abc-4026	352	7	d.	d.	PROPN
abc-4026	352	8	j.	j.	PROPN
abc-4026	352	9	,	,	PUNCT
abc-4026	352	10	1998	1998	NUM
abc-4026	352	11	:	:	PUNCT
abc-4026	352	12	protein	protein	NOUN
abc-4026	352	13	targeting	target	VERB
abc-4026	352	14	to	to	ADP
abc-4026	352	15	the	the	DET
abc-4026	352	16	thylakoid	thylakoid	ADJ
abc-4026	352	17	membrane	membrane	NOUN
abc-4026	352	18	.	.	PUNCT
abc-4026	353	1	annual	annual	ADJ
abc-4026	353	2	review	review	NOUN
abc-4026	353	3	of	of	ADP
abc-4026	353	4	plant	plant	NOUN
abc-4026	353	5	physiology	physiology	NOUN
abc-4026	353	6	and	and	CCONJ
abc-4026	353	7	plant	plant	NOUN
abc-4026	353	8	molecular	molecular	ADJ
abc-4026	353	9	biology	biology	NOUN
abc-4026	353	10	49	49	NUM
abc-4026	353	11	,	,	PUNCT
abc-4026	353	12	97–126	97–126	PROPN
abc-4026	353	13	.	.	PUNCT
abc-4026	354	1	https://doi.org/10.1146/annurev.arplant.49.1.97	https://doi.org/10.1146/annurev.arplant.49.1.97	NOUN
abc-4026	354	2	seo	seo	PROPN
abc-4026	354	3	,	,	PUNCT
abc-4026	354	4	s.	s.	PROPN
abc-4026	354	5	y.	y.	PROPN
abc-4026	354	6	,	,	PUNCT
abc-4026	354	7	wi	wi	PROPN
abc-4026	354	8	,	,	PUNCT
abc-4026	354	9	s.	s.	PROPN
abc-4026	354	10	j.	j.	PROPN
abc-4026	354	11	,	,	PUNCT
abc-4026	354	12	park	park	PROPN
abc-4026	354	13	,	,	PUNCT
abc-4026	354	14	k.	k.	PROPN
abc-4026	354	15	y.	y.	PROPN
abc-4026	354	16	,	,	PUNCT
abc-4026	354	17	2020	2020	NUM
abc-4026	354	18	:	:	PUNCT
abc-4026	354	19	functional	functional	ADJ
abc-4026	354	20	switching	switching	NOUN
abc-4026	354	21	of	of	ADP
abc-4026	354	22	npr1	npr1	NOUN
abc-4026	354	23	between	between	ADP
abc-4026	354	24	chloroplast	chloroplast	NOUN
abc-4026	354	25	and	and	CCONJ
abc-4026	354	26	nucleus	nucleus	NOUN
abc-4026	354	27	for	for	ADP
abc-4026	354	28	adaptive	adaptive	ADJ
abc-4026	354	29	response	response	NOUN
abc-4026	354	30	to	to	PART
abc-4026	354	31	salt	salt	VERB
abc-4026	354	32	stress	stress	NOUN
abc-4026	354	33	.	.	PUNCT
abc-4026	355	1	scientific	scientific	ADJ
abc-4026	355	2	reports	report	NOUN
abc-4026	355	3	10	10	NUM
abc-4026	355	4	,	,	PUNCT
abc-4026	355	5	4339	4339	NUM
abc-4026	355	6	.	.	PUNCT
abc-4026	356	1	https://doi.org/10.1038/	https://doi.org/10.1038/	PROPN
abc-4026	356	2	s41598	s41598	PROPN
abc-4026	356	3	-	-	PUNCT
abc-4026	356	4	020	020	NUM
abc-4026	356	5	-	-	PUNCT
abc-4026	356	6	61379	61379	NUM
abc-4026	356	7	-	-	SYM
abc-4026	356	8	3	3	NUM
abc-4026	356	9	sirpiö	sirpiö	NOUN
abc-4026	356	10	,	,	PUNCT
abc-4026	356	11	s.	s.	PROPN
abc-4026	356	12	,	,	PUNCT
abc-4026	356	13	suorsa	suorsa	NOUN
abc-4026	356	14	,	,	PUNCT
abc-4026	356	15	m.	m.	NOUN
abc-4026	356	16	,	,	PUNCT
abc-4026	356	17	aro	aro	NOUN
abc-4026	356	18	,	,	PUNCT
abc-4026	356	19	e.-m	e.-m	PROPN
abc-4026	356	20	.	.	PROPN
abc-4026	356	21	,	,	PUNCT
abc-4026	356	22	2011	2011	NUM
abc-4026	356	23	:	:	PUNCT
abc-4026	356	24	analysis	analysis	NOUN
abc-4026	356	25	of	of	ADP
abc-4026	356	26	thylakoid	thylakoid	ADJ
abc-4026	356	27	protein	protein	NOUN
abc-4026	356	28	complexes	complex	NOUN
abc-4026	356	29	by	by	ADP
abc-4026	356	30	two	two	NUM
abc-4026	356	31	-	-	PUNCT
abc-4026	356	32	dimensional	dimensional	ADJ
abc-4026	356	33	electrophoretic	electrophoretic	ADJ
abc-4026	356	34	systems	system	NOUN
abc-4026	356	35	.	.	PUNCT
abc-4026	357	1	methods	method	NOUN
abc-4026	357	2	in	in	ADP
abc-4026	357	3	molecular	molecular	ADJ
abc-4026	357	4	biology	biology	NOUN
abc-4026	357	5	775	775	NUM
abc-4026	357	6	,	,	PUNCT
abc-4026	357	7	19–30	19–30	NUM
abc-4026	357	8	.	.	PUNCT
abc-4026	358	1	https://doi	https://doi	NOUN
abc-4026	358	2	.	.	PUNCT
abc-4026	358	3	org/10.1007/978	org/10.1007/978	PROPN
abc-4026	358	4	-	-	PUNCT
abc-4026	358	5	1	1	NUM
abc-4026	358	6	-	-	PUNCT
abc-4026	358	7	61779	61779	NUM
abc-4026	358	8	-	-	PUNCT
abc-4026	358	9	237	237	NUM
abc-4026	358	10	-	-	PUNCT
abc-4026	358	11	3_2	3_2	NUM
abc-4026	358	12	vojta	vojta	NOUN
abc-4026	358	13	,	,	PUNCT
abc-4026	358	14	l.	l.	PROPN
abc-4026	358	15	,	,	PUNCT
abc-4026	358	16	carić	carić	NOUN
abc-4026	358	17	,	,	PUNCT
abc-4026	358	18	d.	d.	PROPN
abc-4026	358	19	,	,	PUNCT
abc-4026	358	20	cesar	cesar	PROPN
abc-4026	358	21	,	,	PUNCT
abc-4026	358	22	v.	v.	ADV
abc-4026	358	23	,	,	PUNCT
abc-4026	358	24	antunović	antunović	NOUN
abc-4026	358	25	dunić	dunić	PROPN
abc-4026	358	26	,	,	PUNCT
abc-4026	358	27	j.	j.	PROPN
abc-4026	358	28	,	,	PUNCT
abc-4026	358	29	lepeduš	lepeduš	PROPN
abc-4026	358	30	,	,	PUNCT
abc-4026	358	31	h.	h.	PROPN
abc-4026	358	32	,	,	PUNCT
abc-4026	358	33	kveder	kveder	PROPN
abc-4026	358	34	,	,	PUNCT
abc-4026	358	35	m.	m.	NOUN
abc-4026	358	36	,	,	PUNCT
abc-4026	358	37	fulgosi	fulgosi	NOUN
abc-4026	358	38	,	,	PUNCT
abc-4026	358	39	h.	h.	PROPN
abc-4026	358	40	,	,	PUNCT
abc-4026	358	41	2015	2015	NUM
abc-4026	358	42	:	:	PUNCT
abc-4026	358	43	trol	trol	PROPN
abc-4026	358	44	-	-	PUNCT
abc-4026	358	45	fnr	fnr	NOUN
abc-4026	358	46	interaction	interaction	NOUN
abc-4026	358	47	reveals	reveal	VERB
abc-4026	358	48	alternative	alternative	ADJ
abc-4026	358	49	pathways	pathway	NOUN
abc-4026	358	50	of	of	ADP
abc-4026	358	51	electron	electron	NOUN
abc-4026	358	52	partitioning	partition	VERB
abc-4026	358	53	in	in	ADP
abc-4026	358	54	photosynthesis	photosynthesis	NOUN
abc-4026	358	55	.	.	PUNCT
abc-4026	359	1	scientific	scientific	ADJ
abc-4026	359	2	reports	report	NOUN
abc-4026	359	3	5	5	NUM
abc-4026	359	4	,	,	PUNCT
abc-4026	359	5	10085	10085	NUM
abc-4026	359	6	.	.	PUNCT
abc-4026	360	1	https://doi.org/10.1038/	https://doi.org/10.1038/	NOUN
abc-4026	360	2	srep10085	srep10085	PROPN
abc-4026	360	3	vojta	vojta	PROPN
abc-4026	360	4	,	,	PUNCT
abc-4026	360	5	l.	l.	PROPN
abc-4026	360	6	,	,	PUNCT
abc-4026	360	7	čuletić	čuletić	NOUN
abc-4026	360	8	,	,	PUNCT
abc-4026	360	9	a.	a.	NOUN
abc-4026	360	10	,	,	PUNCT
abc-4026	360	11	fulgosi	fulgosi	PROPN
abc-4026	360	12	,	,	PUNCT
abc-4026	360	13	h.	h.	PROPN
abc-4026	360	14	,	,	PUNCT
abc-4026	360	15	2018	2018	NUM
abc-4026	360	16	:	:	PUNCT
abc-4026	360	17	effects	effect	NOUN
abc-4026	360	18	of	of	ADP
abc-4026	360	19	trol	trol	NOUN
abc-4026	360	20	presequence	presequence	NOUN
abc-4026	360	21	mutagenesis	mutagenesis	NOUN
abc-4026	360	22	on	on	ADP
abc-4026	360	23	its	its	PRON
abc-4026	360	24	import	import	NOUN
abc-4026	360	25	and	and	CCONJ
abc-4026	360	26	dual	dual	ADJ
abc-4026	360	27	localization	localization	NOUN
abc-4026	360	28	in	in	ADP
abc-4026	360	29	chloroplasts	chloroplast	NOUN
abc-4026	360	30	.	.	PUNCT
abc-4026	361	1	international	international	ADJ
abc-4026	361	2	journal	journal	NOUN
abc-4026	361	3	of	of	ADP
abc-4026	361	4	molecular	molecular	ADJ
abc-4026	361	5	sciences	science	NOUN
abc-4026	361	6	19(2	19(2	NUM
abc-4026	361	7	)	)	PUNCT
abc-4026	361	8	,	,	PUNCT
abc-4026	361	9	569	569	X
abc-4026	361	10	.	.	PUNCT
abc-4026	362	1	https://doi.org/10.3390/ijms19020569	https://doi.org/10.3390/ijms19020569	PROPN
abc-4026	362	2	vojta	vojta	PROPN
abc-4026	362	3	,	,	PUNCT
abc-4026	362	4	l.	l.	PROPN
abc-4026	362	5	,	,	PUNCT
abc-4026	362	6	fulgosi	fulgosi	PROPN
abc-4026	362	7	,	,	PUNCT
abc-4026	362	8	h.	h.	PROPN
abc-4026	362	9	,	,	PUNCT
abc-4026	362	10	2012	2012	NUM
abc-4026	362	11	:	:	PUNCT
abc-4026	362	12	energy	energy	NOUN
abc-4026	362	13	conductance	conductance	NOUN
abc-4026	362	14	from	from	ADP
abc-4026	362	15	thylakoid	thylakoid	ADJ
abc-4026	362	16	complexes	complex	NOUN
abc-4026	362	17	to	to	ADP
abc-4026	362	18	stromal	stromal	ADJ
abc-4026	362	19	reducing	reduce	VERB
abc-4026	362	20	equivalents	equivalent	NOUN
abc-4026	362	21	.	.	PUNCT
abc-4026	363	1	advances	advance	NOUN
abc-4026	363	2	in	in	ADP
abc-4026	363	3	photosynthesis	photosynthesis	NOUN
abc-4026	363	4	fundamental	fundamental	ADJ
abc-4026	363	5	aspects	aspect	NOUN
abc-4026	363	6	,	,	PUNCT
abc-4026	363	7	175–190	175–190	NUM
abc-4026	363	8	.	.	PUNCT
abc-4026	364	1	intech	intech	PROPN
abc-4026	364	2	,	,	PUNCT
abc-4026	364	3	rijeka	rijeka	PROPN
abc-4026	364	4	.	.	PUNCT
abc-4026	365	1	vojta	vojta	PROPN
abc-4026	365	2	,	,	PUNCT
abc-4026	365	3	l.	l.	PROPN
abc-4026	365	4	,	,	PUNCT
abc-4026	365	5	fulgosi	fulgosi	PROPN
abc-4026	365	6	,	,	PUNCT
abc-4026	365	7	h.	h.	PROPN
abc-4026	365	8	,	,	PUNCT
abc-4026	365	9	2016	2016	NUM
abc-4026	365	10	:	:	PUNCT
abc-4026	365	11	data	datum	NOUN
abc-4026	365	12	supporting	support	VERB
abc-4026	365	13	the	the	DET
abc-4026	365	14	absence	absence	NOUN
abc-4026	365	15	of	of	ADP
abc-4026	365	16	fnr	fnr	PROPN
abc-4026	365	17	dynamic	dynamic	ADJ
abc-4026	365	18	photosynthetic	photosynthetic	ADJ
abc-4026	365	19	membrane	membrane	NOUN
abc-4026	365	20	recruitment	recruitment	NOUN
abc-4026	365	21	in	in	ADP
abc-4026	365	22	trol	trol	NOUN
abc-4026	365	23	mutants	mutant	NOUN
abc-4026	365	24	.	.	PUNCT
abc-4026	366	1	data	datum	NOUN
abc-4026	366	2	in	in	ADP
abc-4026	366	3	brief	brief	ADJ
abc-4026	366	4	7	7	NUM
abc-4026	366	5	,	,	PUNCT
abc-4026	366	6	393–396	393–396	NUM
abc-4026	366	7	.	.	PUNCT
abc-4026	367	1	https://doi.org/10.1016/j	https://doi.org/10.1016/j	NOUN
abc-4026	367	2	.	.	PUNCT
abc-4026	368	1	dib.2016.02.044	dib.2016.02.044	PROPN
abc-4026	368	2	vojta	vojta	PROPN
abc-4026	368	3	,	,	PUNCT
abc-4026	368	4	l.	l.	PROPN
abc-4026	368	5	,	,	PUNCT
abc-4026	368	6	fulgosi	fulgosi	PROPN
abc-4026	368	7	,	,	PUNCT
abc-4026	368	8	h.	h.	PROPN
abc-4026	368	9	,	,	PUNCT
abc-4026	368	10	2019	2019	NUM
abc-4026	368	11	:	:	PUNCT
abc-4026	368	12	topology	topology	NOUN
abc-4026	368	13	of	of	ADP
abc-4026	368	14	trol	trol	NOUN
abc-4026	368	15	protein	protein	NOUN
abc-4026	368	16	in	in	ADP
abc-4026	368	17	thylakoid	thylakoid	ADJ
abc-4026	368	18	membranes	membrane	NOUN
abc-4026	368	19	of	of	ADP
abc-4026	368	20	arabidopsis	arabidopsis	NOUN
abc-4026	368	21	thaliana	thaliana	NOUN
abc-4026	368	22	.	.	PUNCT
abc-4026	369	1	physiologia	physiologia	PROPN
abc-4026	369	2	plantarum	plantarum	NOUN
abc-4026	369	3	166(1	166(1	NUM
abc-4026	369	4	)	)	PUNCT
abc-4026	369	5	,	,	PUNCT
abc-4026	369	6	300–308	300–308	NUM
abc-4026	369	7	.	.	PUNCT
abc-4026	370	1	https://doi.org/10.1111/ppl.12927	https://doi.org/10.1111/ppl.12927	PRON
abc-4026	370	2	vojta	vojta	PROPN
abc-4026	370	3	,	,	PUNCT
abc-4026	370	4	l.	l.	PROPN
abc-4026	370	5	,	,	PUNCT
abc-4026	370	6	horvat	horvat	PROPN
abc-4026	370	7	,	,	PUNCT
abc-4026	370	8	l.	l.	PROPN
abc-4026	370	9	,	,	PUNCT
abc-4026	370	10	fulgosi	fulgosi	PROPN
abc-4026	370	11	,	,	PUNCT
abc-4026	370	12	h.	h.	PROPN
abc-4026	370	13	,	,	PUNCT
abc-4026	370	14	2012	2012	NUM
abc-4026	370	15	:	:	PUNCT
abc-4026	370	16	balancing	balance	VERB
abc-4026	370	17	chloroplast	chloroplast	ADJ
abc-4026	370	18	redox	redox	ADJ
abc-4026	370	19	status	status	NOUN
abc-4026	370	20	–	–	PUNCT
abc-4026	370	21	regulation	regulation	NOUN
abc-4026	370	22	of	of	ADP
abc-4026	370	23	fnr	fnr	NOUN
abc-4026	370	24	binding	bind	VERB
abc-4026	370	25	and	and	CCONJ
abc-4026	370	26	release	release	NOUN
abc-4026	370	27	.	.	PUNCT
abc-4026	371	1	periodicum	periodicum	PROPN
abc-4026	371	2	biologorum	biologorum	PROPN
abc-4026	371	3	114	114	NUM
abc-4026	371	4	,	,	PUNCT
abc-4026	371	5	25–31	25–31	PROPN
abc-4026	371	6	.	.	PUNCT
abc-4026	371	7	vojta	vojta	PROPN
abc-4026	371	8	,	,	PUNCT
abc-4026	371	9	l.	l.	PROPN
abc-4026	371	10	,	,	PUNCT
abc-4026	371	11	rac	rac	PROPN
abc-4026	371	12	-	-	PUNCT
abc-4026	371	13	justament	justament	PROPN
abc-4026	371	14	,	,	PUNCT
abc-4026	371	15	a.	a.	NOUN
abc-4026	371	16	,	,	PUNCT
abc-4026	371	17	zechmann	zechmann	PROPN
abc-4026	371	18	,	,	PUNCT
abc-4026	371	19	b.	b.	PROPN
abc-4026	371	20	,	,	PUNCT
abc-4026	371	21	fulgosi	fulgosi	PROPN
abc-4026	371	22	,	,	PUNCT
abc-4026	371	23	h.	h.	PROPN
abc-4026	371	24	,	,	PUNCT
abc-4026	371	25	2023	2023	NUM
abc-4026	371	26	:	:	PUNCT
abc-4026	371	27	thylakoid	thylakoid	ADJ
abc-4026	371	28	rhodanese	rhodanese	ADJ
abc-4026	371	29	-	-	PUNCT
abc-4026	371	30	like	like	ADJ
abc-4026	371	31	protein	protein	NOUN
abc-4026	371	32	–	–	PUNCT
abc-4026	371	33	ferredoxin	ferredoxin	ADJ
abc-4026	371	34	:	:	PUNCT
abc-4026	371	35	nadp+	nadp+	X
abc-4026	371	36	oxidoreductase	oxidoreductase	PROPN
abc-4026	371	37	interaction	interaction	NOUN
abc-4026	371	38	is	be	AUX
abc-4026	371	39	integrated	integrate	VERB
abc-4026	371	40	into	into	ADP
abc-4026	371	41	plant	plant	NOUN
abc-4026	371	42	redox	redox	NOUN
abc-4026	371	43	homeostasis	homeostasis	NOUN
abc-4026	371	44	system	system	NOUN
abc-4026	371	45	.	.	PUNCT
abc-4026	372	1	antioxidants	antioxidant	NOUN
abc-4026	372	2	12(10	12(10	NUM
abc-4026	372	3	)	)	PUNCT
abc-4026	372	4	,	,	PUNCT
abc-4026	372	5	1838	1838	NUM
abc-4026	372	6	.	.	PUNCT
abc-4026	373	1	https://doi	https://doi	X
abc-4026	373	2	.	.	PUNCT
abc-4026	373	3	org/10.3390	org/10.3390	PROPN
abc-4026	373	4	/	/	SYM
abc-4026	373	5	antiox12101838	antiox12101838	PROPN
abc-4026	373	6	vojta	vojta	NOUN
abc-4026	373	7	,	,	PUNCT
abc-4026	373	8	l.	l.	PROPN
abc-4026	373	9	,	,	PUNCT
abc-4026	373	10	soll	soll	PROPN
abc-4026	373	11	,	,	PUNCT
abc-4026	373	12	j.	j.	PROPN
abc-4026	373	13	,	,	PUNCT
abc-4026	373	14	bölter	bölter	PROPN
abc-4026	373	15	,	,	PUNCT
abc-4026	373	16	b.	b.	PROPN
abc-4026	373	17	,	,	PUNCT
abc-4026	373	18	2007	2007	NUM
abc-4026	373	19	:	:	PUNCT
abc-4026	373	20	requirements	requirement	NOUN
abc-4026	373	21	for	for	ADP
abc-4026	373	22	a	a	DET
abc-4026	373	23	conservative	conservative	ADJ
abc-4026	373	24	protein	protein	NOUN
abc-4026	373	25	translocation	translocation	NOUN
abc-4026	373	26	pathway	pathway	NOUN
abc-4026	373	27	in	in	ADP
abc-4026	373	28	chloroplasts	chloroplast	NOUN
abc-4026	373	29	.	.	PUNCT
abc-4026	374	1	febs	febs	NOUN
abc-4026	374	2	letters	letters	PROPN
abc-4026	374	3	581(14	581(14	NUM
abc-4026	374	4	)	)	PUNCT
abc-4026	374	5	,	,	PUNCT
abc-4026	374	6	2621–2624	2621–2624	NUM
abc-4026	374	7	.	.	PUNCT
abc-4026	375	1	https://doi.org/10.1016/j.febslet.2007.05.004	https://doi.org/10.1016/j.febslet.2007.05.004	PROPN
abc-4026	375	2	yoshida	yoshida	PROPN
abc-4026	375	3	,	,	PUNCT
abc-4026	375	4	k.	k.	PROPN
abc-4026	375	5	,	,	PUNCT
abc-4026	375	6	yokochi	yokochi	PROPN
abc-4026	375	7	,	,	PUNCT
abc-4026	375	8	y.	y.	PROPN
abc-4026	375	9	,	,	PUNCT
abc-4026	375	10	tanaka	tanaka	PROPN
abc-4026	375	11	,	,	PUNCT
abc-4026	375	12	k.	k.	PROPN
abc-4026	375	13	,	,	PUNCT
abc-4026	375	14	hisabori	hisabori	INTJ
abc-4026	375	15	,	,	PUNCT
abc-4026	375	16	t.	t.	NOUN
abc-4026	375	17	,	,	PUNCT
abc-4026	375	18	2022	2022	NUM
abc-4026	375	19	:	:	PUNCT
abc-4026	375	20	the	the	DET
abc-4026	375	21	ferredoxin	ferredoxin	PROPN
abc-4026	375	22	/	/	SYM
abc-4026	375	23	thioredoxin	thioredoxin	PROPN
abc-4026	375	24	pathway	pathway	NOUN
abc-4026	375	25	constitutes	constitute	VERB
abc-4026	375	26	an	an	DET
abc-4026	375	27	indispensable	indispensable	ADJ
abc-4026	375	28	redox	redox	NOUN
abc-4026	375	29	-	-	PUNCT
abc-4026	375	30	signaling	signal	VERB
abc-4026	375	31	cascade	cascade	NOUN
abc-4026	375	32	for	for	ADP
abc-4026	375	33	light	light	ADJ
abc-4026	375	34	-	-	PUNCT
abc-4026	375	35	dependent	dependent	ADJ
abc-4026	375	36	reduction	reduction	NOUN
abc-4026	375	37	of	of	ADP
abc-4026	375	38	chloroplast	chloroplast	ADJ
abc-4026	375	39	stromal	stromal	ADJ
abc-4026	375	40	proteins	protein	NOUN
abc-4026	375	41	.	.	PUNCT
abc-4026	376	1	journal	journal	NOUN
abc-4026	376	2	of	of	ADP
abc-4026	376	3	biological	biological	ADJ
abc-4026	376	4	chemistry	chemistry	NOUN
abc-4026	376	5	298(12):102650	298(12):102650	PROPN
abc-4026	376	6	.	.	PUNCT
abc-4026	376	7	https://doi.org/10.1016/j.jbc.2022.102650	https://doi.org/10.1016/j.jbc.2022.102650	X