id	sid	tid	token	lemma	pos
arestyrurj-238	1	1	aresty	aresty	PROPN
arestyrurj-238	1	2	rutgers	rutgers	PROPN
arestyrurj-238	1	3	undergraduate	undergraduate	PROPN
arestyrurj-238	1	4	research	research	PROPN
arestyrurj-238	1	5	journal	journal	PROPN
arestyrurj-238	1	6	,	,	PUNCT
arestyrurj-238	1	7	volume	volume	NOUN
arestyrurj-238	1	8	i	i	PRON
arestyrurj-238	1	9	,	,	PUNCT
arestyrurj-238	1	10	issue	issue	NOUN
arestyrurj-238	1	11	v	v	ADP
arestyrurj-238	1	12	this	this	DET
arestyrurj-238	1	13	work	work	NOUN
arestyrurj-238	1	14	is	be	AUX
arestyrurj-238	1	15	licensed	license	VERB
arestyrurj-238	1	16	under	under	ADP
arestyrurj-238	1	17	a	a	DET
arestyrurj-238	1	18	creative	creative	ADJ
arestyrurj-238	1	19	commons	common	NOUN
arestyrurj-238	1	20	attribution	attribution	NOUN
arestyrurj-238	1	21	-	-	PUNCT
arestyrurj-238	1	22	noncommercial	noncommercial	ADJ
arestyrurj-238	1	23	-	-	PUNCT
arestyrurj-238	1	24	sharealike	sharealike	ADJ
arestyrurj-238	1	25	4.0	4.0	NUM
arestyrurj-238	1	26	international	international	ADJ
arestyrurj-238	1	27	license	license	NOUN
arestyrurj-238	1	28	.	.	PUNCT
arestyrurj-238	2	1	relationship	relationship	NOUN
arestyrurj-238	2	2	between	between	ADP
arestyrurj-238	2	3	biophysical	biophysical	ADJ
arestyrurj-238	2	4	properties	property	NOUN
arestyrurj-238	2	5	of	of	ADP
arestyrurj-238	2	6	antimicrobial	antimicrobial	ADJ
arestyrurj-238	2	7	peptides	peptide	NOUN
arestyrurj-238	2	8	(	(	PUNCT
arestyrurj-238	2	9	amps	amp	NOUN
arestyrurj-238	2	10	)	)	PUNCT
arestyrurj-238	2	11	and	and	CCONJ
arestyrurj-238	2	12	their	their	PRON
arestyrurj-238	2	13	associated	associated	ADJ
arestyrurj-238	2	14	drug	drug	NOUN
arestyrurj-238	2	15	efficacies	efficacy	NOUN
arestyrurj-238	2	16	alisha	alisha	PROPN
arestyrurj-238	2	17	zhu	zhu	PROPN
arestyrurj-238	2	18	✵	✵	PROPN
arestyrurj-238	2	19	abstract	abstract	ADJ
arestyrurj-238	2	20	antibiotic	antibiotic	ADJ
arestyrurj-238	2	21	resistance	resistance	NOUN
arestyrurj-238	2	22	is	be	AUX
arestyrurj-238	2	23	a	a	DET
arestyrurj-238	2	24	growing	grow	VERB
arestyrurj-238	2	25	global	global	ADJ
arestyrurj-238	2	26	health	health	NOUN
arestyrurj-238	2	27	threat	threat	NOUN
arestyrurj-238	2	28	.	.	PUNCT
arestyrurj-238	3	1	one	one	NUM
arestyrurj-238	3	2	consequence	consequence	NOUN
arestyrurj-238	3	3	is	be	AUX
arestyrurj-238	3	4	that	that	SCONJ
arestyrurj-238	3	5	patients	patient	NOUN
arestyrurj-238	3	6	with	with	ADP
arestyrurj-238	3	7	cystic	cystic	ADJ
arestyrurj-238	3	8	fibrosis	fibrosis	NOUN
arestyrurj-238	3	9	(	(	PUNCT
arestyrurj-238	3	10	cf	cf	NOUN
arestyrurj-238	3	11	)	)	PUNCT
arestyrurj-238	3	12	are	be	AUX
arestyrurj-238	3	13	prone	prone	ADJ
arestyrurj-238	3	14	to	to	ADP
arestyrurj-238	3	15	developing	develop	VERB
arestyrurj-238	3	16	antibiotic	antibiotic	ADJ
arestyrurj-238	3	17	resistant	resistant	ADJ
arestyrurj-238	3	18	lung	lung	NOUN
arestyrurj-238	3	19	infections	infection	NOUN
arestyrurj-238	3	20	caused	cause	VERB
arestyrurj-238	3	21	by	by	ADP
arestyrurj-238	3	22	multiple	multiple	ADJ
arestyrurj-238	3	23	strains	strain	NOUN
arestyrurj-238	3	24	of	of	ADP
arestyrurj-238	3	25	bacteria	bacteria	NOUN
arestyrurj-238	3	26	,	,	PUNCT
arestyrurj-238	3	27	including	include	VERB
arestyrurj-238	3	28	pseudomonas	pseudomona	NOUN
arestyrurj-238	3	29	aeruginosa	aeruginosa	NOUN
arestyrurj-238	3	30	.	.	PUNCT
arestyrurj-238	4	1	due	due	ADP
arestyrurj-238	4	2	to	to	ADP
arestyrurj-238	4	3	the	the	DET
arestyrurj-238	4	4	limited	limited	ADJ
arestyrurj-238	4	5	number	number	NOUN
arestyrurj-238	4	6	of	of	ADP
arestyrurj-238	4	7	treatment	treatment	NOUN
arestyrurj-238	4	8	options	option	NOUN
arestyrurj-238	4	9	for	for	ADP
arestyrurj-238	4	10	patients	patient	NOUN
arestyrurj-238	4	11	with	with	ADP
arestyrurj-238	4	12	chronic	chronic	ADJ
arestyrurj-238	4	13	antibiotic	antibiotic	ADJ
arestyrurj-238	4	14	resistant	resistant	ADJ
arestyrurj-238	4	15	infections	infection	NOUN
arestyrurj-238	4	16	,	,	PUNCT
arestyrurj-238	4	17	there	there	PRON
arestyrurj-238	4	18	is	be	VERB
arestyrurj-238	4	19	a	a	DET
arestyrurj-238	4	20	need	need	NOUN
arestyrurj-238	4	21	for	for	ADP
arestyrurj-238	4	22	finding	find	VERB
arestyrurj-238	4	23	new	new	ADJ
arestyrurj-238	4	24	antibiotics	antibiotic	NOUN
arestyrurj-238	4	25	that	that	PRON
arestyrurj-238	4	26	allow	allow	VERB
arestyrurj-238	4	27	for	for	ADP
arestyrurj-238	4	28	effective	effective	ADJ
arestyrurj-238	4	29	eradication	eradication	NOUN
arestyrurj-238	4	30	of	of	ADP
arestyrurj-238	4	31	bacterial	bacterial	ADJ
arestyrurj-238	4	32	infections	infection	NOUN
arestyrurj-238	4	33	,	,	PUNCT
arestyrurj-238	4	34	such	such	ADJ
arestyrurj-238	4	35	as	as	ADP
arestyrurj-238	4	36	those	those	PRON
arestyrurj-238	4	37	in	in	ADP
arestyrurj-238	4	38	the	the	DET
arestyrurj-238	4	39	cf	cf	NOUN
arestyrurj-238	4	40	lung	lung	NOUN
arestyrurj-238	4	41	.	.	PUNCT
arestyrurj-238	5	1	many	many	ADJ
arestyrurj-238	5	2	antimicrobial	antimicrobial	ADJ
arestyrurj-238	5	3	peptides	peptide	NOUN
arestyrurj-238	5	4	(	(	PUNCT
arestyrurj-238	5	5	amps	amp	NOUN
arestyrurj-238	5	6	)	)	PUNCT
arestyrurj-238	5	7	have	have	AUX
arestyrurj-238	5	8	been	be	AUX
arestyrurj-238	5	9	annotated	annotate	VERB
arestyrurj-238	5	10	in	in	ADP
arestyrurj-238	5	11	databases	database	NOUN
arestyrurj-238	5	12	and	and	CCONJ
arestyrurj-238	5	13	are	be	AUX
arestyrurj-238	5	14	considered	consider	VERB
arestyrurj-238	5	15	as	as	ADP
arestyrurj-238	5	16	potential	potential	ADJ
arestyrurj-238	5	17	alternatives	alternative	NOUN
arestyrurj-238	5	18	for	for	ADP
arestyrurj-238	5	19	current	current	ADJ
arestyrurj-238	5	20	antibiotics	antibiotic	NOUN
arestyrurj-238	5	21	.	.	PUNCT
arestyrurj-238	6	1	however	however	ADV
arestyrurj-238	6	2	,	,	PUNCT
arestyrurj-238	6	3	in	in	ADP
arestyrurj-238	6	4	many	many	ADJ
arestyrurj-238	6	5	instances	instance	NOUN
arestyrurj-238	6	6	,	,	PUNCT
arestyrurj-238	6	7	the	the	DET
arestyrurj-238	6	8	suitability	suitability	NOUN
arestyrurj-238	6	9	of	of	ADP
arestyrurj-238	6	10	amps	amp	NOUN
arestyrurj-238	6	11	as	as	ADP
arestyrurj-238	6	12	drug	drug	NOUN
arestyrurj-238	6	13	molecules	molecule	NOUN
arestyrurj-238	6	14	has	have	AUX
arestyrurj-238	6	15	not	not	PART
arestyrurj-238	6	16	been	be	AUX
arestyrurj-238	6	17	extensively	extensively	ADV
arestyrurj-238	6	18	explored	explore	VERB
arestyrurj-238	6	19	.	.	PUNCT
arestyrurj-238	7	1	here	here	ADV
arestyrurj-238	7	2	,	,	PUNCT
arestyrurj-238	7	3	we	we	PRON
arestyrurj-238	7	4	propose	propose	VERB
arestyrurj-238	7	5	that	that	SCONJ
arestyrurj-238	7	6	certain	certain	ADJ
arestyrurj-238	7	7	molecular	molecular	ADJ
arestyrurj-238	7	8	properties	property	NOUN
arestyrurj-238	7	9	of	of	ADP
arestyrurj-238	7	10	amps	amp	NOUN
arestyrurj-238	7	11	favor	favor	VERB
arestyrurj-238	7	12	high	high	ADJ
arestyrurj-238	7	13	antibiotic	antibiotic	ADJ
arestyrurj-238	7	14	efficacy	efficacy	NOUN
arestyrurj-238	7	15	.	.	PUNCT
arestyrurj-238	8	1	using	use	VERB
arestyrurj-238	8	2	information	information	NOUN
arestyrurj-238	8	3	from	from	ADP
arestyrurj-238	8	4	amp	amp	NOUN
arestyrurj-238	8	5	databases	database	NOUN
arestyrurj-238	8	6	,	,	PUNCT
arestyrurj-238	8	7	we	we	PRON
arestyrurj-238	8	8	combined	combine	VERB
arestyrurj-238	8	9	statistical	statistical	ADJ
arestyrurj-238	8	10	analyses	analysis	NOUN
arestyrurj-238	8	11	and	and	CCONJ
arestyrurj-238	8	12	machine	machine	NOUN
arestyrurj-238	8	13	learning	learn	VERB
arestyrurj-238	8	14	techniques	technique	NOUN
arestyrurj-238	8	15	to	to	PART
arestyrurj-238	8	16	identify	identify	VERB
arestyrurj-238	8	17	relationships	relationship	NOUN
arestyrurj-238	8	18	between	between	ADP
arestyrurj-238	8	19	various	various	ADJ
arestyrurj-238	8	20	biophysical	biophysical	ADJ
arestyrurj-238	8	21	properties	property	NOUN
arestyrurj-238	8	22	of	of	ADP
arestyrurj-238	8	23	amps	amp	NOUN
arestyrurj-238	8	24	and	and	CCONJ
arestyrurj-238	8	25	their	their	PRON
arestyrurj-238	8	26	drug	drug	NOUN
arestyrurj-238	8	27	efficacies	efficacy	NOUN
arestyrurj-238	8	28	.	.	PUNCT
arestyrurj-238	9	1	analyses	analysis	NOUN
arestyrurj-238	9	2	from	from	ADP
arestyrurj-238	9	3	classification	classification	NOUN
arestyrurj-238	9	4	and	and	CCONJ
arestyrurj-238	9	5	regression	regression	NOUN
arestyrurj-238	9	6	trees	tree	NOUN
arestyrurj-238	9	7	(	(	PUNCT
arestyrurj-238	9	8	cart	cart	NOUN
arestyrurj-238	9	9	)	)	PUNCT
arestyrurj-238	9	10	and	and	CCONJ
arestyrurj-238	9	11	random	random	ADJ
arestyrurj-238	9	12	forests	forest	NOUN
arestyrurj-238	9	13	suggest	suggest	VERB
arestyrurj-238	9	14	that	that	SCONJ
arestyrurj-238	9	15	net	net	ADJ
arestyrurj-238	9	16	charge	charge	NOUN
arestyrurj-238	9	17	and	and	CCONJ
arestyrurj-238	9	18	maximum	maximum	ADJ
arestyrurj-238	9	19	average	average	ADJ
arestyrurj-238	9	20	hydrophobic	hydrophobic	NOUN
arestyrurj-238	9	21	moment	moment	NOUN
arestyrurj-238	9	22	are	be	AUX
arestyrurj-238	9	23	the	the	DET
arestyrurj-238	9	24	most	most	ADV
arestyrurj-238	9	25	important	important	ADJ
arestyrurj-238	9	26	properties	property	NOUN
arestyrurj-238	9	27	in	in	ADP
arestyrurj-238	9	28	determining	determine	VERB
arestyrurj-238	9	29	if	if	SCONJ
arestyrurj-238	9	30	a	a	DET
arestyrurj-238	9	31	peptide	peptide	NOUN
arestyrurj-238	9	32	is	be	AUX
arestyrurj-238	9	33	useful	useful	ADJ
arestyrurj-238	9	34	against	against	ADP
arestyrurj-238	9	35	p.	p.	NOUN
arestyrurj-238	9	36	aeruginosa	aeruginosa	PROPN
arestyrurj-238	9	37	infections	infection	NOUN
arestyrurj-238	9	38	in	in	ADP
arestyrurj-238	9	39	cf	cf	NOUN
arestyrurj-238	9	40	patients	patient	NOUN
arestyrurj-238	9	41	.	.	PUNCT
arestyrurj-238	10	1	maximum	maximum	ADJ
arestyrurj-238	10	2	average	average	ADJ
arestyrurj-238	10	3	hydrophobic	hydrophobic	NOUN
arestyrurj-238	10	4	residue	residue	NOUN
arestyrurj-238	10	5	,	,	PUNCT
arestyrurj-238	10	6	average	average	ADJ
arestyrurj-238	10	7	alpha	alpha	NOUN
arestyrurj-238	10	8	helix	helix	NOUN
arestyrurj-238	10	9	propensity	propensity	NOUN
arestyrurj-238	10	10	score	score	NOUN
arestyrurj-238	10	11	,	,	PUNCT
arestyrurj-238	10	12	hydrophobic	hydrophobic	NOUN
arestyrurj-238	10	13	proportion	proportion	NOUN
arestyrurj-238	10	14	,	,	PUNCT
arestyrurj-238	10	15	and	and	CCONJ
arestyrurj-238	10	16	peptide	peptide	NOUN
arestyrurj-238	10	17	length	length	NOUN
arestyrurj-238	10	18	still	still	ADV
arestyrurj-238	10	19	contribute	contribute	VERB
arestyrurj-238	10	20	to	to	ADP
arestyrurj-238	10	21	this	this	DET
arestyrurj-238	10	22	determination	determination	NOUN
arestyrurj-238	10	23	but	but	CCONJ
arestyrurj-238	10	24	to	to	ADP
arestyrurj-238	10	25	lesser	less	ADJ
arestyrurj-238	10	26	degrees	degree	NOUN
arestyrurj-238	10	27	.	.	PUNCT
arestyrurj-238	11	1	cation	cation	NOUN
arestyrurj-238	11	2	-	-	PUNCT
arestyrurj-238	11	3	pi	pi	NOUN
arestyrurj-238	11	4	interactions	interaction	NOUN
arestyrurj-238	11	5	,	,	PUNCT
arestyrurj-238	11	6	on	on	ADP
arestyrurj-238	11	7	the	the	DET
arestyrurj-238	11	8	other	other	ADJ
arestyrurj-238	11	9	hand	hand	NOUN
arestyrurj-238	11	10	,	,	PUNCT
arestyrurj-238	11	11	do	do	AUX
arestyrurj-238	11	12	not	not	PART
arestyrurj-238	11	13	appear	appear	VERB
arestyrurj-238	11	14	to	to	PART
arestyrurj-238	11	15	factor	factor	VERB
arestyrurj-238	11	16	into	into	ADP
arestyrurj-238	11	17	this	this	DET
arestyrurj-238	11	18	decision	decision	NOUN
arestyrurj-238	11	19	at	at	ADV
arestyrurj-238	11	20	all	all	ADV
arestyrurj-238	11	21	.	.	PUNCT
arestyrurj-238	12	1	based	base	VERB
arestyrurj-238	12	2	on	on	ADP
arestyrurj-238	12	3	these	these	DET
arestyrurj-238	12	4	properties	property	NOUN
arestyrurj-238	12	5	,	,	PUNCT
arestyrurj-238	12	6	our	our	PRON
arestyrurj-238	12	7	current	current	ADJ
arestyrurj-238	12	8	work	work	NOUN
arestyrurj-238	12	9	is	be	AUX
arestyrurj-238	12	10	focused	focus	VERB
arestyrurj-238	12	11	on	on	ADP
arestyrurj-238	12	12	designing	design	VERB
arestyrurj-238	12	13	and	and	CCONJ
arestyrurj-238	12	14	experimentally	experimentally	ADV
arestyrurj-238	12	15	testing	test	VERB
arestyrurj-238	12	16	new	new	ADJ
arestyrurj-238	12	17	peptides	peptide	NOUN
arestyrurj-238	12	18	that	that	PRON
arestyrurj-238	12	19	may	may	AUX
arestyrurj-238	12	20	have	have	VERB
arestyrurj-238	12	21	activity	activity	NOUN
arestyrurj-238	12	22	against	against	ADP
arestyrurj-238	12	23	p.	p.	NOUN
arestyrurj-238	12	24	aeruginosa	aeruginosa	PROPN
arestyrurj-238	12	25	infections	infection	NOUN
arestyrurj-238	12	26	.	.	PUNCT
arestyrurj-238	13	1	2	2	NUM
arestyrurj-238	13	2	introduction	introduction	NOUN
arestyrurj-238	13	3	antibiotic	antibiotic	ADJ
arestyrurj-238	13	4	resistance	resistance	NOUN
arestyrurj-238	13	5	is	be	AUX
arestyrurj-238	13	6	a	a	DET
arestyrurj-238	13	7	persistent	persistent	ADJ
arestyrurj-238	13	8	issue	issue	NOUN
arestyrurj-238	13	9	in	in	ADP
arestyrurj-238	13	10	patient	patient	ADJ
arestyrurj-238	13	11	care	care	NOUN
arestyrurj-238	13	12	that	that	PRON
arestyrurj-238	13	13	affects	affect	VERB
arestyrurj-238	13	14	more	more	ADJ
arestyrurj-238	13	15	than	than	ADP
arestyrurj-238	13	16	2.8	2.8	NUM
arestyrurj-238	13	17	million	million	NUM
arestyrurj-238	13	18	individuals	individual	NOUN
arestyrurj-238	13	19	,	,	PUNCT
arestyrurj-238	13	20	with	with	ADP
arestyrurj-238	13	21	an	an	DET
arestyrurj-238	13	22	estimated	estimate	VERB
arestyrurj-238	13	23	occurrence	occurrence	NOUN
arestyrurj-238	13	24	of	of	ADP
arestyrurj-238	13	25	~35,000	~35,000	PUNCT
arestyrurj-238	13	26	deaths	death	NOUN
arestyrurj-238	13	27	in	in	ADP
arestyrurj-238	13	28	the	the	DET
arestyrurj-238	13	29	u.s	u.s	PROPN
arestyrurj-238	13	30	.	.	PROPN
arestyrurj-238	13	31	each	each	DET
arestyrurj-238	13	32	year	year	NOUN
arestyrurj-238	13	33	(	(	PUNCT
arestyrurj-238	13	34	cdc	cdc	PROPN
arestyrurj-238	13	35	,	,	PUNCT
arestyrurj-238	13	36	2019	2019	NUM
arestyrurj-238	13	37	)	)	PUNCT
arestyrurj-238	13	38	.	.	PUNCT
arestyrurj-238	14	1	deemed	deem	VERB
arestyrurj-238	14	2	as	as	ADP
arestyrurj-238	14	3	a	a	DET
arestyrurj-238	14	4	serious	serious	ADJ
arestyrurj-238	14	5	threat	threat	NOUN
arestyrurj-238	14	6	by	by	ADP
arestyrurj-238	14	7	the	the	DET
arestyrurj-238	14	8	cdc	cdc	PROPN
arestyrurj-238	14	9	,	,	PUNCT
arestyrurj-238	14	10	pseudomonas	pseudomona	NOUN
arestyrurj-238	14	11	aeruginosa	aeruginosa	NOUN
arestyrurj-238	14	12	,	,	PUNCT
arestyrurj-238	14	13	a	a	DET
arestyrurj-238	14	14	type	type	NOUN
arestyrurj-238	14	15	of	of	ADP
arestyrurj-238	14	16	rod	rod	NOUN
arestyrurj-238	14	17	-	-	PUNCT
arestyrurj-238	14	18	shaped	shape	VERB
arestyrurj-238	14	19	,	,	PUNCT
arestyrurj-238	14	20	gram	gram	NOUN
arestyrurj-238	14	21	-	-	PUNCT
arestyrurj-238	14	22	negative	negative	ADJ
arestyrurj-238	14	23	bacteria	bacteria	NOUN
arestyrurj-238	14	24	,	,	PUNCT
arestyrurj-238	14	25	is	be	AUX
arestyrurj-238	14	26	a	a	DET
arestyrurj-238	14	27	major	major	ADJ
arestyrurj-238	14	28	source	source	NOUN
arestyrurj-238	14	29	of	of	ADP
arestyrurj-238	14	30	infection	infection	NOUN
arestyrurj-238	14	31	that	that	PRON
arestyrurj-238	14	32	requires	require	VERB
arestyrurj-238	14	33	greater	great	ADJ
arestyrurj-238	14	34	attention	attention	NOUN
arestyrurj-238	14	35	.	.	PUNCT
arestyrurj-238	15	1	gram	gram	NOUN
arestyrurj-238	15	2	-	-	PUNCT
arestyrurj-238	15	3	negative	negative	ADJ
arestyrurj-238	15	4	bacterial	bacterial	ADJ
arestyrurj-238	15	5	infections	infection	NOUN
arestyrurj-238	15	6	tend	tend	VERB
arestyrurj-238	15	7	to	to	PART
arestyrurj-238	15	8	be	be	AUX
arestyrurj-238	15	9	difficult	difficult	ADJ
arestyrurj-238	15	10	to	to	PART
arestyrurj-238	15	11	treat	treat	VERB
arestyrurj-238	15	12	because	because	SCONJ
arestyrurj-238	15	13	they	they	PRON
arestyrurj-238	15	14	have	have	VERB
arestyrurj-238	15	15	an	an	DET
arestyrurj-238	15	16	extra	extra	ADJ
arestyrurj-238	15	17	outer	outer	ADJ
arestyrurj-238	15	18	protective	protective	ADJ
arestyrurj-238	15	19	membrane	membrane	NOUN
arestyrurj-238	15	20	layer	layer	NOUN
arestyrurj-238	15	21	.	.	PUNCT
arestyrurj-238	16	1	due	due	ADP
arestyrurj-238	16	2	to	to	ADP
arestyrurj-238	16	3	buildup	buildup	NOUN
arestyrurj-238	16	4	of	of	ADP
arestyrurj-238	16	5	mucus	mucus	NOUN
arestyrurj-238	16	6	and	and	CCONJ
arestyrurj-238	16	7	formation	formation	NOUN
arestyrurj-238	16	8	of	of	ADP
arestyrurj-238	16	9	bacterial	bacterial	ADJ
arestyrurj-238	16	10	biofilms	biofilm	NOUN
arestyrurj-238	16	11	that	that	PRON
arestyrurj-238	16	12	prevent	prevent	VERB
arestyrurj-238	16	13	the	the	DET
arestyrurj-238	16	14	delivery	delivery	NOUN
arestyrurj-238	16	15	of	of	ADP
arestyrurj-238	16	16	antibiotics	antibiotic	NOUN
arestyrurj-238	16	17	at	at	ADP
arestyrurj-238	16	18	the	the	DET
arestyrurj-238	16	19	levels	level	NOUN
arestyrurj-238	16	20	needed	need	VERB
arestyrurj-238	16	21	for	for	ADP
arestyrurj-238	16	22	bacteria	bacteria	NOUN
arestyrurj-238	16	23	eradication	eradication	NOUN
arestyrurj-238	16	24	,	,	PUNCT
arestyrurj-238	16	25	patients	patient	NOUN
arestyrurj-238	16	26	with	with	ADP
arestyrurj-238	16	27	cystic	cystic	ADJ
arestyrurj-238	16	28	fibrosis	fibrosis	NOUN
arestyrurj-238	16	29	(	(	PUNCT
arestyrurj-238	16	30	cf	cf	NOUN
arestyrurj-238	16	31	)	)	PUNCT
arestyrurj-238	16	32	are	be	AUX
arestyrurj-238	16	33	susceptible	susceptible	ADJ
arestyrurj-238	16	34	to	to	ADP
arestyrurj-238	16	35	developing	develop	VERB
arestyrurj-238	16	36	antibiotic	antibiotic	ADJ
arestyrurj-238	16	37	resistant	resistant	ADJ
arestyrurj-238	16	38	lung	lung	NOUN
arestyrurj-238	16	39	infections	infection	NOUN
arestyrurj-238	16	40	caused	cause	VERB
arestyrurj-238	16	41	by	by	ADP
arestyrurj-238	16	42	bacteria	bacteria	NOUN
arestyrurj-238	16	43	,	,	PUNCT
arestyrurj-238	16	44	of	of	ADP
arestyrurj-238	16	45	which	which	PRON
arestyrurj-238	16	46	the	the	DET
arestyrurj-238	16	47	most	most	ADV
arestyrurj-238	16	48	common	common	ADJ
arestyrurj-238	16	49	in	in	ADP
arestyrurj-238	16	50	adults	adult	NOUN
arestyrurj-238	16	51	is	be	AUX
arestyrurj-238	16	52	p.	p.	NOUN
arestyrurj-238	16	53	aeruginosa	aeruginosa	PROPN
arestyrurj-238	16	54	.	.	PUNCT
arestyrurj-238	17	1	cf	cf	NOUN
arestyrurj-238	17	2	is	be	AUX
arestyrurj-238	17	3	a	a	DET
arestyrurj-238	17	4	recessive	recessive	ADJ
arestyrurj-238	17	5	genetic	genetic	ADJ
arestyrurj-238	17	6	disorder	disorder	NOUN
arestyrurj-238	17	7	that	that	PRON
arestyrurj-238	17	8	arises	arise	VERB
arestyrurj-238	17	9	from	from	ADP
arestyrurj-238	17	10	mutations	mutation	NOUN
arestyrurj-238	17	11	in	in	ADP
arestyrurj-238	17	12	the	the	DET
arestyrurj-238	17	13	cystic	cystic	ADJ
arestyrurj-238	17	14	fibrosis	fibrosis	NOUN
arestyrurj-238	17	15	transmembrane	transmembrane	NOUN
arestyrurj-238	17	16	conductance	conductance	NOUN
arestyrurj-238	17	17	regulator	regulator	NOUN
arestyrurj-238	17	18	(	(	PUNCT
arestyrurj-238	17	19	cftr	cftr	NOUN
arestyrurj-238	17	20	)	)	PUNCT
arestyrurj-238	17	21	gene	gene	NOUN
arestyrurj-238	17	22	.	.	PUNCT
arestyrurj-238	18	1	loss	loss	NOUN
arestyrurj-238	18	2	of	of	ADP
arestyrurj-238	18	3	function	function	NOUN
arestyrurj-238	18	4	of	of	ADP
arestyrurj-238	18	5	the	the	DET
arestyrurj-238	18	6	cftr	cftr	NOUN
arestyrurj-238	18	7	decreases	decrease	VERB
arestyrurj-238	18	8	hydration	hydration	NOUN
arestyrurj-238	18	9	in	in	ADP
arestyrurj-238	18	10	the	the	DET
arestyrurj-238	18	11	airways	airway	NOUN
arestyrurj-238	18	12	,	,	PUNCT
arestyrurj-238	18	13	leading	lead	VERB
arestyrurj-238	18	14	to	to	ADP
arestyrurj-238	18	15	decreased	decrease	VERB
arestyrurj-238	18	16	mucociliary	mucociliary	ADJ
arestyrurj-238	18	17	clearance	clearance	NOUN
arestyrurj-238	18	18	and	and	CCONJ
arestyrurj-238	18	19	bacterial	bacterial	ADJ
arestyrurj-238	18	20	retention	retention	NOUN
arestyrurj-238	18	21	(	(	PUNCT
arestyrurj-238	18	22	allen	allen	NOUN
arestyrurj-238	18	23	et	et	PROPN
arestyrurj-238	18	24	al	al	PROPN
arestyrurj-238	18	25	.	.	PROPN
arestyrurj-238	18	26	,	,	PUNCT
arestyrurj-238	18	27	2020	2020	NUM
arestyrurj-238	18	28	)	)	PUNCT
arestyrurj-238	18	29	.	.	PUNCT
arestyrurj-238	19	1	consequently	consequently	ADV
arestyrurj-238	19	2	,	,	PUNCT
arestyrurj-238	19	3	80	80	NUM
arestyrurj-238	19	4	%	%	NOUN
arestyrurj-238	19	5	of	of	ADP
arestyrurj-238	19	6	cf	cf	NOUN
arestyrurj-238	19	7	patients	patient	NOUN
arestyrurj-238	19	8	develop	develop	VERB
arestyrurj-238	19	9	chronic	chronic	ADJ
arestyrurj-238	19	10	infections	infection	NOUN
arestyrurj-238	19	11	(	(	PUNCT
arestyrurj-238	19	12	moreau	moreau	PROPN
arestyrurj-238	19	13	-	-	PUNCT
arestyrurj-238	19	14	marquis	marquis	PROPN
arestyrurj-238	19	15	et	et	PROPN
arestyrurj-238	19	16	al	al	PROPN
arestyrurj-238	19	17	.	.	PROPN
arestyrurj-238	19	18	,	,	PUNCT
arestyrurj-238	19	19	2008	2008	NUM
arestyrurj-238	19	20	)	)	PUNCT
arestyrurj-238	19	21	.	.	PUNCT
arestyrurj-238	20	1	thus	thus	ADV
arestyrurj-238	20	2	,	,	PUNCT
arestyrurj-238	20	3	there	there	PRON
arestyrurj-238	20	4	is	be	VERB
arestyrurj-238	20	5	a	a	DET
arestyrurj-238	20	6	need	need	NOUN
arestyrurj-238	20	7	for	for	ADP
arestyrurj-238	20	8	the	the	DET
arestyrurj-238	20	9	discovery	discovery	NOUN
arestyrurj-238	20	10	of	of	ADP
arestyrurj-238	20	11	new	new	ADJ
arestyrurj-238	20	12	antibiotic	antibiotic	ADJ
arestyrurj-238	20	13	agents	agent	NOUN
arestyrurj-238	20	14	.	.	PUNCT
arestyrurj-238	21	1	antimicrobial	antimicrobial	ADJ
arestyrurj-238	21	2	peptides	peptide	NOUN
arestyrurj-238	21	3	(	(	PUNCT
arestyrurj-238	21	4	amps	amp	NOUN
arestyrurj-238	21	5	)	)	PUNCT
arestyrurj-238	21	6	are	be	AUX
arestyrurj-238	21	7	a	a	DET
arestyrurj-238	21	8	class	class	NOUN
arestyrurj-238	21	9	of	of	ADP
arestyrurj-238	21	10	small	small	ADJ
arestyrurj-238	21	11	peptides	peptide	NOUN
arestyrurj-238	21	12	that	that	PRON
arestyrurj-238	21	13	exist	exist	VERB
arestyrurj-238	21	14	in	in	ADP
arestyrurj-238	21	15	nature	nature	NOUN
arestyrurj-238	21	16	.	.	PUNCT
arestyrurj-238	22	1	because	because	SCONJ
arestyrurj-238	22	2	they	they	PRON
arestyrurj-238	22	3	exhibit	exhibit	VERB
arestyrurj-238	22	4	a	a	DET
arestyrurj-238	22	5	broad	broad	ADJ
arestyrurj-238	22	6	range	range	NOUN
arestyrurj-238	22	7	of	of	ADP
arestyrurj-238	22	8	activity	activity	NOUN
arestyrurj-238	22	9	against	against	ADP
arestyrurj-238	22	10	various	various	ADJ
arestyrurj-238	22	11	bacteria	bacteria	NOUN
arestyrurj-238	22	12	,	,	PUNCT
arestyrurj-238	22	13	amps	amp	NOUN
arestyrurj-238	22	14	hold	hold	VERB
arestyrurj-238	22	15	potential	potential	ADJ
arestyrurj-238	22	16	as	as	ADP
arestyrurj-238	22	17	small	small	ADJ
arestyrurj-238	22	18	molecule	molecule	NOUN
arestyrurj-238	22	19	antibiotics	antibiotic	NOUN
arestyrurj-238	22	20	(	(	PUNCT
arestyrurj-238	22	21	ageitos	ageitos	NOUN
arestyrurj-238	22	22	et	et	PROPN
arestyrurj-238	22	23	al	al	PROPN
arestyrurj-238	22	24	.	.	PROPN
arestyrurj-238	22	25	,	,	PUNCT
arestyrurj-238	22	26	2017	2017	NUM
arestyrurj-238	22	27	)	)	PUNCT
arestyrurj-238	22	28	.	.	PUNCT
arestyrurj-238	23	1	amps	amp	NOUN
arestyrurj-238	23	2	have	have	VERB
arestyrurj-238	23	3	various	various	ADJ
arestyrurj-238	23	4	modes	mode	NOUN
arestyrurj-238	23	5	of	of	ADP
arestyrurj-238	23	6	action	action	NOUN
arestyrurj-238	23	7	.	.	PUNCT
arestyrurj-238	24	1	first	first	ADV
arestyrurj-238	24	2	,	,	PUNCT
arestyrurj-238	24	3	amps	amp	NOUN
arestyrurj-238	24	4	can	can	AUX
arestyrurj-238	24	5	directly	directly	ADV
arestyrurj-238	24	6	kill	kill	VERB
arestyrurj-238	24	7	bacteria	bacteria	NOUN
arestyrurj-238	24	8	by	by	ADP
arestyrurj-238	24	9	disrupting	disrupt	VERB
arestyrurj-238	24	10	the	the	DET
arestyrurj-238	24	11	cell	cell	NOUN
arestyrurj-238	24	12	membrane	membrane	NOUN
arestyrurj-238	24	13	.	.	PUNCT
arestyrurj-238	25	1	amps	amp	NOUN
arestyrurj-238	25	2	can	can	AUX
arestyrurj-238	25	3	destabilize	destabilize	VERB
arestyrurj-238	25	4	and	and	CCONJ
arestyrurj-238	25	5	permeabilize	permeabilize	VERB
arestyrurj-238	25	6	the	the	DET
arestyrurj-238	25	7	bacterial	bacterial	ADJ
arestyrurj-238	25	8	cell	cell	NOUN
arestyrurj-238	25	9	membrane	membrane	NOUN
arestyrurj-238	25	10	through	through	ADP
arestyrurj-238	25	11	both	both	CCONJ
arestyrurj-238	25	12	hydrophobic	hydrophobic	ADJ
arestyrurj-238	25	13	and	and	CCONJ
arestyrurj-238	25	14	electrostatic	electrostatic	ADJ
arestyrurj-238	25	15	interactions	interaction	NOUN
arestyrurj-238	25	16	.	.	PUNCT
arestyrurj-238	26	1	in	in	ADP
arestyrurj-238	26	2	many	many	ADJ
arestyrurj-238	26	3	cases	case	NOUN
arestyrurj-238	26	4	,	,	PUNCT
arestyrurj-238	26	5	the	the	DET
arestyrurj-238	26	6	positive	positive	ADJ
arestyrurj-238	26	7	net	net	ADJ
arestyrurj-238	26	8	charge	charge	NOUN
arestyrurj-238	26	9	of	of	ADP
arestyrurj-238	26	10	amps	amp	NOUN
arestyrurj-238	26	11	allows	allow	VERB
arestyrurj-238	26	12	them	they	PRON
arestyrurj-238	26	13	to	to	PART
arestyrurj-238	26	14	interact	interact	VERB
arestyrurj-238	26	15	with	with	ADP
arestyrurj-238	26	16	the	the	DET
arestyrurj-238	26	17	negatively	negatively	ADV
arestyrurj-238	26	18	charged	charge	VERB
arestyrurj-238	26	19	regions	region	NOUN
arestyrurj-238	26	20	of	of	ADP
arestyrurj-238	26	21	the	the	DET
arestyrurj-238	26	22	aresty	aresty	ADJ
arestyrurj-238	26	23	rutgers	rutgers	PROPN
arestyrurj-238	26	24	undergraduate	undergraduate	PROPN
arestyrurj-238	26	25	research	research	PROPN
arestyrurj-238	26	26	journal	journal	PROPN
arestyrurj-238	26	27	,	,	PUNCT
arestyrurj-238	26	28	volume	volume	NOUN
arestyrurj-238	26	29	i	i	PRON
arestyrurj-238	26	30	,	,	PUNCT
arestyrurj-238	26	31	issue	issue	NOUN
arestyrurj-238	26	32	v	v	ADP
arestyrurj-238	26	33	bacterial	bacterial	ADJ
arestyrurj-238	26	34	surface	surface	NOUN
arestyrurj-238	26	35	.	.	PUNCT
arestyrurj-238	27	1	these	these	DET
arestyrurj-238	27	2	interactions	interaction	NOUN
arestyrurj-238	27	3	often	often	ADV
arestyrurj-238	27	4	lead	lead	VERB
arestyrurj-238	27	5	to	to	ADP
arestyrurj-238	27	6	the	the	DET
arestyrurj-238	27	7	formation	formation	NOUN
arestyrurj-238	27	8	of	of	ADP
arestyrurj-238	27	9	membrane	membrane	NOUN
arestyrurj-238	27	10	pores	pore	NOUN
arestyrurj-238	27	11	resulting	result	VERB
arestyrurj-238	27	12	in	in	ADP
arestyrurj-238	27	13	lysis	lysis	NOUN
arestyrurj-238	27	14	,	,	PUNCT
arestyrurj-238	27	15	or	or	CCONJ
arestyrurj-238	27	16	the	the	DET
arestyrurj-238	27	17	rupture	rupture	NOUN
arestyrurj-238	27	18	of	of	ADP
arestyrurj-238	27	19	the	the	DET
arestyrurj-238	27	20	cell	cell	NOUN
arestyrurj-238	27	21	membrane	membrane	NOUN
arestyrurj-238	27	22	(	(	PUNCT
arestyrurj-238	27	23	li	li	PROPN
arestyrurj-238	27	24	et	et	PROPN
arestyrurj-238	27	25	al	al	PROPN
arestyrurj-238	27	26	.	.	PROPN
arestyrurj-238	27	27	,	,	PUNCT
arestyrurj-238	27	28	2021	2021	NUM
arestyrurj-238	27	29	)	)	PUNCT
arestyrurj-238	27	30	.	.	PUNCT
arestyrurj-238	28	1	second	second	ADV
arestyrurj-238	28	2	,	,	PUNCT
arestyrurj-238	28	3	amps	amp	NOUN
arestyrurj-238	28	4	can	can	AUX
arestyrurj-238	28	5	prevent	prevent	VERB
arestyrurj-238	28	6	the	the	DET
arestyrurj-238	28	7	formation	formation	NOUN
arestyrurj-238	28	8	of	of	ADP
arestyrurj-238	28	9	bacterial	bacterial	ADJ
arestyrurj-238	28	10	cell	cell	NOUN
arestyrurj-238	28	11	walls	wall	NOUN
arestyrurj-238	28	12	by	by	ADP
arestyrurj-238	28	13	blocking	block	VERB
arestyrurj-238	28	14	peptidoglycan	peptidoglycan	ADJ
arestyrurj-238	28	15	elongation	elongation	NOUN
arestyrurj-238	28	16	.	.	PUNCT
arestyrurj-238	29	1	peptidoglycan	peptidoglycan	PROPN
arestyrurj-238	29	2	is	be	AUX
arestyrurj-238	29	3	a	a	DET
arestyrurj-238	29	4	polymer	polymer	NOUN
arestyrurj-238	29	5	consisting	consist	VERB
arestyrurj-238	29	6	of	of	ADP
arestyrurj-238	29	7	sugar	sugar	NOUN
arestyrurj-238	29	8	chains	chain	NOUN
arestyrurj-238	29	9	interlinked	interlink	VERB
arestyrurj-238	29	10	with	with	ADP
arestyrurj-238	29	11	peptides	peptide	NOUN
arestyrurj-238	29	12	.	.	PUNCT
arestyrurj-238	30	1	since	since	SCONJ
arestyrurj-238	30	2	the	the	DET
arestyrurj-238	30	3	bacterial	bacterial	ADJ
arestyrurj-238	30	4	cell	cell	NOUN
arestyrurj-238	30	5	wall	wall	NOUN
arestyrurj-238	30	6	is	be	AUX
arestyrurj-238	30	7	an	an	DET
arestyrurj-238	30	8	essential	essential	ADJ
arestyrurj-238	30	9	protective	protective	ADJ
arestyrurj-238	30	10	barrier	barrier	NOUN
arestyrurj-238	30	11	and	and	CCONJ
arestyrurj-238	30	12	reinforces	reinforce	VERB
arestyrurj-238	30	13	cell	cell	NOUN
arestyrurj-238	30	14	shape	shape	NOUN
arestyrurj-238	30	15	,	,	PUNCT
arestyrurj-238	30	16	inhibiting	inhibit	VERB
arestyrurj-238	30	17	cell	cell	NOUN
arestyrurj-238	30	18	wall	wall	NOUN
arestyrurj-238	30	19	biosynthesis	biosynthesis	NOUN
arestyrurj-238	30	20	effectively	effectively	ADV
arestyrurj-238	30	21	kills	kill	VERB
arestyrurj-238	30	22	the	the	DET
arestyrurj-238	30	23	bacteria	bacteria	NOUN
arestyrurj-238	30	24	(	(	PUNCT
arestyrurj-238	30	25	chen	chen	PROPN
arestyrurj-238	30	26	et	et	PROPN
arestyrurj-238	30	27	al	al	PROPN
arestyrurj-238	30	28	.	.	PROPN
arestyrurj-238	30	29	,	,	PUNCT
arestyrurj-238	30	30	2020	2020	NUM
arestyrurj-238	30	31	)	)	PUNCT
arestyrurj-238	30	32	.	.	PUNCT
arestyrurj-238	31	1	third	third	ADV
arestyrurj-238	31	2	,	,	PUNCT
arestyrurj-238	31	3	amps	amp	NOUN
arestyrurj-238	31	4	can	can	AUX
arestyrurj-238	31	5	penetrate	penetrate	VERB
arestyrurj-238	31	6	the	the	DET
arestyrurj-238	31	7	cell	cell	NOUN
arestyrurj-238	31	8	membrane	membrane	NOUN
arestyrurj-238	31	9	and	and	CCONJ
arestyrurj-238	31	10	act	act	VERB
arestyrurj-238	31	11	on	on	ADP
arestyrurj-238	31	12	intracellular	intracellular	ADJ
arestyrurj-238	31	13	targets	target	NOUN
arestyrurj-238	31	14	,	,	PUNCT
arestyrurj-238	31	15	including	include	VERB
arestyrurj-238	31	16	rna	rna	PROPN
arestyrurj-238	31	17	,	,	PUNCT
arestyrurj-238	31	18	dna	dna	NOUN
arestyrurj-238	31	19	,	,	PUNCT
arestyrurj-238	31	20	and	and	CCONJ
arestyrurj-238	31	21	ribosomes	ribosome	NOUN
arestyrurj-238	31	22	.	.	PUNCT
arestyrurj-238	32	1	although	although	SCONJ
arestyrurj-238	32	2	this	this	DET
arestyrurj-238	32	3	mode	mode	NOUN
arestyrurj-238	32	4	of	of	ADP
arestyrurj-238	32	5	action	action	NOUN
arestyrurj-238	32	6	does	do	AUX
arestyrurj-238	32	7	not	not	PART
arestyrurj-238	32	8	result	result	VERB
arestyrurj-238	32	9	in	in	ADP
arestyrurj-238	32	10	cell	cell	NOUN
arestyrurj-238	32	11	lysis	lysis	NOUN
arestyrurj-238	32	12	,	,	PUNCT
arestyrurj-238	32	13	it	it	PRON
arestyrurj-238	32	14	interferes	interfere	VERB
arestyrurj-238	32	15	with	with	ADP
arestyrurj-238	32	16	bacterial	bacterial	ADJ
arestyrurj-238	32	17	bioprocesses	bioprocesse	NOUN
arestyrurj-238	32	18	.	.	PUNCT
arestyrurj-238	33	1	for	for	ADP
arestyrurj-238	33	2	instance	instance	NOUN
arestyrurj-238	33	3	,	,	PUNCT
arestyrurj-238	33	4	some	some	DET
arestyrurj-238	33	5	amps	amp	NOUN
arestyrurj-238	33	6	block	block	NOUN
arestyrurj-238	33	7	translation	translation	NOUN
arestyrurj-238	33	8	initiation	initiation	NOUN
arestyrurj-238	33	9	by	by	ADP
arestyrurj-238	33	10	binding	bind	VERB
arestyrurj-238	33	11	to	to	ADP
arestyrurj-238	33	12	the	the	DET
arestyrurj-238	33	13	p	p	NOUN
arestyrurj-238	33	14	-	-	PUNCT
arestyrurj-238	33	15	site	site	NOUN
arestyrurj-238	33	16	on	on	ADP
arestyrurj-238	33	17	ribosomes	ribosome	NOUN
arestyrurj-238	33	18	,	,	PUNCT
arestyrurj-238	33	19	while	while	SCONJ
arestyrurj-238	33	20	others	other	NOUN
arestyrurj-238	33	21	inhibit	inhibit	VERB
arestyrurj-238	33	22	protein	protein	NOUN
arestyrurj-238	33	23	synthesis	synthesis	NOUN
arestyrurj-238	33	24	by	by	ADP
arestyrurj-238	33	25	preventing	prevent	VERB
arestyrurj-238	33	26	rna	rna	NOUN
arestyrurj-238	33	27	splicing	splicing	NOUN
arestyrurj-238	33	28	post	post	NOUN
arestyrurj-238	33	29	-	-	NOUN
arestyrurj-238	33	30	transcription	transcription	NOUN
arestyrurj-238	33	31	(	(	PUNCT
arestyrurj-238	33	32	ageitos	ageitos	NOUN
arestyrurj-238	33	33	et	et	NOUN
arestyrurj-238	33	34	al	al	PROPN
arestyrurj-238	33	35	.	.	PROPN
arestyrurj-238	33	36	,	,	PUNCT
arestyrurj-238	33	37	2017	2017	NUM
arestyrurj-238	33	38	)	)	PUNCT
arestyrurj-238	33	39	.	.	PUNCT
arestyrurj-238	34	1	promising	promise	VERB
arestyrurj-238	34	2	amps	amp	NOUN
arestyrurj-238	34	3	proposed	propose	VERB
arestyrurj-238	34	4	in	in	ADP
arestyrurj-238	34	5	literature	literature	NOUN
arestyrurj-238	34	6	,	,	PUNCT
arestyrurj-238	34	7	particularly	particularly	ADV
arestyrurj-238	34	8	cationic	cationic	ADJ
arestyrurj-238	34	9	antimicrobial	antimicrobial	ADJ
arestyrurj-238	34	10	peptides	peptide	NOUN
arestyrurj-238	34	11	(	(	PUNCT
arestyrurj-238	34	12	camps	camp	NOUN
arestyrurj-238	34	13	)	)	PUNCT
arestyrurj-238	34	14	—	—	PUNCT
arestyrurj-238	34	15	i.e.	i.e.	X
arestyrurj-238	34	16	,	,	PUNCT
arestyrurj-238	34	17	amps	amp	NOUN
arestyrurj-238	34	18	that	that	PRON
arestyrurj-238	34	19	have	have	VERB
arestyrurj-238	34	20	an	an	DET
arestyrurj-238	34	21	overall	overall	ADJ
arestyrurj-238	34	22	net	net	ADJ
arestyrurj-238	34	23	positive	positive	ADJ
arestyrurj-238	34	24	charge	charge	NOUN
arestyrurj-238	34	25	—	—	PUNCT
arestyrurj-238	34	26	suggest	suggest	VERB
arestyrurj-238	34	27	that	that	SCONJ
arestyrurj-238	34	28	certain	certain	ADJ
arestyrurj-238	34	29	characteristics	characteristic	NOUN
arestyrurj-238	34	30	of	of	ADP
arestyrurj-238	34	31	peptides	peptide	NOUN
arestyrurj-238	34	32	favor	favor	VERB
arestyrurj-238	34	33	activity	activity	NOUN
arestyrurj-238	34	34	against	against	ADP
arestyrurj-238	34	35	gram	gram	NOUN
arestyrurj-238	34	36	-	-	PUNCT
arestyrurj-238	34	37	negative	negative	ADJ
arestyrurj-238	34	38	bacterial	bacterial	ADJ
arestyrurj-238	34	39	infections	infection	NOUN
arestyrurj-238	34	40	,	,	PUNCT
arestyrurj-238	34	41	such	such	ADJ
arestyrurj-238	34	42	as	as	ADP
arestyrurj-238	34	43	those	those	PRON
arestyrurj-238	34	44	caused	cause	VERB
arestyrurj-238	34	45	by	by	ADP
arestyrurj-238	34	46	p.	p.	PROPN
arestyrurj-238	34	47	aeruginosa	aeruginosa	PROPN
arestyrurj-238	34	48	(	(	PUNCT
arestyrurj-238	34	49	lei	lei	X
arestyrurj-238	34	50	et	et	PROPN
arestyrurj-238	34	51	al	al	PROPN
arestyrurj-238	34	52	.	.	PROPN
arestyrurj-238	34	53	,	,	PUNCT
arestyrurj-238	34	54	2019	2019	NUM
arestyrurj-238	34	55	)	)	PUNCT
arestyrurj-238	34	56	.	.	PUNCT
arestyrurj-238	35	1	although	although	SCONJ
arestyrurj-238	35	2	amps	amp	NOUN
arestyrurj-238	35	3	have	have	AUX
arestyrurj-238	35	4	been	be	AUX
arestyrurj-238	35	5	documented	document	VERB
arestyrurj-238	35	6	in	in	ADP
arestyrurj-238	35	7	databases	database	NOUN
arestyrurj-238	35	8	,	,	PUNCT
arestyrurj-238	35	9	in	in	ADP
arestyrurj-238	35	10	many	many	ADJ
arestyrurj-238	35	11	cases	case	NOUN
arestyrurj-238	35	12	,	,	PUNCT
arestyrurj-238	35	13	their	their	PRON
arestyrurj-238	35	14	microbiological	microbiological	ADJ
arestyrurj-238	35	15	activity	activity	NOUN
arestyrurj-238	35	16	is	be	AUX
arestyrurj-238	35	17	not	not	PART
arestyrurj-238	35	18	established	establish	VERB
arestyrurj-238	35	19	.	.	PUNCT
arestyrurj-238	36	1	the	the	DET
arestyrurj-238	36	2	rules	rule	NOUN
arestyrurj-238	36	3	governing	govern	VERB
arestyrurj-238	36	4	which	which	DET
arestyrurj-238	36	5	peptides	peptide	NOUN
arestyrurj-238	36	6	are	be	AUX
arestyrurj-238	36	7	likely	likely	ADJ
arestyrurj-238	36	8	to	to	PART
arestyrurj-238	36	9	be	be	AUX
arestyrurj-238	36	10	effective	effective	ADJ
arestyrurj-238	36	11	are	be	AUX
arestyrurj-238	36	12	not	not	PART
arestyrurj-238	36	13	understood	understand	VERB
arestyrurj-238	36	14	,	,	PUNCT
arestyrurj-238	36	15	especially	especially	ADV
arestyrurj-238	36	16	for	for	ADP
arestyrurj-238	36	17	a	a	DET
arestyrurj-238	36	18	specific	specific	ADJ
arestyrurj-238	36	19	species	specie	NOUN
arestyrurj-238	36	20	of	of	ADP
arestyrurj-238	36	21	bacteria	bacteria	NOUN
arestyrurj-238	36	22	such	such	ADJ
arestyrurj-238	36	23	as	as	ADP
arestyrurj-238	36	24	p.	p.	PROPN
arestyrurj-238	36	25	aeruginosa	aeruginosa	PROPN
arestyrurj-238	36	26	(	(	PUNCT
arestyrurj-238	36	27	ramazi	ramazi	PROPN
arestyrurj-238	36	28	et	et	PROPN
arestyrurj-238	36	29	al	al	PROPN
arestyrurj-238	36	30	.	.	PROPN
arestyrurj-238	36	31	,	,	PUNCT
arestyrurj-238	36	32	2022	2022	NUM
arestyrurj-238	36	33	)	)	PUNCT
arestyrurj-238	36	34	.	.	PUNCT
arestyrurj-238	37	1	thus	thus	ADV
arestyrurj-238	37	2	,	,	PUNCT
arestyrurj-238	37	3	we	we	PRON
arestyrurj-238	37	4	propose	propose	VERB
arestyrurj-238	37	5	to	to	PART
arestyrurj-238	37	6	use	use	VERB
arestyrurj-238	37	7	database	database	NOUN
arestyrurj-238	37	8	analysis	analysis	NOUN
arestyrurj-238	37	9	to	to	PART
arestyrurj-238	37	10	explore	explore	VERB
arestyrurj-238	37	11	the	the	DET
arestyrurj-238	37	12	relationship	relationship	NOUN
arestyrurj-238	37	13	between	between	ADP
arestyrurj-238	37	14	biophysical	biophysical	ADJ
arestyrurj-238	37	15	properties	property	NOUN
arestyrurj-238	37	16	of	of	ADP
arestyrurj-238	37	17	amps	amp	NOUN
arestyrurj-238	37	18	and	and	CCONJ
arestyrurj-238	37	19	their	their	PRON
arestyrurj-238	37	20	corresponding	correspond	VERB
arestyrurj-238	37	21	effectiveness	effectiveness	NOUN
arestyrurj-238	37	22	.	.	PUNCT
arestyrurj-238	38	1	we	we	PRON
arestyrurj-238	38	2	define	define	VERB
arestyrurj-238	38	3	effectiveness	effectiveness	NOUN
arestyrurj-238	38	4	based	base	VERB
arestyrurj-238	38	5	on	on	ADP
arestyrurj-238	38	6	a	a	DET
arestyrurj-238	38	7	peptide	peptide	NOUN
arestyrurj-238	38	8	’s	’s	PART
arestyrurj-238	38	9	minimum	minimum	ADJ
arestyrurj-238	38	10	inhibitory	inhibitory	ADJ
arestyrurj-238	38	11	concentration	concentration	NOUN
arestyrurj-238	38	12	(	(	PUNCT
arestyrurj-238	38	13	mic	mic	NOUN
arestyrurj-238	38	14	)	)	PUNCT
arestyrurj-238	38	15	,	,	PUNCT
arestyrurj-238	38	16	which	which	PRON
arestyrurj-238	38	17	is	be	AUX
arestyrurj-238	38	18	the	the	DET
arestyrurj-238	38	19	lowest	low	ADJ
arestyrurj-238	38	20	concentration	concentration	NOUN
arestyrurj-238	38	21	of	of	ADP
arestyrurj-238	38	22	peptide	peptide	NOUN
arestyrurj-238	38	23	that	that	PRON
arestyrurj-238	38	24	prevents	prevent	VERB
arestyrurj-238	38	25	visible	visible	ADJ
arestyrurj-238	38	26	bacterial	bacterial	ADJ
arestyrurj-238	38	27	growth	growth	NOUN
arestyrurj-238	38	28	.	.	PUNCT
arestyrurj-238	39	1	we	we	PRON
arestyrurj-238	39	2	selected	select	VERB
arestyrurj-238	39	3	the	the	DET
arestyrurj-238	39	4	database	database	NOUN
arestyrurj-238	39	5	of	of	ADP
arestyrurj-238	39	6	antimicrobial	antimicrobial	ADJ
arestyrurj-238	39	7	activity	activity	NOUN
arestyrurj-238	39	8	and	and	CCONJ
arestyrurj-238	39	9	structure	structure	NOUN
arestyrurj-238	39	10	of	of	ADP
arestyrurj-238	39	11	peptides	peptide	NOUN
arestyrurj-238	39	12	(	(	PUNCT
arestyrurj-238	39	13	dbaasp	dbaasp	NOUN
arestyrurj-238	39	14	)	)	PUNCT
arestyrurj-238	39	15	for	for	ADP
arestyrurj-238	39	16	our	our	PRON
arestyrurj-238	39	17	studies	study	NOUN
arestyrurj-238	39	18	.	.	PUNCT
arestyrurj-238	40	1	a	a	DET
arestyrurj-238	40	2	set	set	NOUN
arestyrurj-238	40	3	of	of	ADP
arestyrurj-238	40	4	candidate	candidate	NOUN
arestyrurj-238	40	5	peptides	peptide	NOUN
arestyrurj-238	40	6	designed	design	VERB
arestyrurj-238	40	7	to	to	PART
arestyrurj-238	40	8	be	be	AUX
arestyrurj-238	40	9	efficacious	efficacious	ADJ
arestyrurj-238	40	10	will	will	AUX
arestyrurj-238	40	11	be	be	AUX
arestyrurj-238	40	12	identified	identify	VERB
arestyrurj-238	40	13	and	and	CCONJ
arestyrurj-238	40	14	tested	test	VERB
arestyrurj-238	40	15	against	against	ADP
arestyrurj-238	40	16	clinical	clinical	ADJ
arestyrurj-238	40	17	strains	strain	NOUN
arestyrurj-238	40	18	of	of	ADP
arestyrurj-238	40	19	p.	p.	NOUN
arestyrurj-238	40	20	aeruginosa	aeruginosa	PROPN
arestyrurj-238	40	21	.	.	PUNCT
arestyrurj-238	41	1	3	3	NUM
arestyrurj-238	41	2	methodology	methodology	NOUN
arestyrurj-238	41	3	database	database	NOUN
arestyrurj-238	41	4	selection	selection	NOUN
arestyrurj-238	41	5	and	and	CCONJ
arestyrurj-238	41	6	filtering	filter	VERB
arestyrurj-238	41	7	numerous	numerous	ADJ
arestyrurj-238	41	8	databases	database	NOUN
arestyrurj-238	41	9	have	have	AUX
arestyrurj-238	41	10	been	be	AUX
arestyrurj-238	41	11	constructed	construct	VERB
arestyrurj-238	41	12	to	to	PART
arestyrurj-238	41	13	provide	provide	VERB
arestyrurj-238	41	14	classified	classified	ADJ
arestyrurj-238	41	15	information	information	NOUN
arestyrurj-238	41	16	for	for	ADP
arestyrurj-238	41	17	productive	productive	ADJ
arestyrurj-238	41	18	amp	amp	NOUN
arestyrurj-238	41	19	design	design	NOUN
arestyrurj-238	41	20	and	and	CCONJ
arestyrurj-238	41	21	research	research	NOUN
arestyrurj-238	41	22	.	.	PUNCT
arestyrurj-238	42	1	the	the	DET
arestyrurj-238	42	2	dbaasp	dbaasp	NOUN
arestyrurj-238	42	3	is	be	AUX
arestyrurj-238	42	4	one	one	NUM
arestyrurj-238	42	5	of	of	ADP
arestyrurj-238	42	6	the	the	DET
arestyrurj-238	42	7	larger	large	ADJ
arestyrurj-238	42	8	amp	amp	NOUN
arestyrurj-238	42	9	databases	database	NOUN
arestyrurj-238	42	10	,	,	PUNCT
arestyrurj-238	42	11	since	since	SCONJ
arestyrurj-238	42	12	it	it	PRON
arestyrurj-238	42	13	contains	contain	VERB
arestyrurj-238	42	14	information	information	NOUN
arestyrurj-238	42	15	on	on	ADP
arestyrurj-238	42	16	both	both	CCONJ
arestyrurj-238	42	17	synthetic	synthetic	ADJ
arestyrurj-238	42	18	and	and	CCONJ
arestyrurj-238	42	19	natural	natural	ADJ
arestyrurj-238	42	20	peptides	peptide	NOUN
arestyrurj-238	42	21	(	(	PUNCT
arestyrurj-238	42	22	pirtskhalava	pirtskhalava	NOUN
arestyrurj-238	42	23	et	et	PROPN
arestyrurj-238	42	24	al	al	PROPN
arestyrurj-238	42	25	.	.	PROPN
arestyrurj-238	42	26	,	,	PUNCT
arestyrurj-238	42	27	2021	2021	NUM
arestyrurj-238	42	28	)	)	PUNCT
arestyrurj-238	42	29	.	.	PUNCT
arestyrurj-238	43	1	the	the	DET
arestyrurj-238	43	2	inclusion	inclusion	NOUN
arestyrurj-238	43	3	of	of	ADP
arestyrurj-238	43	4	both	both	CCONJ
arestyrurj-238	43	5	synthetic	synthetic	ADJ
arestyrurj-238	43	6	and	and	CCONJ
arestyrurj-238	43	7	natural	natural	ADJ
arestyrurj-238	43	8	peptides	peptide	NOUN
arestyrurj-238	43	9	widens	widen	VERB
arestyrurj-238	43	10	the	the	DET
arestyrurj-238	43	11	scope	scope	NOUN
arestyrurj-238	43	12	of	of	ADP
arestyrurj-238	43	13	antimicrobial	antimicrobial	ADJ
arestyrurj-238	43	14	research	research	NOUN
arestyrurj-238	43	15	and	and	CCONJ
arestyrurj-238	43	16	development	development	NOUN
arestyrurj-238	43	17	by	by	ADP
arestyrurj-238	43	18	allowing	allow	VERB
arestyrurj-238	43	19	for	for	ADP
arestyrurj-238	43	20	a	a	DET
arestyrurj-238	43	21	more	more	ADV
arestyrurj-238	43	22	comprehensive	comprehensive	ADJ
arestyrurj-238	43	23	exploration	exploration	NOUN
arestyrurj-238	43	24	of	of	ADP
arestyrurj-238	43	25	the	the	DET
arestyrurj-238	43	26	peptide	peptide	NOUN
arestyrurj-238	43	27	design	design	NOUN
arestyrurj-238	43	28	space	space	NOUN
arestyrurj-238	43	29	.	.	PUNCT
arestyrurj-238	44	1	at	at	ADP
arestyrurj-238	44	2	the	the	DET
arestyrurj-238	44	3	time	time	NOUN
arestyrurj-238	44	4	of	of	ADP
arestyrurj-238	44	5	use	use	NOUN
arestyrurj-238	44	6	,	,	PUNCT
arestyrurj-238	44	7	the	the	DET
arestyrurj-238	44	8	dbaasp	dbaasp	NOUN
arestyrurj-238	44	9	contained	contain	VERB
arestyrurj-238	44	10	information	information	NOUN
arestyrurj-238	44	11	on	on	ADP
arestyrurj-238	44	12	18,000	18,000	NUM
arestyrurj-238	44	13	+	+	NUM
arestyrurj-238	44	14	peptides	peptide	NOUN
arestyrurj-238	44	15	.	.	PUNCT
arestyrurj-238	45	1	however	however	ADV
arestyrurj-238	45	2	,	,	PUNCT
arestyrurj-238	45	3	the	the	DET
arestyrurj-238	45	4	complete	complete	ADJ
arestyrurj-238	45	5	dbaasp	dbaasp	NOUN
arestyrurj-238	45	6	data	datum	NOUN
arestyrurj-238	45	7	set	set	VERB
arestyrurj-238	45	8	file	file	NOUN
arestyrurj-238	45	9	contained	contain	VERB
arestyrurj-238	45	10	150,000	150,000	NUM
arestyrurj-238	45	11	+	+	NUM
arestyrurj-238	45	12	entries	entry	NOUN
arestyrurj-238	45	13	;	;	PUNCT
arestyrurj-238	45	14	several	several	ADJ
arestyrurj-238	45	15	peptides	peptide	NOUN
arestyrurj-238	45	16	had	have	VERB
arestyrurj-238	45	17	multiple	multiple	ADJ
arestyrurj-238	45	18	data	datum	NOUN
arestyrurj-238	45	19	entries	entry	NOUN
arestyrurj-238	45	20	containing	contain	VERB
arestyrurj-238	45	21	results	result	NOUN
arestyrurj-238	45	22	from	from	ADP
arestyrurj-238	45	23	different	different	ADJ
arestyrurj-238	45	24	experiments	experiment	NOUN
arestyrurj-238	45	25	.	.	PUNCT
arestyrurj-238	46	1	we	we	PRON
arestyrurj-238	46	2	implemented	implement	VERB
arestyrurj-238	46	3	initial	initial	ADJ
arestyrurj-238	46	4	conditions	condition	NOUN
arestyrurj-238	46	5	to	to	PART
arestyrurj-238	46	6	acquire	acquire	VERB
arestyrurj-238	46	7	a	a	DET
arestyrurj-238	46	8	suitable	suitable	ADJ
arestyrurj-238	46	9	subset	subset	NOUN
arestyrurj-238	46	10	.	.	PUNCT
arestyrurj-238	47	1	for	for	ADP
arestyrurj-238	47	2	the	the	DET
arestyrurj-238	47	3	dbaasp	dbaasp	NOUN
arestyrurj-238	47	4	,	,	PUNCT
arestyrurj-238	47	5	selected	select	VERB
arestyrurj-238	47	6	peptides	peptide	NOUN
arestyrurj-238	47	7	must	must	AUX
arestyrurj-238	47	8	be	be	AUX
arestyrurj-238	47	9	monomers	monomer	NOUN
arestyrurj-238	47	10	,	,	PUNCT
arestyrurj-238	47	11	can	can	AUX
arestyrurj-238	47	12	not	not	PART
arestyrurj-238	47	13	contain	contain	VERB
arestyrurj-238	47	14	any	any	DET
arestyrurj-238	47	15	damino	damino	NOUN
arestyrurj-238	47	16	acids	acid	NOUN
arestyrurj-238	47	17	(	(	PUNCT
arestyrurj-238	47	18	as	as	SCONJ
arestyrurj-238	47	19	we	we	PRON
arestyrurj-238	47	20	do	do	AUX
arestyrurj-238	47	21	not	not	PART
arestyrurj-238	47	22	wish	wish	VERB
arestyrurj-238	47	23	to	to	PART
arestyrurj-238	47	24	work	work	VERB
arestyrurj-238	47	25	with	with	ADP
arestyrurj-238	47	26	synthetic	synthetic	ADJ
arestyrurj-238	47	27	amino	amino	NOUN
arestyrurj-238	47	28	acids	acid	NOUN
arestyrurj-238	47	29	)	)	PUNCT
arestyrurj-238	47	30	,	,	PUNCT
arestyrurj-238	47	31	and	and	CCONJ
arestyrurj-238	47	32	can	can	AUX
arestyrurj-238	47	33	not	not	PART
arestyrurj-238	47	34	contain	contain	VERB
arestyrurj-238	47	35	any	any	DET
arestyrurj-238	47	36	uncommon	uncommon	ADJ
arestyrurj-238	47	37	or	or	CCONJ
arestyrurj-238	47	38	variable	variable	ADJ
arestyrurj-238	47	39	amino	amino	NOUN
arestyrurj-238	47	40	acids	acid	NOUN
arestyrurj-238	47	41	.	.	PUNCT
arestyrurj-238	48	1	these	these	DET
arestyrurj-238	48	2	conditions	condition	NOUN
arestyrurj-238	48	3	ensure	ensure	VERB
arestyrurj-238	48	4	that	that	SCONJ
arestyrurj-238	48	5	the	the	DET
arestyrurj-238	48	6	subset	subset	NOUN
arestyrurj-238	48	7	consists	consist	VERB
arestyrurj-238	48	8	of	of	ADP
arestyrurj-238	48	9	peptides	peptide	NOUN
arestyrurj-238	48	10	,	,	PUNCT
arestyrurj-238	48	11	not	not	PART
arestyrurj-238	48	12	proteins	protein	NOUN
arestyrurj-238	48	13	,	,	PUNCT
arestyrurj-238	48	14	that	that	PRON
arestyrurj-238	48	15	are	be	AUX
arestyrurj-238	48	16	more	more	ADV
arestyrurj-238	48	17	likely	likely	ADJ
arestyrurj-238	48	18	to	to	PART
arestyrurj-238	48	19	be	be	AUX
arestyrurj-238	48	20	compatible	compatible	ADJ
arestyrurj-238	48	21	with	with	ADP
arestyrurj-238	48	22	biological	biological	ADJ
arestyrurj-238	48	23	systems	system	NOUN
arestyrurj-238	48	24	.	.	PUNCT
arestyrurj-238	49	1	in	in	ADP
arestyrurj-238	49	2	addition	addition	NOUN
arestyrurj-238	49	3	,	,	PUNCT
arestyrurj-238	49	4	the	the	DET
arestyrurj-238	49	5	peptides	peptide	NOUN
arestyrurj-238	49	6	must	must	AUX
arestyrurj-238	49	7	have	have	VERB
arestyrurj-238	49	8	lengths	length	NOUN
arestyrurj-238	49	9	less	less	ADJ
arestyrurj-238	49	10	than	than	ADP
arestyrurj-238	49	11	or	or	CCONJ
arestyrurj-238	49	12	equal	equal	ADJ
arestyrurj-238	49	13	to	to	ADP
arestyrurj-238	49	14	50	50	NUM
arestyrurj-238	49	15	amino	amino	ADJ
arestyrurj-238	49	16	acids	acid	NOUN
arestyrurj-238	49	17	but	but	CCONJ
arestyrurj-238	49	18	also	also	ADV
arestyrurj-238	49	19	greater	great	ADJ
arestyrurj-238	49	20	than	than	ADP
arestyrurj-238	49	21	or	or	CCONJ
arestyrurj-238	49	22	equal	equal	ADJ
arestyrurj-238	49	23	to	to	ADP
arestyrurj-238	49	24	11	11	NUM
arestyrurj-238	49	25	amino	amino	NOUN
arestyrurj-238	49	26	acids	acid	NOUN
arestyrurj-238	49	27	.	.	PUNCT
arestyrurj-238	50	1	shorter	short	ADJ
arestyrurj-238	50	2	lengths	length	NOUN
arestyrurj-238	50	3	enable	enable	VERB
arestyrurj-238	50	4	amps	amp	NOUN
arestyrurj-238	50	5	to	to	PART
arestyrurj-238	50	6	have	have	VERB
arestyrurj-238	50	7	greater	great	ADJ
arestyrurj-238	50	8	efficiency	efficiency	NOUN
arestyrurj-238	50	9	and	and	CCONJ
arestyrurj-238	50	10	flexibility	flexibility	NOUN
arestyrurj-238	50	11	when	when	SCONJ
arestyrurj-238	50	12	interacting	interact	VERB
arestyrurj-238	50	13	with	with	ADP
arestyrurj-238	50	14	bacterial	bacterial	ADJ
arestyrurj-238	50	15	cell	cell	NOUN
arestyrurj-238	50	16	membranes	membrane	NOUN
arestyrurj-238	50	17	,	,	PUNCT
arestyrurj-238	50	18	which	which	PRON
arestyrurj-238	50	19	is	be	AUX
arestyrurj-238	50	20	why	why	SCONJ
arestyrurj-238	50	21	an	an	DET
arestyrurj-238	50	22	upper	upper	ADJ
arestyrurj-238	50	23	limit	limit	NOUN
arestyrurj-238	50	24	for	for	ADP
arestyrurj-238	50	25	peptide	peptide	ADJ
arestyrurj-238	50	26	length	length	NOUN
arestyrurj-238	50	27	was	be	AUX
arestyrurj-238	50	28	specified	specify	VERB
arestyrurj-238	50	29	.	.	PUNCT
arestyrurj-238	51	1	however	however	ADV
arestyrurj-238	51	2	,	,	PUNCT
arestyrurj-238	51	3	the	the	DET
arestyrurj-238	51	4	amps	amp	NOUN
arestyrurj-238	51	5	also	also	ADV
arestyrurj-238	51	6	had	have	VERB
arestyrurj-238	51	7	to	to	PART
arestyrurj-238	51	8	have	have	VERB
arestyrurj-238	51	9	lengths	length	NOUN
arestyrurj-238	51	10	of	of	ADP
arestyrurj-238	51	11	at	at	ADV
arestyrurj-238	51	12	least	least	ADJ
arestyrurj-238	51	13	11	11	NUM
arestyrurj-238	51	14	amino	amino	NOUN
arestyrurj-238	51	15	acids	acid	NOUN
arestyrurj-238	51	16	long	long	ADV
arestyrurj-238	51	17	,	,	PUNCT
arestyrurj-238	51	18	since	since	SCONJ
arestyrurj-238	51	19	this	this	PRON
arestyrurj-238	51	20	represents	represent	VERB
arestyrurj-238	51	21	three	three	NUM
arestyrurj-238	51	22	turns	turn	NOUN
arestyrurj-238	51	23	of	of	ADP
arestyrurj-238	51	24	an	an	DET
arestyrurj-238	51	25	alpha	alpha	NOUN
arestyrurj-238	51	26	helix	helix	NOUN
arestyrurj-238	51	27	spanning	span	VERB
arestyrurj-238	51	28	the	the	DET
arestyrurj-238	51	29	minimum	minimum	ADJ
arestyrurj-238	51	30	thickness	thickness	NOUN
arestyrurj-238	51	31	of	of	ADP
arestyrurj-238	51	32	a	a	DET
arestyrurj-238	51	33	gramnegative	gramnegative	ADJ
arestyrurj-238	51	34	bacterial	bacterial	ADJ
arestyrurj-238	51	35	cell	cell	NOUN
arestyrurj-238	51	36	membrane	membrane	NOUN
arestyrurj-238	51	37	.	.	PUNCT
arestyrurj-238	52	1	most	most	ADV
arestyrurj-238	52	2	importantly	importantly	ADV
arestyrurj-238	52	3	,	,	PUNCT
arestyrurj-238	52	4	the	the	DET
arestyrurj-238	52	5	peptide	peptide	NOUN
arestyrurj-238	52	6	must	must	AUX
arestyrurj-238	52	7	have	have	VERB
arestyrurj-238	52	8	known	know	VERB
arestyrurj-238	52	9	activity	activity	NOUN
arestyrurj-238	52	10	against	against	ADP
arestyrurj-238	52	11	p.	p.	PROPN
arestyrurj-238	52	12	aeruginosa	aeruginosa	PROPN
arestyrurj-238	52	13	,	,	PUNCT
arestyrurj-238	52	14	but	but	CCONJ
arestyrurj-238	52	15	its	its	PRON
arestyrurj-238	52	16	mic	mic	ADJ
arestyrurj-238	52	17	value	value	NOUN
arestyrurj-238	52	18	can	can	AUX
arestyrurj-238	52	19	not	not	PART
arestyrurj-238	52	20	exceed	exceed	VERB
arestyrurj-238	52	21	500	500	NUM
arestyrurj-238	52	22	µm	µm	NOUN
arestyrurj-238	52	23	.	.	PUNCT
arestyrurj-238	53	1	a	a	DET
arestyrurj-238	53	2	high	high	ADJ
arestyrurj-238	53	3	mic	mic	ADJ
arestyrurj-238	53	4	value	value	NOUN
arestyrurj-238	53	5	indicates	indicate	VERB
arestyrurj-238	53	6	that	that	SCONJ
arestyrurj-238	53	7	more	more	ADJ
arestyrurj-238	53	8	peptide	peptide	NOUN
arestyrurj-238	53	9	is	be	AUX
arestyrurj-238	53	10	required	require	VERB
arestyrurj-238	53	11	for	for	ADP
arestyrurj-238	53	12	inhibiting	inhibit	VERB
arestyrurj-238	53	13	growth	growth	NOUN
arestyrurj-238	53	14	;	;	PUNCT
arestyrurj-238	53	15	we	we	PRON
arestyrurj-238	53	16	defined	define	VERB
arestyrurj-238	53	17	a	a	DET
arestyrurj-238	53	18	mic	mic	NOUN
arestyrurj-238	53	19	>	>	X
arestyrurj-238	53	20	500	500	NUM
arestyrurj-238	53	21	µm	µm	NOUN
arestyrurj-238	53	22	as	as	ADV
arestyrurj-238	53	23	ineffective	ineffective	ADJ
arestyrurj-238	53	24	for	for	ADP
arestyrurj-238	53	25	treating	treat	VERB
arestyrurj-238	53	26	p.	p.	NOUN
arestyrurj-238	53	27	aeruginosa	aeruginosa	NOUN
arestyrurj-238	53	28	infections	infection	NOUN
arestyrurj-238	53	29	.	.	PUNCT
arestyrurj-238	54	1	if	if	SCONJ
arestyrurj-238	54	2	a	a	DET
arestyrurj-238	54	3	peptide	peptide	NOUN
arestyrurj-238	54	4	’s	’s	PART
arestyrurj-238	54	5	reported	report	VERB
arestyrurj-238	54	6	mic	mic	NOUN
arestyrurj-238	54	7	was	be	AUX
arestyrurj-238	54	8	a	a	DET
arestyrurj-238	54	9	lower	low	ADJ
arestyrurj-238	54	10	threshold	threshold	NOUN
arestyrurj-238	54	11	value	value	NOUN
arestyrurj-238	54	12	(	(	PUNCT
arestyrurj-238	54	13	i.e.	i.e.	X
arestyrurj-238	54	14	,	,	PUNCT
arestyrurj-238	54	15	greater	great	ADJ
arestyrurj-238	54	16	than	than	ADP
arestyrurj-238	54	17	some	some	DET
arestyrurj-238	54	18	value	value	NOUN
arestyrurj-238	54	19	)	)	PUNCT
arestyrurj-238	54	20	,	,	PUNCT
arestyrurj-238	54	21	then	then	ADV
arestyrurj-238	54	22	we	we	PRON
arestyrurj-238	54	23	considered	consider	VERB
arestyrurj-238	54	24	its	its	PRON
arestyrurj-238	54	25	mic	mic	ADJ
arestyrurj-238	54	26	value	value	NOUN
arestyrurj-238	54	27	to	to	PART
arestyrurj-238	54	28	be	be	AUX
arestyrurj-238	54	29	double	double	VERB
arestyrurj-238	54	30	its	its	PRON
arestyrurj-238	54	31	lower	low	ADJ
arestyrurj-238	54	32	threshold	threshold	NOUN
arestyrurj-238	54	33	.	.	PUNCT
arestyrurj-238	55	1	this	this	PRON
arestyrurj-238	55	2	was	be	AUX
arestyrurj-238	55	3	done	do	VERB
arestyrurj-238	55	4	to	to	PART
arestyrurj-238	55	5	account	account	VERB
arestyrurj-238	55	6	for	for	ADP
arestyrurj-238	55	7	one	one	NUM
arestyrurj-238	55	8	more	more	ADJ
arestyrurj-238	55	9	factor	factor	NOUN
arestyrurj-238	55	10	of	of	ADP
arestyrurj-238	55	11	two	two	NUM
arestyrurj-238	55	12	in	in	ADP
arestyrurj-238	55	13	the	the	DET
arestyrurj-238	55	14	two	two	NUM
arestyrurj-238	55	15	-	-	PUNCT
arestyrurj-238	55	16	fold	fold	ADJ
arestyrurj-238	55	17	serial	serial	ADJ
arestyrurj-238	55	18	dilution	dilution	NOUN
arestyrurj-238	55	19	performed	perform	VERB
arestyrurj-238	55	20	in	in	ADP
arestyrurj-238	55	21	a	a	DET
arestyrurj-238	55	22	mic	mic	ADJ
arestyrurj-238	55	23	assay	assay	NOUN
arestyrurj-238	55	24	.	.	PUNCT
arestyrurj-238	56	1	if	if	SCONJ
arestyrurj-238	56	2	a	a	DET
arestyrurj-238	56	3	peptide	peptide	NOUN
arestyrurj-238	56	4	’s	’s	PART
arestyrurj-238	56	5	reported	report	VERB
arestyrurj-238	56	6	mic	mic	NOUN
arestyrurj-238	56	7	was	be	AUX
arestyrurj-238	56	8	an	an	DET
arestyrurj-238	56	9	upper	upper	ADJ
arestyrurj-238	56	10	threshold	threshold	NOUN
arestyrurj-238	56	11	value	value	NOUN
arestyrurj-238	56	12	(	(	PUNCT
arestyrurj-238	56	13	i.e.	i.e.	X
arestyrurj-238	56	14	,	,	PUNCT
arestyrurj-238	56	15	lower	low	ADJ
arestyrurj-238	56	16	than	than	ADP
arestyrurj-238	56	17	some	some	DET
arestyrurj-238	56	18	value	value	NOUN
arestyrurj-238	56	19	)	)	PUNCT
arestyrurj-238	56	20	,	,	PUNCT
arestyrurj-238	56	21	then	then	ADV
arestyrurj-238	56	22	we	we	PRON
arestyrurj-238	56	23	considered	consider	VERB
arestyrurj-238	56	24	its	its	PRON
arestyrurj-238	56	25	mic	mic	ADJ
arestyrurj-238	56	26	value	value	NOUN
arestyrurj-238	56	27	to	to	PART
arestyrurj-238	56	28	be	be	AUX
arestyrurj-238	56	29	equal	equal	ADJ
arestyrurj-238	56	30	to	to	ADP
arestyrurj-238	56	31	its	its	PRON
arestyrurj-238	56	32	upper	upper	ADJ
arestyrurj-238	56	33	threshold	threshold	NOUN
arestyrurj-238	56	34	.	.	PUNCT
arestyrurj-238	57	1	if	if	SCONJ
arestyrurj-238	57	2	a	a	DET
arestyrurj-238	57	3	peptide	peptide	NOUN
arestyrurj-238	57	4	had	have	VERB
arestyrurj-238	57	5	numerous	numerous	ADJ
arestyrurj-238	57	6	reported	report	VERB
arestyrurj-238	57	7	mic	mic	ADJ
arestyrurj-238	57	8	values	value	NOUN
arestyrurj-238	57	9	,	,	PUNCT
arestyrurj-238	57	10	the	the	DET
arestyrurj-238	57	11	lowest	low	ADJ
arestyrurj-238	57	12	mic	mic	NOUN
arestyrurj-238	57	13	was	be	AUX
arestyrurj-238	57	14	aresty	aresty	ADJ
arestyrurj-238	57	15	rutgers	rutgers	PROPN
arestyrurj-238	57	16	undergraduate	undergraduate	PROPN
arestyrurj-238	57	17	research	research	PROPN
arestyrurj-238	57	18	journal	journal	PROPN
arestyrurj-238	57	19	,	,	PUNCT
arestyrurj-238	57	20	volume	volume	NOUN
arestyrurj-238	57	21	i	i	PRON
arestyrurj-238	57	22	,	,	PUNCT
arestyrurj-238	57	23	issue	issue	NOUN
arestyrurj-238	57	24	v	v	NUM
arestyrurj-238	57	25	selected	select	VERB
arestyrurj-238	57	26	.	.	PUNCT
arestyrurj-238	58	1	after	after	SCONJ
arestyrurj-238	58	2	these	these	DET
arestyrurj-238	58	3	initial	initial	ADJ
arestyrurj-238	58	4	conditions	condition	NOUN
arestyrurj-238	58	5	were	be	AUX
arestyrurj-238	58	6	implemented	implement	VERB
arestyrurj-238	58	7	,	,	PUNCT
arestyrurj-238	58	8	we	we	PRON
arestyrurj-238	58	9	arrived	arrive	VERB
arestyrurj-238	58	10	at	at	ADP
arestyrurj-238	58	11	a	a	DET
arestyrurj-238	58	12	subset	subset	NOUN
arestyrurj-238	58	13	of	of	ADP
arestyrurj-238	58	14	4,218	4,218	NUM
arestyrurj-238	58	15	unique	unique	ADJ
arestyrurj-238	58	16	peptides	peptide	NOUN
arestyrurj-238	58	17	.	.	PUNCT
arestyrurj-238	59	1	molecular	molecular	ADJ
arestyrurj-238	59	2	properties	property	NOUN
arestyrurj-238	59	3	of	of	ADP
arestyrurj-238	59	4	biophysical	biophysical	ADJ
arestyrurj-238	59	5	significance	significance	NOUN
arestyrurj-238	59	6	based	base	VERB
arestyrurj-238	59	7	on	on	ADP
arestyrurj-238	59	8	what	what	PRON
arestyrurj-238	59	9	is	be	AUX
arestyrurj-238	59	10	known	know	VERB
arestyrurj-238	59	11	about	about	ADP
arestyrurj-238	59	12	amps	amp	NOUN
arestyrurj-238	59	13	,	,	PUNCT
arestyrurj-238	59	14	there	there	PRON
arestyrurj-238	59	15	are	be	VERB
arestyrurj-238	59	16	several	several	ADJ
arestyrurj-238	59	17	molecular	molecular	ADJ
arestyrurj-238	59	18	properties	property	NOUN
arestyrurj-238	59	19	that	that	PRON
arestyrurj-238	59	20	are	be	AUX
arestyrurj-238	59	21	relatively	relatively	ADV
arestyrurj-238	59	22	simple	simple	ADJ
arestyrurj-238	59	23	to	to	PART
arestyrurj-238	59	24	compute	compute	VERB
arestyrurj-238	59	25	and	and	CCONJ
arestyrurj-238	59	26	are	be	AUX
arestyrurj-238	59	27	likely	likely	ADJ
arestyrurj-238	59	28	to	to	PART
arestyrurj-238	59	29	influence	influence	VERB
arestyrurj-238	59	30	amp	amp	NOUN
arestyrurj-238	59	31	activity	activity	NOUN
arestyrurj-238	59	32	:	:	PUNCT
arestyrurj-238	59	33	peptide	peptide	NOUN
arestyrurj-238	59	34	length	length	NOUN
arestyrurj-238	59	35	.	.	PUNCT
arestyrurj-238	60	1	the	the	DET
arestyrurj-238	60	2	peptide	peptide	ADJ
arestyrurj-238	60	3	length	length	NOUN
arestyrurj-238	60	4	is	be	AUX
arestyrurj-238	60	5	the	the	DET
arestyrurj-238	60	6	total	total	ADJ
arestyrurj-238	60	7	number	number	NOUN
arestyrurj-238	60	8	of	of	ADP
arestyrurj-238	60	9	amino	amino	NOUN
arestyrurj-238	60	10	acid	acid	NOUN
arestyrurj-238	60	11	residues	residue	NOUN
arestyrurj-238	60	12	in	in	ADP
arestyrurj-238	60	13	the	the	DET
arestyrurj-238	60	14	peptide	peptide	NOUN
arestyrurj-238	60	15	sequence	sequence	NOUN
arestyrurj-238	60	16	.	.	PUNCT
arestyrurj-238	61	1	amps	amp	NOUN
arestyrurj-238	61	2	are	be	AUX
arestyrurj-238	61	3	typically	typically	ADV
arestyrurj-238	61	4	quite	quite	ADV
arestyrurj-238	61	5	short	short	ADJ
arestyrurj-238	61	6	;	;	PUNCT
arestyrurj-238	61	7	most	most	ADJ
arestyrurj-238	61	8	of	of	ADP
arestyrurj-238	61	9	them	they	PRON
arestyrurj-238	61	10	have	have	VERB
arestyrurj-238	61	11	lengths	length	NOUN
arestyrurj-238	61	12	less	less	ADJ
arestyrurj-238	61	13	than	than	ADP
arestyrurj-238	61	14	50	50	NUM
arestyrurj-238	61	15	amino	amino	NOUN
arestyrurj-238	61	16	acids	acid	NOUN
arestyrurj-238	61	17	,	,	PUNCT
arestyrurj-238	61	18	but	but	CCONJ
arestyrurj-238	61	19	some	some	PRON
arestyrurj-238	61	20	can	can	AUX
arestyrurj-238	61	21	have	have	VERB
arestyrurj-238	61	22	lengths	length	NOUN
arestyrurj-238	61	23	as	as	ADV
arestyrurj-238	61	24	large	large	ADJ
arestyrurj-238	61	25	as	as	ADP
arestyrurj-238	61	26	100	100	NUM
arestyrurj-238	61	27	amino	amino	ADJ
arestyrurj-238	61	28	acids	acid	NOUN
arestyrurj-238	61	29	(	(	PUNCT
arestyrurj-238	61	30	ageitos	ageitos	NOUN
arestyrurj-238	61	31	et	et	NOUN
arestyrurj-238	61	32	al	al	PROPN
arestyrurj-238	61	33	.	.	PROPN
arestyrurj-238	61	34	,	,	PUNCT
arestyrurj-238	61	35	2017	2017	NUM
arestyrurj-238	61	36	)	)	PUNCT
arestyrurj-238	61	37	.	.	PUNCT
arestyrurj-238	62	1	net	net	ADJ
arestyrurj-238	62	2	charge	charge	NOUN
arestyrurj-238	62	3	.	.	PUNCT
arestyrurj-238	63	1	a	a	DET
arestyrurj-238	63	2	peptide	peptide	NOUN
arestyrurj-238	63	3	’s	’s	PART
arestyrurj-238	63	4	net	net	ADJ
arestyrurj-238	63	5	charge	charge	NOUN
arestyrurj-238	63	6	is	be	AUX
arestyrurj-238	63	7	calculated	calculate	VERB
arestyrurj-238	63	8	by	by	ADP
arestyrurj-238	63	9	subtracting	subtract	VERB
arestyrurj-238	63	10	the	the	DET
arestyrurj-238	63	11	total	total	ADJ
arestyrurj-238	63	12	number	number	NOUN
arestyrurj-238	63	13	of	of	ADP
arestyrurj-238	63	14	negatively	negatively	ADV
arestyrurj-238	63	15	charged	charge	VERB
arestyrurj-238	63	16	amino	amino	NOUN
arestyrurj-238	63	17	acid	acid	NOUN
arestyrurj-238	63	18	residues	residue	NOUN
arestyrurj-238	63	19	from	from	ADP
arestyrurj-238	63	20	the	the	DET
arestyrurj-238	63	21	total	total	ADJ
arestyrurj-238	63	22	number	number	NOUN
arestyrurj-238	63	23	of	of	ADP
arestyrurj-238	63	24	positively	positively	ADV
arestyrurj-238	63	25	charged	charge	VERB
arestyrurj-238	63	26	amino	amino	NOUN
arestyrurj-238	63	27	acid	acid	NOUN
arestyrurj-238	63	28	residues	residue	NOUN
arestyrurj-238	63	29	.	.	PUNCT
arestyrurj-238	64	1	𝑁𝑒𝑡	𝑁𝑒𝑡	PROPN
arestyrurj-238	64	2	𝐶ℎ𝑎𝑟𝑔𝑒	𝐶ℎ𝑎𝑟𝑔𝑒	PROPN
arestyrurj-238	64	3	=	=	SYM
arestyrurj-238	64	4	𝐿𝑦𝑠	𝐿𝑦𝑠	PROPN
arestyrurj-238	64	5	+	+	PROPN
arestyrurj-238	64	6	𝐴𝑟𝑔	𝐴𝑟𝑔	PROPN
arestyrurj-238	64	7	−	−	PROPN
arestyrurj-238	65	1	𝐴𝑠𝑝	𝐴𝑠𝑝	PROPN
arestyrurj-238	65	2	−	−	PROPN
arestyrurj-238	65	3	𝐺𝑙𝑢	𝐺𝑙𝑢	PROPN
arestyrurj-238	65	4	(	(	PUNCT
arestyrurj-238	65	5	1	1	NUM
arestyrurj-238	65	6	)	)	PUNCT
arestyrurj-238	65	7	net	net	ADJ
arestyrurj-238	65	8	charge	charge	NOUN
arestyrurj-238	65	9	indicates	indicate	VERB
arestyrurj-238	65	10	how	how	SCONJ
arestyrurj-238	65	11	an	an	DET
arestyrurj-238	65	12	amp	amp	NOUN
arestyrurj-238	65	13	will	will	AUX
arestyrurj-238	65	14	electrostatically	electrostatically	ADV
arestyrurj-238	65	15	interact	interact	VERB
arestyrurj-238	65	16	with	with	ADP
arestyrurj-238	65	17	the	the	DET
arestyrurj-238	65	18	bacterial	bacterial	ADJ
arestyrurj-238	65	19	membrane	membrane	NOUN
arestyrurj-238	65	20	.	.	PUNCT
arestyrurj-238	66	1	studies	study	NOUN
arestyrurj-238	66	2	have	have	AUX
arestyrurj-238	66	3	shown	show	VERB
arestyrurj-238	66	4	that	that	SCONJ
arestyrurj-238	66	5	decreasing	decrease	VERB
arestyrurj-238	66	6	the	the	DET
arestyrurj-238	66	7	net	net	ADJ
arestyrurj-238	66	8	charge	charge	NOUN
arestyrurj-238	66	9	to	to	ADP
arestyrurj-238	66	10	less	less	ADJ
arestyrurj-238	66	11	than	than	ADP
arestyrurj-238	66	12	+4	+4	PROPN
arestyrurj-238	66	13	rendered	render	VERB
arestyrurj-238	66	14	peptides	peptide	NOUN
arestyrurj-238	66	15	inactive	inactive	ADJ
arestyrurj-238	66	16	,	,	PUNCT
arestyrurj-238	66	17	and	and	CCONJ
arestyrurj-238	66	18	increasing	increase	VERB
arestyrurj-238	66	19	net	net	ADJ
arestyrurj-238	66	20	charge	charge	NOUN
arestyrurj-238	66	21	improved	improve	VERB
arestyrurj-238	66	22	antimicrobial	antimicrobial	ADJ
arestyrurj-238	66	23	activity	activity	NOUN
arestyrurj-238	66	24	.	.	PUNCT
arestyrurj-238	67	1	however	however	ADV
arestyrurj-238	67	2	,	,	PUNCT
arestyrurj-238	67	3	an	an	DET
arestyrurj-238	67	4	increase	increase	NOUN
arestyrurj-238	67	5	to	to	ADP
arestyrurj-238	67	6	net	net	ADJ
arestyrurj-238	67	7	charges	charge	NOUN
arestyrurj-238	67	8	greater	great	ADJ
arestyrurj-238	67	9	than	than	SCONJ
arestyrurj-238	67	10	+9	+9	PRON
arestyrurj-238	67	11	led	lead	VERB
arestyrurj-238	67	12	to	to	ADP
arestyrurj-238	67	13	a	a	DET
arestyrurj-238	67	14	dramatic	dramatic	ADJ
arestyrurj-238	67	15	rise	rise	NOUN
arestyrurj-238	67	16	in	in	ADP
arestyrurj-238	67	17	hemolytic	hemolytic	ADJ
arestyrurj-238	67	18	activity	activity	NOUN
arestyrurj-238	67	19	(	(	PUNCT
arestyrurj-238	67	20	jiang	jiang	PROPN
arestyrurj-238	67	21	et	et	PROPN
arestyrurj-238	67	22	al	al	PROPN
arestyrurj-238	67	23	.	.	PROPN
arestyrurj-238	67	24	,	,	PUNCT
arestyrurj-238	67	25	2008	2008	NUM
arestyrurj-238	67	26	)	)	PUNCT
arestyrurj-238	67	27	.	.	PUNCT
arestyrurj-238	68	1	this	this	PRON
arestyrurj-238	68	2	is	be	AUX
arestyrurj-238	68	3	undesirable	undesirable	ADJ
arestyrurj-238	68	4	because	because	SCONJ
arestyrurj-238	68	5	greater	great	ADJ
arestyrurj-238	68	6	hemolytic	hemolytic	ADJ
arestyrurj-238	68	7	activity	activity	NOUN
arestyrurj-238	68	8	leads	lead	VERB
arestyrurj-238	68	9	to	to	ADP
arestyrurj-238	68	10	red	red	ADJ
arestyrurj-238	68	11	blood	blood	NOUN
arestyrurj-238	68	12	cell	cell	NOUN
arestyrurj-238	68	13	damage	damage	NOUN
arestyrurj-238	68	14	and	and	CCONJ
arestyrurj-238	68	15	can	can	AUX
arestyrurj-238	68	16	result	result	VERB
arestyrurj-238	68	17	in	in	ADP
arestyrurj-238	68	18	anemia	anemia	NOUN
arestyrurj-238	68	19	,	,	PUNCT
arestyrurj-238	68	20	inflammation	inflammation	NOUN
arestyrurj-238	68	21	,	,	PUNCT
arestyrurj-238	68	22	and	and	CCONJ
arestyrurj-238	68	23	organ	organ	NOUN
arestyrurj-238	68	24	dysfunction	dysfunction	NOUN
arestyrurj-238	68	25	.	.	PUNCT
arestyrurj-238	69	1	hydrophobic	hydrophobic	NOUN
arestyrurj-238	69	2	proportion	proportion	NOUN
arestyrurj-238	69	3	.	.	PUNCT
arestyrurj-238	70	1	the	the	DET
arestyrurj-238	70	2	hydrophobic	hydrophobic	NOUN
arestyrurj-238	70	3	proportion	proportion	NOUN
arestyrurj-238	70	4	refers	refer	VERB
arestyrurj-238	70	5	to	to	ADP
arestyrurj-238	70	6	the	the	DET
arestyrurj-238	70	7	percentage	percentage	NOUN
arestyrurj-238	70	8	of	of	ADP
arestyrurj-238	70	9	hydrophobic	hydrophobic	NOUN
arestyrurj-238	70	10	amino	amino	NOUN
arestyrurj-238	70	11	acid	acid	NOUN
arestyrurj-238	70	12	residues	residue	NOUN
arestyrurj-238	70	13	within	within	ADP
arestyrurj-238	70	14	the	the	DET
arestyrurj-238	70	15	peptide	peptide	NOUN
arestyrurj-238	70	16	sequence	sequence	NOUN
arestyrurj-238	70	17	.	.	PUNCT
arestyrurj-238	71	1	hydrophobic	hydrophobic	NOUN
arestyrurj-238	71	2	residues	residue	NOUN
arestyrurj-238	71	3	facilitate	facilitate	VERB
arestyrurj-238	71	4	interactions	interaction	NOUN
arestyrurj-238	71	5	with	with	ADP
arestyrurj-238	71	6	the	the	DET
arestyrurj-238	71	7	phospholipid	phospholipid	NOUN
arestyrurj-238	71	8	fatty	fatty	NOUN
arestyrurj-238	71	9	acyl	acyl	NOUN
arestyrurj-238	71	10	chains	chain	NOUN
arestyrurj-238	71	11	of	of	ADP
arestyrurj-238	71	12	the	the	DET
arestyrurj-238	71	13	bacterial	bacterial	ADJ
arestyrurj-238	71	14	membrane	membrane	NOUN
arestyrurj-238	71	15	(	(	PUNCT
arestyrurj-238	71	16	edwards	edwards	PROPN
arestyrurj-238	71	17	et	et	PROPN
arestyrurj-238	71	18	al	al	PROPN
arestyrurj-238	71	19	.	.	PROPN
arestyrurj-238	71	20	,	,	PUNCT
arestyrurj-238	71	21	2016	2016	NUM
arestyrurj-238	71	22	)	)	PUNCT
arestyrurj-238	71	23	.	.	PUNCT
arestyrurj-238	72	1	amps	amp	NOUN
arestyrurj-238	72	2	typically	typically	ADV
arestyrurj-238	72	3	contain	contain	VERB
arestyrurj-238	72	4	40%-60	40%-60	NUM
arestyrurj-238	72	5	%	%	NOUN
arestyrurj-238	72	6	hydrophobic	hydrophobic	NOUN
arestyrurj-238	72	7	residues	residue	NOUN
arestyrurj-238	72	8	(	(	PUNCT
arestyrurj-238	72	9	ye	ye	NOUN
arestyrurj-238	72	10	et	et	NOUN
arestyrurj-238	72	11	al	al	PROPN
arestyrurj-238	72	12	.	.	PROPN
arestyrurj-238	72	13	,	,	PUNCT
arestyrurj-238	72	14	2019	2019	NUM
arestyrurj-238	72	15	)	)	PUNCT
arestyrurj-238	72	16	.	.	PUNCT
arestyrurj-238	73	1	we	we	PRON
arestyrurj-238	73	2	considered	consider	VERB
arestyrurj-238	73	3	an	an	DET
arestyrurj-238	73	4	amino	amino	NOUN
arestyrurj-238	73	5	acid	acid	NOUN
arestyrurj-238	73	6	to	to	PART
arestyrurj-238	73	7	be	be	AUX
arestyrurj-238	73	8	hydrophobic	hydrophobic	ADJ
arestyrurj-238	73	9	if	if	SCONJ
arestyrurj-238	73	10	it	it	PRON
arestyrurj-238	73	11	exceeds	exceed	VERB
arestyrurj-238	73	12	0.700	0.700	NUM
arestyrurj-238	73	13	on	on	ADP
arestyrurj-238	73	14	fauchere	fauchere	ADV
arestyrurj-238	73	15	and	and	CCONJ
arestyrurj-238	73	16	pliska	pliska	NOUN
arestyrurj-238	73	17	’s	’s	PART
arestyrurj-238	73	18	(	(	PUNCT
arestyrurj-238	73	19	1983	1983	NUM
arestyrurj-238	73	20	)	)	PUNCT
arestyrurj-238	73	21	hydrophobicity	hydrophobicity	NOUN
arestyrurj-238	73	22	scale	scale	NOUN
arestyrurj-238	73	23	based	base	VERB
arestyrurj-238	73	24	on	on	ADP
arestyrurj-238	73	25	octanol	octanol	NOUN
arestyrurj-238	73	26	-	-	PUNCT
arestyrurj-238	73	27	water	water	NOUN
arestyrurj-238	73	28	partition	partition	NOUN
arestyrurj-238	73	29	coefficients	coefficient	NOUN
arestyrurj-238	73	30	,	,	PUNCT
arestyrurj-238	73	31	which	which	PRON
arestyrurj-238	73	32	is	be	AUX
arestyrurj-238	73	33	defined	define	VERB
arestyrurj-238	73	34	as	as	ADP
arestyrurj-238	73	35	the	the	DET
arestyrurj-238	73	36	ratio	ratio	NOUN
arestyrurj-238	73	37	of	of	ADP
arestyrurj-238	73	38	the	the	DET
arestyrurj-238	73	39	peptide	peptide	NOUN
arestyrurj-238	73	40	’s	’s	PART
arestyrurj-238	73	41	concentration	concentration	NOUN
arestyrurj-238	73	42	in	in	ADP
arestyrurj-238	73	43	the	the	DET
arestyrurj-238	73	44	octanol	octanol	NOUN
arestyrurj-238	73	45	phase	phase	NOUN
arestyrurj-238	73	46	to	to	ADP
arestyrurj-238	73	47	its	its	PRON
arestyrurj-238	73	48	concentration	concentration	NOUN
arestyrurj-238	73	49	in	in	ADP
arestyrurj-238	73	50	the	the	DET
arestyrurj-238	73	51	aqueous	aqueous	ADJ
arestyrurj-238	73	52	phase	phase	NOUN
arestyrurj-238	73	53	.	.	PUNCT
arestyrurj-238	74	1	if	if	SCONJ
arestyrurj-238	74	2	the	the	DET
arestyrurj-238	74	3	coefficient	coefficient	NOUN
arestyrurj-238	74	4	value	value	NOUN
arestyrurj-238	74	5	is	be	AUX
arestyrurj-238	74	6	greater	great	ADJ
arestyrurj-238	74	7	than	than	ADP
arestyrurj-238	74	8	one	one	NUM
arestyrurj-238	74	9	,	,	PUNCT
arestyrurj-238	74	10	then	then	ADV
arestyrurj-238	74	11	the	the	DET
arestyrurj-238	74	12	peptide	peptide	NOUN
arestyrurj-238	74	13	is	be	AUX
arestyrurj-238	74	14	more	more	ADV
arestyrurj-238	74	15	lipophilic	lipophilic	ADJ
arestyrurj-238	74	16	(	(	PUNCT
arestyrurj-238	74	17	dissolves	dissolve	VERB
arestyrurj-238	74	18	in	in	ADP
arestyrurj-238	74	19	lipids	lipid	NOUN
arestyrurj-238	74	20	)	)	PUNCT
arestyrurj-238	74	21	;	;	PUNCT
arestyrurj-238	74	22	if	if	SCONJ
arestyrurj-238	74	23	the	the	DET
arestyrurj-238	74	24	coefficient	coefficient	NOUN
arestyrurj-238	74	25	value	value	NOUN
arestyrurj-238	74	26	is	be	AUX
arestyrurj-238	74	27	less	less	ADJ
arestyrurj-238	74	28	than	than	ADP
arestyrurj-238	74	29	one	one	NUM
arestyrurj-238	74	30	,	,	PUNCT
arestyrurj-238	74	31	then	then	ADV
arestyrurj-238	74	32	the	the	DET
arestyrurj-238	74	33	peptide	peptide	NOUN
arestyrurj-238	74	34	is	be	AUX
arestyrurj-238	74	35	more	more	ADV
arestyrurj-238	74	36	hydrophilic	hydrophilic	ADJ
arestyrurj-238	74	37	(	(	PUNCT
arestyrurj-238	74	38	dissolves	dissolve	VERB
arestyrurj-238	74	39	in	in	ADP
arestyrurj-238	74	40	water	water	NOUN
arestyrurj-238	74	41	)	)	PUNCT
arestyrurj-238	74	42	.	.	PUNCT
arestyrurj-238	75	1	𝐻𝑝𝑟𝑜𝑝	𝐻𝑝𝑟𝑜𝑝	PROPN
arestyrurj-238	75	2	=	=	PUNCT
arestyrurj-238	75	3	𝐶𝑦𝑠+𝑃ℎ𝑒+𝐼𝑙𝑒+𝐿𝑒𝑢+𝑀𝑒𝑡+𝑃𝑟𝑜+𝑉𝑎𝑙+𝑇𝑟𝑝+𝑇𝑦𝑟	𝐶𝑦𝑠+𝑃ℎ𝑒+𝐼𝑙𝑒+𝐿𝑒𝑢+𝑀𝑒𝑡+𝑃𝑟𝑜+𝑉𝑎𝑙+𝑇𝑟𝑝+𝑇𝑦𝑟	PUNCT
arestyrurj-238	75	4	𝑃𝑒𝑝𝑡𝑖𝑑𝑒	𝑃𝑒𝑝𝑡𝑖𝑑𝑒	PROPN
arestyrurj-238	75	5	𝐿𝑒𝑛𝑔𝑡ℎ	𝐿𝑒𝑛𝑔𝑡ℎ	PROPN
arestyrurj-238	75	6	(	(	PUNCT
arestyrurj-238	75	7	2	2	NUM
arestyrurj-238	75	8	)	)	PUNCT
arestyrurj-238	75	9	maximum	maximum	ADJ
arestyrurj-238	75	10	average	average	ADJ
arestyrurj-238	75	11	hydrophobic	hydrophobic	NOUN
arestyrurj-238	75	12	moment	moment	NOUN
arestyrurj-238	75	13	.	.	PUNCT
arestyrurj-238	76	1	the	the	DET
arestyrurj-238	76	2	hydrophobic	hydrophobic	ADJ
arestyrurj-238	76	3	moment	moment	NOUN
arestyrurj-238	76	4	is	be	AUX
arestyrurj-238	76	5	a	a	DET
arestyrurj-238	76	6	measure	measure	NOUN
arestyrurj-238	76	7	of	of	ADP
arestyrurj-238	76	8	the	the	DET
arestyrurj-238	76	9	amphiphilicity	amphiphilicity	NOUN
arestyrurj-238	76	10	,	,	PUNCT
arestyrurj-238	76	11	or	or	CCONJ
arestyrurj-238	76	12	asymmetry	asymmetry	NOUN
arestyrurj-238	76	13	of	of	ADP
arestyrurj-238	76	14	hydrophobicity	hydrophobicity	NOUN
arestyrurj-238	76	15	,	,	PUNCT
arestyrurj-238	76	16	of	of	ADP
arestyrurj-238	76	17	a	a	DET
arestyrurj-238	76	18	peptide	peptide	NOUN
arestyrurj-238	76	19	’s	’s	PART
arestyrurj-238	76	20	structure	structure	NOUN
arestyrurj-238	76	21	.	.	PUNCT
arestyrurj-238	77	1	a	a	DET
arestyrurj-238	77	2	large	large	ADJ
arestyrurj-238	77	3	hydrophobic	hydrophobic	NOUN
arestyrurj-238	77	4	moment	moment	NOUN
arestyrurj-238	77	5	corresponds	correspond	VERB
arestyrurj-238	77	6	to	to	ADP
arestyrurj-238	77	7	a	a	DET
arestyrurj-238	77	8	structure	structure	NOUN
arestyrurj-238	77	9	that	that	PRON
arestyrurj-238	77	10	is	be	AUX
arestyrurj-238	77	11	primarily	primarily	ADV
arestyrurj-238	77	12	hydrophobic	hydrophobic	ADJ
arestyrurj-238	77	13	on	on	ADP
arestyrurj-238	77	14	one	one	NUM
arestyrurj-238	77	15	side	side	NOUN
arestyrurj-238	77	16	and	and	CCONJ
arestyrurj-238	77	17	primarily	primarily	ADV
arestyrurj-238	77	18	hydrophilic	hydrophilic	ADJ
arestyrurj-238	77	19	on	on	ADP
arestyrurj-238	77	20	the	the	DET
arestyrurj-238	77	21	other	other	ADJ
arestyrurj-238	77	22	side	side	NOUN
arestyrurj-238	77	23	.	.	PUNCT
arestyrurj-238	78	1	eisenberg	eisenberg	PROPN
arestyrurj-238	78	2	et	et	PROPN
arestyrurj-238	78	3	al	al	PROPN
arestyrurj-238	78	4	.	.	PROPN
arestyrurj-238	78	5	defined	define	VERB
arestyrurj-238	78	6	the	the	DET
arestyrurj-238	78	7	hydrophobic	hydrophobic	NOUN
arestyrurj-238	78	8	dipole	dipole	NOUN
arestyrurj-238	78	9	moment	moment	NOUN
arestyrurj-238	78	10	as	as	ADP
arestyrurj-238	78	11	𝜇	𝜇	ADP
arestyrurj-238	78	12	=	=	X
arestyrurj-238	78	13	√[∑	√[∑	NOUN
arestyrurj-238	78	14	𝐻𝑖	𝐻𝑖	PROPN
arestyrurj-238	78	15	cos(𝑖𝛿)𝑖	cos(𝑖𝛿)𝑖	PROPN
arestyrurj-238	78	16	]	]	X
arestyrurj-238	78	17	2	2	NUM
arestyrurj-238	78	18	+	+	CCONJ
arestyrurj-238	79	1	[	[	X
arestyrurj-238	79	2	∑	∑	X
arestyrurj-238	79	3	𝐻𝑖	𝐻𝑖	PROPN
arestyrurj-238	79	4	sin(𝑖𝛿)𝑖	sin(𝑖𝛿)𝑖	NOUN
arestyrurj-238	79	5	]	]	SYM
arestyrurj-238	79	6	2	2	NUM
arestyrurj-238	79	7	(	(	PUNCT
arestyrurj-238	79	8	3	3	NUM
arestyrurj-238	79	9	)	)	PUNCT
arestyrurj-238	79	10	where	where	SCONJ
arestyrurj-238	79	11	δ	δ	PROPN
arestyrurj-238	79	12	represents	represent	VERB
arestyrurj-238	79	13	the	the	DET
arestyrurj-238	79	14	angle	angle	NOUN
arestyrurj-238	79	15	between	between	ADP
arestyrurj-238	79	16	the	the	DET
arestyrurj-238	79	17	amino	amino	NOUN
arestyrurj-238	79	18	acid	acid	NOUN
arestyrurj-238	79	19	side	side	NOUN
arestyrurj-238	79	20	chains	chain	NOUN
arestyrurj-238	79	21	(	(	PUNCT
arestyrurj-238	79	22	δ	δ	X
arestyrurj-238	79	23	=	=	NOUN
arestyrurj-238	79	24	100	100	NUM
arestyrurj-238	79	25	for	for	ADP
arestyrurj-238	79	26	an	an	DET
arestyrurj-238	79	27	alpha	alpha	NOUN
arestyrurj-238	79	28	helix	helix	NOUN
arestyrurj-238	79	29	)	)	PUNCT
arestyrurj-238	79	30	,	,	PUNCT
arestyrurj-238	79	31	i	i	PRON
arestyrurj-238	79	32	represents	represent	VERB
arestyrurj-238	79	33	the	the	DET
arestyrurj-238	79	34	residue	residue	NOUN
arestyrurj-238	79	35	number	number	NOUN
arestyrurj-238	79	36	in	in	ADP
arestyrurj-238	79	37	the	the	DET
arestyrurj-238	79	38	ith	ith	PROPN
arestyrurj-238	79	39	position	position	NOUN
arestyrurj-238	79	40	,	,	PUNCT
arestyrurj-238	79	41	and	and	CCONJ
arestyrurj-238	79	42	hi	hi	INTJ
arestyrurj-238	79	43	represents	represent	VERB
arestyrurj-238	79	44	the	the	DET
arestyrurj-238	79	45	ith	ith	PROPN
arestyrurj-238	79	46	amino	amino	PROPN
arestyrurj-238	79	47	acid	acid	PROPN
arestyrurj-238	79	48	’s	’s	PART
arestyrurj-238	79	49	hydrophobicity	hydrophobicity	NOUN
arestyrurj-238	79	50	based	base	VERB
arestyrurj-238	79	51	on	on	ADP
arestyrurj-238	79	52	an	an	DET
arestyrurj-238	79	53	averaged	average	VERB
arestyrurj-238	79	54	consensus	consensus	NOUN
arestyrurj-238	79	55	scale	scale	NOUN
arestyrurj-238	79	56	(	(	PUNCT
arestyrurj-238	79	57	eisenberg	eisenberg	PROPN
arestyrurj-238	79	58	et	et	PROPN
arestyrurj-238	79	59	al	al	PROPN
arestyrurj-238	79	60	.	.	PROPN
arestyrurj-238	79	61	,	,	PUNCT
arestyrurj-238	79	62	1982	1982	NUM
arestyrurj-238	79	63	,	,	PUNCT
arestyrurj-238	79	64	1984	1984	NUM
arestyrurj-238	79	65	)	)	PUNCT
arestyrurj-238	79	66	.	.	PUNCT
arestyrurj-238	80	1	we	we	PRON
arestyrurj-238	80	2	modified	modify	VERB
arestyrurj-238	80	3	this	this	DET
arestyrurj-238	80	4	equation	equation	NOUN
arestyrurj-238	80	5	to	to	PART
arestyrurj-238	80	6	determine	determine	VERB
arestyrurj-238	80	7	the	the	DET
arestyrurj-238	80	8	maximum	maximum	ADJ
arestyrurj-238	80	9	average	average	ADJ
arestyrurj-238	80	10	hydrophobic	hydrophobic	NOUN
arestyrurj-238	80	11	moment	moment	NOUN
arestyrurj-238	80	12	across	across	ADP
arestyrurj-238	80	13	an	an	DET
arestyrurj-238	80	14	11	11	NUM
arestyrurj-238	80	15	amino	amino	NOUN
arestyrurj-238	80	16	acid	acid	NOUN
arestyrurj-238	80	17	window	window	NOUN
arestyrurj-238	80	18	,	,	PUNCT
arestyrurj-238	80	19	which	which	PRON
arestyrurj-238	80	20	represents	represent	VERB
arestyrurj-238	80	21	three	three	NUM
arestyrurj-238	80	22	turns	turn	NOUN
arestyrurj-238	80	23	of	of	ADP
arestyrurj-238	80	24	an	an	DET
arestyrurj-238	80	25	alpha	alpha	NOUN
arestyrurj-238	80	26	helix	helix	NOUN
arestyrurj-238	80	27	,	,	PUNCT
arestyrurj-238	80	28	with	with	ADP
arestyrurj-238	80	29	δ	δ	PROPN
arestyrurj-238	80	30	ranging	range	VERB
arestyrurj-238	80	31	from	from	ADP
arestyrurj-238	80	32	90	90	NUM
arestyrurj-238	80	33	°	°	NOUN
arestyrurj-238	80	34	to	to	ADP
arestyrurj-238	80	35	110	110	NUM
arestyrurj-238	80	36	°	°	NOUN
arestyrurj-238	80	37	instead	instead	ADV
arestyrurj-238	80	38	of	of	ADP
arestyrurj-238	80	39	fixing	fix	VERB
arestyrurj-238	80	40	it	it	PRON
arestyrurj-238	80	41	at	at	ADP
arestyrurj-238	80	42	100	100	NUM
arestyrurj-238	80	43	°	°	NOUN
arestyrurj-238	80	44	.	.	PUNCT
arestyrurj-238	80	45	by	by	ADP
arestyrurj-238	80	46	adding	add	VERB
arestyrurj-238	80	47	these	these	DET
arestyrurj-238	80	48	modifications	modification	NOUN
arestyrurj-238	80	49	,	,	PUNCT
arestyrurj-238	80	50	we	we	PRON
arestyrurj-238	80	51	hope	hope	VERB
arestyrurj-238	80	52	to	to	PART
arestyrurj-238	80	53	account	account	VERB
arestyrurj-238	80	54	for	for	ADP
arestyrurj-238	80	55	peptides	peptide	NOUN
arestyrurj-238	80	56	that	that	PRON
arestyrurj-238	80	57	have	have	VERB
arestyrurj-238	80	58	alpha	alpha	ADJ
arestyrurj-238	80	59	helical	helical	ADJ
arestyrurj-238	80	60	segments	segment	NOUN
arestyrurj-238	80	61	but	but	CCONJ
arestyrurj-238	80	62	may	may	AUX
arestyrurj-238	80	63	not	not	PART
arestyrurj-238	80	64	have	have	VERB
arestyrurj-238	80	65	a	a	DET
arestyrurj-238	80	66	complete	complete	ADJ
arestyrurj-238	80	67	alpha	alpha	ADJ
arestyrurj-238	80	68	helical	helical	ADJ
arestyrurj-238	80	69	structure	structure	NOUN
arestyrurj-238	80	70	.	.	PUNCT
arestyrurj-238	81	1	additionally	additionally	ADV
arestyrurj-238	81	2	,	,	PUNCT
arestyrurj-238	81	3	instead	instead	ADV
arestyrurj-238	81	4	of	of	ADP
arestyrurj-238	81	5	using	use	VERB
arestyrurj-238	81	6	the	the	DET
arestyrurj-238	81	7	averaged	averaged	ADJ
arestyrurj-238	81	8	consensus	consensus	NOUN
arestyrurj-238	81	9	scale	scale	NOUN
arestyrurj-238	81	10	,	,	PUNCT
arestyrurj-238	81	11	values	value	NOUN
arestyrurj-238	81	12	from	from	ADP
arestyrurj-238	81	13	fauchere	fauchere	ADJ
arestyrurj-238	81	14	and	and	CCONJ
arestyrurj-238	81	15	pliska	pliska	NOUN
arestyrurj-238	81	16	’s	’s	PART
arestyrurj-238	81	17	(	(	PUNCT
arestyrurj-238	81	18	1983	1983	NUM
arestyrurj-238	81	19	)	)	PUNCT
arestyrurj-238	81	20	scale	scale	NOUN
arestyrurj-238	81	21	were	be	AUX
arestyrurj-238	81	22	used	use	VERB
arestyrurj-238	81	23	.	.	PUNCT
arestyrurj-238	82	1	<	<	X
arestyrurj-238	82	2	𝜇𝑚𝑎𝑥	𝜇𝑚𝑎𝑥	X
arestyrurj-238	82	3	>	>	X
arestyrurj-238	82	4	=	=	PUNCT
arestyrurj-238	82	5	√[∑	√[∑	NOUN
arestyrurj-238	82	6	𝐻𝑖	𝐻𝑖	PROPN
arestyrurj-238	82	7	cos(𝑖𝛿)𝑖	cos(𝑖𝛿)𝑖	PROPN
arestyrurj-238	82	8	]	]	X
arestyrurj-238	82	9	2	2	NUM
arestyrurj-238	82	10	+	+	CCONJ
arestyrurj-238	83	1	[	[	X
arestyrurj-238	83	2	∑	∑	X
arestyrurj-238	83	3	𝐻𝑖	𝐻𝑖	PROPN
arestyrurj-238	83	4	sin(𝑖𝛿)𝑖	sin(𝑖𝛿)𝑖	NOUN
arestyrurj-238	83	5	]	]	X
arestyrurj-238	83	6	2	2	NUM
arestyrurj-238	83	7	11	11	NUM
arestyrurj-238	83	8	(	(	PUNCT
arestyrurj-238	83	9	4	4	NUM
arestyrurj-238	83	10	)	)	PUNCT
arestyrurj-238	83	11	maximum	maximum	ADJ
arestyrurj-238	83	12	average	average	ADJ
arestyrurj-238	83	13	hydrophobic	hydrophobic	NOUN
arestyrurj-238	83	14	residue	residue	NOUN
arestyrurj-238	83	15	.	.	PUNCT
arestyrurj-238	84	1	the	the	DET
arestyrurj-238	84	2	hydrophobic	hydrophobic	NOUN
arestyrurj-238	84	3	residue	residue	NOUN
arestyrurj-238	84	4	calculation	calculation	NOUN
arestyrurj-238	84	5	provides	provide	VERB
arestyrurj-238	84	6	a	a	DET
arestyrurj-238	84	7	measure	measure	NOUN
arestyrurj-238	84	8	of	of	ADP
arestyrurj-238	84	9	the	the	DET
arestyrurj-238	84	10	average	average	ADJ
arestyrurj-238	84	11	hydrophobicity	hydrophobicity	NOUN
arestyrurj-238	84	12	across	across	ADP
arestyrurj-238	84	13	an	an	DET
arestyrurj-238	84	14	11	11	NUM
arestyrurj-238	84	15	amino	amino	NOUN
arestyrurj-238	84	16	acid	acid	NOUN
arestyrurj-238	84	17	window	window	NOUN
arestyrurj-238	84	18	.	.	PUNCT
arestyrurj-238	85	1	as	as	ADP
arestyrurj-238	85	2	in	in	ADP
arestyrurj-238	85	3	the	the	DET
arestyrurj-238	85	4	maximum	maximum	ADJ
arestyrurj-238	85	5	average	average	ADJ
arestyrurj-238	85	6	hydrophobic	hydrophobic	NOUN
arestyrurj-238	85	7	moment	moment	NOUN
arestyrurj-238	85	8	calculation	calculation	NOUN
arestyrurj-238	85	9	,	,	PUNCT
arestyrurj-238	85	10	hi	hi	INTJ
arestyrurj-238	85	11	represents	represent	VERB
arestyrurj-238	85	12	the	the	DET
arestyrurj-238	85	13	ith	ith	PROPN
arestyrurj-238	85	14	amino	amino	PROPN
arestyrurj-238	85	15	acid	acid	PROPN
arestyrurj-238	85	16	’s	’s	PART
arestyrurj-238	85	17	hydrophobicity	hydrophobicity	NOUN
arestyrurj-238	85	18	based	base	VERB
arestyrurj-238	85	19	on	on	ADP
arestyrurj-238	85	20	fauchere	fauchere	ADJ
arestyrurj-238	85	21	and	and	CCONJ
arestyrurj-238	85	22	pliska	pliska	NOUN
arestyrurj-238	85	23	’s	’s	PART
arestyrurj-238	85	24	scale	scale	NOUN
arestyrurj-238	85	25	(	(	PUNCT
arestyrurj-238	85	26	1983	1983	NUM
arestyrurj-238	85	27	)	)	PUNCT
arestyrurj-238	85	28	.	.	PUNCT
arestyrurj-238	86	1	aresty	aresty	PROPN
arestyrurj-238	86	2	rutgers	rutgers	PROPN
arestyrurj-238	86	3	undergraduate	undergraduate	PROPN
arestyrurj-238	86	4	research	research	PROPN
arestyrurj-238	86	5	journal	journal	PROPN
arestyrurj-238	86	6	,	,	PUNCT
arestyrurj-238	86	7	volume	volume	NOUN
arestyrurj-238	86	8	i	i	PRON
arestyrurj-238	86	9	,	,	PUNCT
arestyrurj-238	86	10	issue	issue	VERB
arestyrurj-238	86	11	v	v	ADP
arestyrurj-238	86	12	<	<	X
arestyrurj-238	86	13	𝐻𝑚𝑎𝑥	𝐻𝑚𝑎𝑥	PROPN
arestyrurj-238	86	14	>	>	X
arestyrurj-238	86	15	=	=	PUNCT
arestyrurj-238	86	16	∑	∑	PUNCT
arestyrurj-238	86	17	𝐻𝑖𝑖	𝐻𝑖𝑖	PROPN
arestyrurj-238	86	18	11	11	NUM
arestyrurj-238	86	19	(	(	PUNCT
arestyrurj-238	86	20	5	5	NUM
arestyrurj-238	86	21	)	)	PUNCT
arestyrurj-238	86	22	average	average	ADJ
arestyrurj-238	86	23	alpha	alpha	NOUN
arestyrurj-238	86	24	helix	helix	NOUN
arestyrurj-238	86	25	propensity	propensity	NOUN
arestyrurj-238	86	26	score	score	NOUN
arestyrurj-238	86	27	.	.	PUNCT
arestyrurj-238	87	1	alphahelices	alphahelice	NOUN
arestyrurj-238	87	2	are	be	AUX
arestyrurj-238	87	3	the	the	DET
arestyrurj-238	87	4	most	most	ADV
arestyrurj-238	87	5	common	common	ADJ
arestyrurj-238	87	6	secondary	secondary	ADJ
arestyrurj-238	87	7	structure	structure	NOUN
arestyrurj-238	87	8	seen	see	VERB
arestyrurj-238	87	9	in	in	ADP
arestyrurj-238	87	10	amps	amp	NOUN
arestyrurj-238	87	11	.	.	PUNCT
arestyrurj-238	88	1	studies	study	NOUN
arestyrurj-238	88	2	have	have	AUX
arestyrurj-238	88	3	demonstrated	demonstrate	VERB
arestyrurj-238	88	4	that	that	SCONJ
arestyrurj-238	88	5	increased	increase	VERB
arestyrurj-238	88	6	alpha	alpha	NOUN
arestyrurj-238	88	7	-	-	PUNCT
arestyrurj-238	88	8	helical	helical	ADJ
arestyrurj-238	88	9	content	content	NOUN
arestyrurj-238	88	10	correlates	correlate	VERB
arestyrurj-238	88	11	to	to	ADP
arestyrurj-238	88	12	greater	great	ADJ
arestyrurj-238	88	13	antimicrobial	antimicrobial	ADJ
arestyrurj-238	88	14	activity	activity	NOUN
arestyrurj-238	88	15	(	(	PUNCT
arestyrurj-238	88	16	li	li	PROPN
arestyrurj-238	88	17	et	et	PROPN
arestyrurj-238	88	18	al	al	PROPN
arestyrurj-238	88	19	.	.	PROPN
arestyrurj-238	88	20	,	,	PUNCT
arestyrurj-238	88	21	2021	2021	NUM
arestyrurj-238	88	22	)	)	PUNCT
arestyrurj-238	88	23	.	.	PUNCT
arestyrurj-238	89	1	the	the	DET
arestyrurj-238	89	2	alpha	alpha	ADJ
arestyrurj-238	89	3	helix	helix	NOUN
arestyrurj-238	89	4	propensity	propensity	NOUN
arestyrurj-238	89	5	score	score	NOUN
arestyrurj-238	89	6	describes	describe	VERB
arestyrurj-238	89	7	how	how	SCONJ
arestyrurj-238	89	8	likely	likely	ADJ
arestyrurj-238	89	9	a	a	DET
arestyrurj-238	89	10	peptide	peptide	NOUN
arestyrurj-238	89	11	will	will	AUX
arestyrurj-238	89	12	form	form	VERB
arestyrurj-238	89	13	an	an	DET
arestyrurj-238	89	14	alpha	alpha	NOUN
arestyrurj-238	89	15	helix	helix	NOUN
arestyrurj-238	89	16	.	.	PUNCT
arestyrurj-238	90	1	pace	pace	NOUN
arestyrurj-238	90	2	and	and	CCONJ
arestyrurj-238	90	3	scholtz	scholtz	ADJ
arestyrurj-238	90	4	(	(	PUNCT
arestyrurj-238	90	5	1998	1998	NUM
arestyrurj-238	90	6	)	)	PUNCT
arestyrurj-238	90	7	created	create	VERB
arestyrurj-238	90	8	a	a	DET
arestyrurj-238	90	9	helix	helix	ADJ
arestyrurj-238	90	10	propensity	propensity	NOUN
arestyrurj-238	90	11	scale	scale	NOUN
arestyrurj-238	90	12	based	base	VERB
arestyrurj-238	90	13	on	on	ADP
arestyrurj-238	90	14	experimental	experimental	ADJ
arestyrurj-238	90	15	studies	study	NOUN
arestyrurj-238	90	16	of	of	ADP
arestyrurj-238	90	17	proteins	protein	NOUN
arestyrurj-238	90	18	and	and	CCONJ
arestyrurj-238	90	19	peptides	peptide	NOUN
arestyrurj-238	90	20	.	.	PUNCT
arestyrurj-238	91	1	the	the	DET
arestyrurj-238	91	2	propensity	propensity	NOUN
arestyrurj-238	91	3	score	score	NOUN
arestyrurj-238	91	4	is	be	AUX
arestyrurj-238	91	5	given	give	VERB
arestyrurj-238	91	6	in	in	ADP
arestyrurj-238	91	7	terms	term	NOUN
arestyrurj-238	91	8	of	of	ADP
arestyrurj-238	91	9	the	the	DET
arestyrurj-238	91	10	amount	amount	NOUN
arestyrurj-238	91	11	of	of	ADP
arestyrurj-238	91	12	energy	energy	NOUN
arestyrurj-238	91	13	required	require	VERB
arestyrurj-238	91	14	for	for	ADP
arestyrurj-238	91	15	a	a	DET
arestyrurj-238	91	16	given	give	VERB
arestyrurj-238	91	17	amino	amino	NOUN
arestyrurj-238	91	18	acid	acid	NOUN
arestyrurj-238	91	19	to	to	PART
arestyrurj-238	91	20	fold	fold	VERB
arestyrurj-238	91	21	into	into	ADP
arestyrurj-238	91	22	an	an	DET
arestyrurj-238	91	23	alpha	alpha	NOUN
arestyrurj-238	91	24	helix	helix	NOUN
arestyrurj-238	91	25	,	,	PUNCT
arestyrurj-238	91	26	with	with	ADP
arestyrurj-238	91	27	a	a	DET
arestyrurj-238	91	28	higher	high	ADJ
arestyrurj-238	91	29	propensity	propensity	NOUN
arestyrurj-238	91	30	score	score	NOUN
arestyrurj-238	91	31	corresponding	correspond	VERB
arestyrurj-238	91	32	to	to	ADP
arestyrurj-238	91	33	a	a	DET
arestyrurj-238	91	34	smaller	small	ADJ
arestyrurj-238	91	35	probability	probability	NOUN
arestyrurj-238	91	36	that	that	SCONJ
arestyrurj-238	91	37	the	the	DET
arestyrurj-238	91	38	peptide	peptide	NOUN
arestyrurj-238	91	39	will	will	AUX
arestyrurj-238	91	40	form	form	VERB
arestyrurj-238	91	41	an	an	DET
arestyrurj-238	91	42	alpha	alpha	ADJ
arestyrurj-238	91	43	helical	helical	ADJ
arestyrurj-238	91	44	shape	shape	NOUN
arestyrurj-238	91	45	.	.	PUNCT
arestyrurj-238	92	1	we	we	PRON
arestyrurj-238	92	2	modified	modify	VERB
arestyrurj-238	92	3	porto	porto	PROPN
arestyrurj-238	92	4	et	et	PROPN
arestyrurj-238	92	5	al	al	PROPN
arestyrurj-238	92	6	.	.	PROPN
arestyrurj-238	92	7	’s	’s	PART
arestyrurj-238	92	8	(	(	PUNCT
arestyrurj-238	92	9	2018	2018	NUM
arestyrurj-238	92	10	)	)	PUNCT
arestyrurj-238	92	11	alpha	alpha	NOUN
arestyrurj-238	92	12	helix	helix	NOUN
arestyrurj-238	92	13	propensity	propensity	NOUN
arestyrurj-238	92	14	score	score	NOUN
arestyrurj-238	92	15	calculation	calculation	NOUN
arestyrurj-238	92	16	by	by	ADP
arestyrurj-238	92	17	dividing	divide	VERB
arestyrurj-238	92	18	it	it	PRON
arestyrurj-238	92	19	by	by	ADP
arestyrurj-238	92	20	peptide	peptide	ADJ
arestyrurj-238	92	21	length	length	NOUN
arestyrurj-238	92	22	to	to	PART
arestyrurj-238	92	23	standardize	standardize	VERB
arestyrurj-238	92	24	the	the	DET
arestyrurj-238	92	25	propensity	propensity	NOUN
arestyrurj-238	92	26	score	score	NOUN
arestyrurj-238	92	27	across	across	ADP
arestyrurj-238	92	28	the	the	DET
arestyrurj-238	92	29	entire	entire	ADJ
arestyrurj-238	92	30	peptide	peptide	NOUN
arestyrurj-238	92	31	.	.	PUNCT
arestyrurj-238	93	1	<	<	X
arestyrurj-238	93	2	𝛼	𝛼	X
arestyrurj-238	93	3	>	>	X
arestyrurj-238	93	4	=	=	PUNCT
arestyrurj-238	94	1	∑	∑	PUNCT
arestyrurj-238	94	2	𝑒𝐻𝑥𝑖𝑖	𝑒𝐻𝑥𝑖𝑖	PROPN
arestyrurj-238	94	3	𝑃𝑒𝑝𝑡𝑖𝑑𝑒	𝑃𝑒𝑝𝑡𝑖𝑑𝑒	PROPN
arestyrurj-238	94	4	𝐿𝑒𝑛𝑔𝑡ℎ	𝐿𝑒𝑛𝑔𝑡ℎ	PROPN
arestyrurj-238	94	5	(	(	PUNCT
arestyrurj-238	94	6	6	6	NUM
arestyrurj-238	94	7	)	)	PUNCT
arestyrurj-238	94	8	hxi	hxi	NOUN
arestyrurj-238	94	9	represents	represent	VERB
arestyrurj-238	94	10	the	the	DET
arestyrurj-238	94	11	ith	ith	PROPN
arestyrurj-238	94	12	amino	amino	PROPN
arestyrurj-238	94	13	acid	acid	PROPN
arestyrurj-238	94	14	’s	’s	PART
arestyrurj-238	94	15	helix	helix	ADJ
arestyrurj-238	94	16	propensity	propensity	NOUN
arestyrurj-238	94	17	,	,	PUNCT
arestyrurj-238	94	18	based	base	VERB
arestyrurj-238	94	19	on	on	ADP
arestyrurj-238	94	20	the	the	DET
arestyrurj-238	94	21	pace	pace	NOUN
arestyrurj-238	94	22	–	–	PUNCT
arestyrurj-238	94	23	schols	schol	NOUN
arestyrurj-238	94	24	scale	scale	NOUN
arestyrurj-238	94	25	.	.	PUNCT
arestyrurj-238	95	1	cation	cation	NOUN
arestyrurj-238	95	2	-	-	PUNCT
arestyrurj-238	95	3	pi	pi	NOUN
arestyrurj-238	95	4	interactions	interaction	NOUN
arestyrurj-238	95	5	.	.	PUNCT
arestyrurj-238	96	1	cation	cation	NOUN
arestyrurj-238	96	2	-	-	PUNCT
arestyrurj-238	96	3	pi	pi	NOUN
arestyrurj-238	96	4	interactions	interaction	NOUN
arestyrurj-238	96	5	between	between	ADP
arestyrurj-238	96	6	the	the	DET
arestyrurj-238	96	7	positively	positively	ADV
arestyrurj-238	96	8	charged	charge	VERB
arestyrurj-238	96	9	side	side	NOUN
arestyrurj-238	96	10	chain	chain	NOUN
arestyrurj-238	96	11	of	of	ADP
arestyrurj-238	96	12	an	an	DET
arestyrurj-238	96	13	arginine	arginine	NOUN
arestyrurj-238	96	14	amino	amino	NOUN
arestyrurj-238	96	15	acid	acid	NOUN
arestyrurj-238	96	16	residue	residue	NOUN
arestyrurj-238	96	17	and	and	CCONJ
arestyrurj-238	96	18	the	the	DET
arestyrurj-238	96	19	aromatic	aromatic	ADJ
arestyrurj-238	96	20	side	side	NOUN
arestyrurj-238	96	21	chain	chain	NOUN
arestyrurj-238	96	22	of	of	ADP
arestyrurj-238	96	23	a	a	DET
arestyrurj-238	96	24	tryptophan	tryptophan	NOUN
arestyrurj-238	96	25	amino	amino	NOUN
arestyrurj-238	96	26	acid	acid	NOUN
arestyrurj-238	96	27	residue	residue	NOUN
arestyrurj-238	96	28	are	be	AUX
arestyrurj-238	96	29	of	of	ADP
arestyrurj-238	96	30	interest	interest	NOUN
arestyrurj-238	96	31	because	because	SCONJ
arestyrurj-238	96	32	studies	study	NOUN
arestyrurj-238	96	33	suggest	suggest	VERB
arestyrurj-238	96	34	that	that	SCONJ
arestyrurj-238	96	35	tryptophan	tryptophan	NOUN
arestyrurj-238	96	36	containing	contain	VERB
arestyrurj-238	96	37	peptides	peptide	NOUN
arestyrurj-238	96	38	have	have	VERB
arestyrurj-238	96	39	higher	high	ADJ
arestyrurj-238	96	40	affinity	affinity	NOUN
arestyrurj-238	96	41	for	for	ADP
arestyrurj-238	96	42	deeper	deep	ADJ
arestyrurj-238	96	43	insertion	insertion	NOUN
arestyrurj-238	96	44	into	into	ADP
arestyrurj-238	96	45	bacterial	bacterial	ADJ
arestyrurj-238	96	46	cell	cell	NOUN
arestyrurj-238	96	47	membranes	membrane	NOUN
arestyrurj-238	96	48	(	(	PUNCT
arestyrurj-238	96	49	hicapie	hicapie	PROPN
arestyrurj-238	96	50	et	et	PROPN
arestyrurj-238	96	51	al	al	PROPN
arestyrurj-238	96	52	,	,	PUNCT
arestyrurj-238	96	53	2018	2018	NUM
arestyrurj-238	96	54	)	)	PUNCT
arestyrurj-238	96	55	.	.	PUNCT
arestyrurj-238	97	1	assuming	assume	VERB
arestyrurj-238	97	2	that	that	SCONJ
arestyrurj-238	97	3	the	the	DET
arestyrurj-238	97	4	peptide	peptide	NOUN
arestyrurj-238	97	5	adopts	adopt	VERB
arestyrurj-238	97	6	an	an	DET
arestyrurj-238	97	7	alpha	alpha	NOUN
arestyrurj-238	97	8	helix	helix	ADJ
arestyrurj-238	97	9	secondary	secondary	ADJ
arestyrurj-238	97	10	structure	structure	NOUN
arestyrurj-238	97	11	,	,	PUNCT
arestyrurj-238	97	12	a	a	DET
arestyrurj-238	97	13	cation	cation	NOUN
arestyrurj-238	97	14	-	-	PUNCT
arestyrurj-238	97	15	pi	pi	NOUN
arestyrurj-238	97	16	interaction	interaction	NOUN
arestyrurj-238	97	17	exists	exist	VERB
arestyrurj-238	97	18	only	only	ADV
arestyrurj-238	97	19	for	for	ADP
arestyrurj-238	97	20	the	the	DET
arestyrurj-238	97	21	configuration	configuration	NOUN
arestyrurj-238	97	22	where	where	SCONJ
arestyrurj-238	97	23	an	an	DET
arestyrurj-238	97	24	arginine	arginine	NOUN
arestyrurj-238	97	25	is	be	AUX
arestyrurj-238	97	26	four	four	NUM
arestyrurj-238	97	27	residues	residue	NOUN
arestyrurj-238	97	28	after	after	ADP
arestyrurj-238	97	29	a	a	DET
arestyrurj-238	97	30	tryptophan	tryptophan	NOUN
arestyrurj-238	97	31	(	(	PUNCT
arestyrurj-238	97	32	shi	shi	PROPN
arestyrurj-238	97	33	et	et	PROPN
arestyrurj-238	97	34	al	al	PROPN
arestyrurj-238	97	35	.	.	PROPN
arestyrurj-238	97	36	,	,	PUNCT
arestyrurj-238	97	37	2022	2022	NUM
arestyrurj-238	97	38	)	)	PUNCT
arestyrurj-238	97	39	.	.	PUNCT
arestyrurj-238	98	1	we	we	PRON
arestyrurj-238	98	2	computed	compute	VERB
arestyrurj-238	98	3	a	a	DET
arestyrurj-238	98	4	simple	simple	ADJ
arestyrurj-238	98	5	count	count	NOUN
arestyrurj-238	98	6	for	for	ADP
arestyrurj-238	98	7	the	the	DET
arestyrurj-238	98	8	number	number	NOUN
arestyrurj-238	98	9	of	of	ADP
arestyrurj-238	98	10	cationpi	cationpi	ADJ
arestyrurj-238	98	11	interactions	interaction	NOUN
arestyrurj-238	98	12	within	within	ADP
arestyrurj-238	98	13	a	a	DET
arestyrurj-238	98	14	peptide	peptide	ADJ
arestyrurj-238	98	15	sequence	sequence	NOUN
arestyrurj-238	98	16	.	.	PUNCT
arestyrurj-238	99	1	𝑇𝑟𝑝	𝑇𝑟𝑝	NOUN
arestyrurj-238	99	2	⟶	⟶	NOUN
arestyrurj-238	99	3	𝐴𝑟𝑔	𝐴𝑟𝑔	PROPN
arestyrurj-238	99	4	(	(	PUNCT
arestyrurj-238	99	5	𝑖	𝑖	PROPN
arestyrurj-238	99	6	,	,	PUNCT
arestyrurj-238	99	7	𝑖	𝑖	X
arestyrurj-238	99	8	+	+	NOUN
arestyrurj-238	99	9	4	4	NUM
arestyrurj-238	99	10	)	)	PUNCT
arestyrurj-238	99	11	(	(	PUNCT
arestyrurj-238	99	12	7	7	X
arestyrurj-238	99	13	)	)	PUNCT
arestyrurj-238	99	14	statistical	statistical	ADJ
arestyrurj-238	99	15	analyses	analysis	NOUN
arestyrurj-238	99	16	and	and	CCONJ
arestyrurj-238	99	17	machine	machine	NOUN
arestyrurj-238	99	18	learning	learn	VERB
arestyrurj-238	99	19	techniques	technique	VERB
arestyrurj-238	99	20	scatterplot	scatterplot	NOUN
arestyrurj-238	99	21	matrix	matrix	NOUN
arestyrurj-238	99	22	.	.	PUNCT
arestyrurj-238	100	1	using	use	VERB
arestyrurj-238	100	2	the	the	DET
arestyrurj-238	100	3	psych	psych	NOUN
arestyrurj-238	100	4	r	r	NOUN
arestyrurj-238	100	5	package	package	NOUN
arestyrurj-238	100	6	,	,	PUNCT
arestyrurj-238	100	7	a	a	DET
arestyrurj-238	100	8	scatterplot	scatterplot	NOUN
arestyrurj-238	100	9	matrix	matrix	NOUN
arestyrurj-238	100	10	was	be	AUX
arestyrurj-238	100	11	generated	generate	VERB
arestyrurj-238	100	12	to	to	PART
arestyrurj-238	100	13	visualize	visualize	VERB
arestyrurj-238	100	14	the	the	DET
arestyrurj-238	100	15	pairwise	pairwise	NOUN
arestyrurj-238	100	16	relationships	relationship	NOUN
arestyrurj-238	100	17	between	between	ADP
arestyrurj-238	100	18	the	the	DET
arestyrurj-238	100	19	selected	select	VERB
arestyrurj-238	100	20	biophysical	biophysical	ADJ
arestyrurj-238	100	21	features	feature	NOUN
arestyrurj-238	100	22	.	.	PUNCT
arestyrurj-238	101	1	a	a	DET
arestyrurj-238	101	2	scatterplot	scatterplot	NOUN
arestyrurj-238	101	3	matrix	matrix	NOUN
arestyrurj-238	101	4	helps	help	VERB
arestyrurj-238	101	5	to	to	PART
arestyrurj-238	101	6	graphically	graphically	ADV
arestyrurj-238	101	7	and	and	CCONJ
arestyrurj-238	101	8	quantitatively	quantitatively	ADV
arestyrurj-238	101	9	identify	identify	VERB
arestyrurj-238	101	10	if	if	SCONJ
arestyrurj-238	101	11	multicollinearity	multicollinearity	NOUN
arestyrurj-238	101	12	exists	exist	VERB
arestyrurj-238	101	13	among	among	ADP
arestyrurj-238	101	14	the	the	DET
arestyrurj-238	101	15	various	various	ADJ
arestyrurj-238	101	16	molecular	molecular	ADJ
arestyrurj-238	101	17	properties	property	NOUN
arestyrurj-238	101	18	of	of	ADP
arestyrurj-238	101	19	interest	interest	NOUN
arestyrurj-238	101	20	.	.	PUNCT
arestyrurj-238	102	1	principal	principal	ADJ
arestyrurj-238	102	2	component	component	NOUN
arestyrurj-238	102	3	analysis	analysis	NOUN
arestyrurj-238	102	4	(	(	PUNCT
arestyrurj-238	102	5	pca	pca	NOUN
arestyrurj-238	102	6	)	)	PUNCT
arestyrurj-238	102	7	.	.	PUNCT
arestyrurj-238	103	1	as	as	ADP
arestyrurj-238	103	2	a	a	DET
arestyrurj-238	103	3	dimensionality	dimensionality	NOUN
arestyrurj-238	103	4	reduction	reduction	NOUN
arestyrurj-238	103	5	technique	technique	NOUN
arestyrurj-238	103	6	,	,	PUNCT
arestyrurj-238	103	7	pca	pca	PROPN
arestyrurj-238	103	8	is	be	AUX
arestyrurj-238	103	9	appropriate	appropriate	ADJ
arestyrurj-238	103	10	for	for	ADP
arestyrurj-238	103	11	our	our	PRON
arestyrurj-238	103	12	purposes	purpose	NOUN
arestyrurj-238	103	13	because	because	SCONJ
arestyrurj-238	103	14	the	the	DET
arestyrurj-238	103	15	dbaasp	dbaasp	NOUN
arestyrurj-238	103	16	subset	subset	NOUN
arestyrurj-238	103	17	is	be	AUX
arestyrurj-238	103	18	a	a	DET
arestyrurj-238	103	19	large	large	ADJ
arestyrurj-238	103	20	data	datum	NOUN
arestyrurj-238	103	21	set	set	VERB
arestyrurj-238	103	22	in	in	ADP
arestyrurj-238	103	23	which	which	PRON
arestyrurj-238	103	24	each	each	DET
arestyrurj-238	103	25	observation	observation	NOUN
arestyrurj-238	103	26	contains	contain	VERB
arestyrurj-238	103	27	a	a	DET
arestyrurj-238	103	28	high	high	ADJ
arestyrurj-238	103	29	number	number	NOUN
arestyrurj-238	103	30	of	of	ADP
arestyrurj-238	103	31	features	feature	NOUN
arestyrurj-238	103	32	(	(	PUNCT
arestyrurj-238	103	33	each	each	DET
arestyrurj-238	103	34	peptide	peptide	NOUN
arestyrurj-238	103	35	is	be	AUX
arestyrurj-238	103	36	associated	associate	VERB
arestyrurj-238	103	37	with	with	ADP
arestyrurj-238	103	38	seven	seven	NUM
arestyrurj-238	103	39	molecular	molecular	ADJ
arestyrurj-238	103	40	properties	property	NOUN
arestyrurj-238	103	41	)	)	PUNCT
arestyrurj-238	103	42	.	.	PUNCT
arestyrurj-238	104	1	pca	pca	PROPN
arestyrurj-238	104	2	was	be	AUX
arestyrurj-238	104	3	conducted	conduct	VERB
arestyrurj-238	104	4	using	use	VERB
arestyrurj-238	104	5	the	the	DET
arestyrurj-238	104	6	factoextra	factoextra	ADJ
arestyrurj-238	104	7	r	r	NOUN
arestyrurj-238	104	8	package	package	NOUN
arestyrurj-238	104	9	and	and	CCONJ
arestyrurj-238	104	10	is	be	AUX
arestyrurj-238	104	11	accomplished	accomplish	VERB
arestyrurj-238	104	12	by	by	ADP
arestyrurj-238	104	13	linearly	linearly	ADV
arestyrurj-238	104	14	transforming	transform	VERB
arestyrurj-238	104	15	the	the	DET
arestyrurj-238	104	16	data	datum	NOUN
arestyrurj-238	104	17	onto	onto	ADP
arestyrurj-238	104	18	a	a	DET
arestyrurj-238	104	19	new	new	ADJ
arestyrurj-238	104	20	coordinate	coordinate	NOUN
arestyrurj-238	104	21	system	system	NOUN
arestyrurj-238	104	22	.	.	PUNCT
arestyrurj-238	105	1	information	information	NOUN
arestyrurj-238	105	2	is	be	AUX
arestyrurj-238	105	3	projected	project	VERB
arestyrurj-238	105	4	onto	onto	ADP
arestyrurj-238	105	5	a	a	DET
arestyrurj-238	105	6	two	two	NUM
arestyrurj-238	105	7	-	-	PUNCT
arestyrurj-238	105	8	dimensional	dimensional	ADJ
arestyrurj-238	105	9	space	space	NOUN
arestyrurj-238	105	10	,	,	PUNCT
arestyrurj-238	105	11	increasing	increase	VERB
arestyrurj-238	105	12	interpretability	interpretability	NOUN
arestyrurj-238	105	13	while	while	SCONJ
arestyrurj-238	105	14	preserving	preserve	VERB
arestyrurj-238	105	15	the	the	DET
arestyrurj-238	105	16	maximum	maximum	ADJ
arestyrurj-238	105	17	amount	amount	NOUN
arestyrurj-238	105	18	of	of	ADP
arestyrurj-238	105	19	information	information	NOUN
arestyrurj-238	105	20	(	(	PUNCT
arestyrurj-238	105	21	jolliffe	jolliffe	PROPN
arestyrurj-238	105	22	&	&	CCONJ
arestyrurj-238	105	23	cadima	cadima	PROPN
arestyrurj-238	105	24	,	,	PUNCT
arestyrurj-238	105	25	2016	2016	NUM
arestyrurj-238	105	26	)	)	PUNCT
arestyrurj-238	105	27	.	.	PUNCT
arestyrurj-238	106	1	decision	decision	NOUN
arestyrurj-238	106	2	trees	tree	NOUN
arestyrurj-238	106	3	.	.	PUNCT
arestyrurj-238	107	1	classification	classification	NOUN
arestyrurj-238	107	2	and	and	CCONJ
arestyrurj-238	107	3	regression	regression	NOUN
arestyrurj-238	107	4	tree	tree	NOUN
arestyrurj-238	107	5	(	(	PUNCT
arestyrurj-238	107	6	cart	cart	NOUN
arestyrurj-238	107	7	)	)	PUNCT
arestyrurj-238	107	8	is	be	AUX
arestyrurj-238	107	9	a	a	DET
arestyrurj-238	107	10	predictive	predictive	ADJ
arestyrurj-238	107	11	modeling	modeling	NOUN
arestyrurj-238	107	12	approach	approach	NOUN
arestyrurj-238	107	13	.	.	PUNCT
arestyrurj-238	108	1	it	it	PRON
arestyrurj-238	108	2	illustrates	illustrate	VERB
arestyrurj-238	108	3	how	how	SCONJ
arestyrurj-238	108	4	peptide	peptide	ADJ
arestyrurj-238	108	5	effectiveness	effectiveness	NOUN
arestyrurj-238	108	6	(	(	PUNCT
arestyrurj-238	108	7	response	response	NOUN
arestyrurj-238	108	8	variable	variable	NOUN
arestyrurj-238	108	9	)	)	PUNCT
arestyrurj-238	108	10	can	can	AUX
arestyrurj-238	108	11	be	be	AUX
arestyrurj-238	108	12	predicted	predict	VERB
arestyrurj-238	108	13	based	base	VERB
arestyrurj-238	108	14	on	on	ADP
arestyrurj-238	108	15	the	the	DET
arestyrurj-238	108	16	seven	seven	NUM
arestyrurj-238	108	17	biophysical	biophysical	ADJ
arestyrurj-238	108	18	properties	property	NOUN
arestyrurj-238	108	19	(	(	PUNCT
arestyrurj-238	108	20	explanatory	explanatory	ADJ
arestyrurj-238	108	21	variables	variable	NOUN
arestyrurj-238	108	22	)	)	PUNCT
arestyrurj-238	108	23	.	.	PUNCT
arestyrurj-238	109	1	while	while	SCONJ
arestyrurj-238	109	2	classification	classification	NOUN
arestyrurj-238	109	3	trees	tree	NOUN
arestyrurj-238	109	4	are	be	AUX
arestyrurj-238	109	5	used	use	VERB
arestyrurj-238	109	6	for	for	ADP
arestyrurj-238	109	7	predicting	predict	VERB
arestyrurj-238	109	8	a	a	DET
arestyrurj-238	109	9	qualitative	qualitative	ADJ
arestyrurj-238	109	10	outcome	outcome	NOUN
arestyrurj-238	109	11	,	,	PUNCT
arestyrurj-238	109	12	regression	regression	NOUN
arestyrurj-238	109	13	trees	tree	NOUN
arestyrurj-238	109	14	are	be	AUX
arestyrurj-238	109	15	used	use	VERB
arestyrurj-238	109	16	for	for	ADP
arestyrurj-238	109	17	predicting	predict	VERB
arestyrurj-238	109	18	a	a	DET
arestyrurj-238	109	19	quantitative	quantitative	ADJ
arestyrurj-238	109	20	outcome	outcome	NOUN
arestyrurj-238	109	21	(	(	PUNCT
arestyrurj-238	109	22	krzywinski	krzywinski	PROPN
arestyrurj-238	109	23	&	&	CCONJ
arestyrurj-238	109	24	altman	altman	PROPN
arestyrurj-238	109	25	,	,	PUNCT
arestyrurj-238	109	26	2017	2017	NUM
arestyrurj-238	109	27	)	)	PUNCT
arestyrurj-238	109	28	.	.	PUNCT
arestyrurj-238	110	1	using	use	VERB
arestyrurj-238	110	2	the	the	DET
arestyrurj-238	110	3	rpart	rpart	NOUN
arestyrurj-238	110	4	and	and	CCONJ
arestyrurj-238	110	5	rpart.plot	rpart.plot	NOUN
arestyrurj-238	110	6	r	r	NOUN
arestyrurj-238	110	7	packages	package	NOUN
arestyrurj-238	110	8	,	,	PUNCT
arestyrurj-238	110	9	we	we	PRON
arestyrurj-238	110	10	generated	generate	VERB
arestyrurj-238	110	11	cart	cart	NOUN
arestyrurj-238	110	12	for	for	ADP
arestyrurj-238	110	13	the	the	DET
arestyrurj-238	110	14	dbaasp	dbaasp	NOUN
arestyrurj-238	110	15	subset	subset	NOUN
arestyrurj-238	110	16	.	.	PUNCT
arestyrurj-238	111	1	for	for	ADP
arestyrurj-238	111	2	the	the	DET
arestyrurj-238	111	3	classification	classification	NOUN
arestyrurj-238	111	4	tree	tree	NOUN
arestyrurj-238	111	5	,	,	PUNCT
arestyrurj-238	111	6	the	the	DET
arestyrurj-238	111	7	peptides	peptide	NOUN
arestyrurj-238	111	8	were	be	AUX
arestyrurj-238	111	9	separated	separate	VERB
arestyrurj-238	111	10	into	into	ADP
arestyrurj-238	111	11	two	two	NUM
arestyrurj-238	111	12	classes	class	NOUN
arestyrurj-238	111	13	based	base	VERB
arestyrurj-238	111	14	on	on	ADP
arestyrurj-238	111	15	a	a	DET
arestyrurj-238	111	16	mic	mic	ADJ
arestyrurj-238	111	17	threshold	threshold	NOUN
arestyrurj-238	111	18	that	that	SCONJ
arestyrurj-238	111	19	we	we	PRON
arestyrurj-238	111	20	specified	specify	VERB
arestyrurj-238	111	21	:	:	PUNCT
arestyrurj-238	111	22	noneffective	noneffective	ADJ
arestyrurj-238	111	23	(	(	PUNCT
arestyrurj-238	111	24	mic	mic	ADJ
arestyrurj-238	111	25	≥	≥	NUM
arestyrurj-238	111	26	4	4	NUM
arestyrurj-238	111	27	µm	µm	NOUN
arestyrurj-238	111	28	)	)	PUNCT
arestyrurj-238	111	29	and	and	CCONJ
arestyrurj-238	111	30	effective	effective	ADJ
arestyrurj-238	111	31	(	(	PUNCT
arestyrurj-238	111	32	mic	mic	ADJ
arestyrurj-238	111	33	<	<	X
arestyrurj-238	111	34	4	4	NUM
arestyrurj-238	111	35	µm	µm	NOUN
arestyrurj-238	111	36	)	)	PUNCT
arestyrurj-238	111	37	.	.	PUNCT
arestyrurj-238	112	1	for	for	ADP
arestyrurj-238	112	2	the	the	DET
arestyrurj-238	112	3	regression	regression	NOUN
arestyrurj-238	112	4	tree	tree	NOUN
arestyrurj-238	112	5	,	,	PUNCT
arestyrurj-238	112	6	the	the	DET
arestyrurj-238	112	7	peptides	peptide	NOUN
arestyrurj-238	112	8	were	be	AUX
arestyrurj-238	112	9	partitioned	partition	VERB
arestyrurj-238	112	10	based	base	VERB
arestyrurj-238	112	11	on	on	ADP
arestyrurj-238	112	12	their	their	PRON
arestyrurj-238	112	13	biophysical	biophysical	ADJ
arestyrurj-238	112	14	properties	property	NOUN
arestyrurj-238	112	15	,	,	PUNCT
arestyrurj-238	112	16	and	and	CCONJ
arestyrurj-238	112	17	an	an	DET
arestyrurj-238	112	18	average	average	ADJ
arestyrurj-238	112	19	log2(mic	log2(mic	NOUN
arestyrurj-238	112	20	)	)	PUNCT
arestyrurj-238	112	21	was	be	AUX
arestyrurj-238	112	22	reported	report	VERB
arestyrurj-238	112	23	for	for	ADP
arestyrurj-238	112	24	each	each	DET
arestyrurj-238	112	25	subgroup	subgroup	NOUN
arestyrurj-238	112	26	.	.	PUNCT
arestyrurj-238	113	1	log2(mic	log2(mic	PROPN
arestyrurj-238	113	2	)	)	PUNCT
arestyrurj-238	113	3	was	be	AUX
arestyrurj-238	113	4	used	use	VERB
arestyrurj-238	113	5	in	in	ADP
arestyrurj-238	113	6	place	place	NOUN
arestyrurj-238	113	7	of	of	ADP
arestyrurj-238	113	8	the	the	DET
arestyrurj-238	113	9	mic	mic	NOUN
arestyrurj-238	113	10	to	to	PART
arestyrurj-238	113	11	reduce	reduce	VERB
arestyrurj-238	113	12	the	the	DET
arestyrurj-238	113	13	skewness	skewness	NOUN
arestyrurj-238	113	14	of	of	ADP
arestyrurj-238	113	15	the	the	DET
arestyrurj-238	113	16	mic	mic	ADJ
arestyrurj-238	113	17	data	datum	NOUN
arestyrurj-238	113	18	.	.	PUNCT
arestyrurj-238	114	1	log2(mic	log2(mic	PROPN
arestyrurj-238	114	2	)	)	PUNCT
arestyrurj-238	114	3	was	be	AUX
arestyrurj-238	114	4	the	the	DET
arestyrurj-238	114	5	most	most	ADV
arestyrurj-238	114	6	sensible	sensible	ADJ
arestyrurj-238	114	7	transformation	transformation	NOUN
arestyrurj-238	114	8	to	to	PART
arestyrurj-238	114	9	apply	apply	VERB
arestyrurj-238	114	10	because	because	SCONJ
arestyrurj-238	114	11	mic	mic	ADJ
arestyrurj-238	114	12	assays	assay	NOUN
arestyrurj-238	114	13	are	be	AUX
arestyrurj-238	114	14	based	base	VERB
arestyrurj-238	114	15	on	on	ADP
arestyrurj-238	114	16	two	two	NUM
arestyrurj-238	114	17	-	-	PUNCT
arestyrurj-238	114	18	fold	fold	ADJ
arestyrurj-238	114	19	serial	serial	ADJ
arestyrurj-238	114	20	dilutions	dilution	NOUN
arestyrurj-238	114	21	.	.	PUNCT
arestyrurj-238	115	1	random	random	ADJ
arestyrurj-238	115	2	forests	forest	NOUN
arestyrurj-238	115	3	.	.	PUNCT
arestyrurj-238	116	1	the	the	DET
arestyrurj-238	116	2	random	random	ADJ
arestyrurj-238	116	3	forest	forest	NOUN
arestyrurj-238	116	4	algorithm	algorithm	NOUN
arestyrurj-238	116	5	is	be	AUX
arestyrurj-238	116	6	an	an	DET
arestyrurj-238	116	7	ensemble	ensemble	ADJ
arestyrurj-238	116	8	learning	learning	NOUN
arestyrurj-238	116	9	method	method	NOUN
arestyrurj-238	116	10	that	that	PRON
arestyrurj-238	116	11	aggregates	aggregate	VERB
arestyrurj-238	116	12	multiple	multiple	ADJ
arestyrurj-238	116	13	decision	decision	NOUN
arestyrurj-238	116	14	trees	tree	NOUN
arestyrurj-238	116	15	to	to	PART
arestyrurj-238	116	16	create	create	VERB
arestyrurj-238	116	17	more	more	ADV
arestyrurj-238	116	18	accurate	accurate	ADJ
arestyrurj-238	116	19	predictions	prediction	NOUN
arestyrurj-238	116	20	(	(	PUNCT
arestyrurj-238	116	21	brieman	brieman	NOUN
arestyrurj-238	116	22	,	,	PUNCT
arestyrurj-238	116	23	2001	2001	NUM
arestyrurj-238	116	24	)	)	PUNCT
arestyrurj-238	116	25	.	.	PUNCT
arestyrurj-238	117	1	like	like	ADP
arestyrurj-238	117	2	decision	decision	NOUN
arestyrurj-238	117	3	trees	tree	NOUN
arestyrurj-238	117	4	,	,	PUNCT
arestyrurj-238	117	5	random	random	ADJ
arestyrurj-238	117	6	forests	forest	NOUN
arestyrurj-238	117	7	can	can	AUX
arestyrurj-238	117	8	handle	handle	VERB
arestyrurj-238	117	9	both	both	CCONJ
arestyrurj-238	117	10	regression	regression	NOUN
arestyrurj-238	117	11	and	and	CCONJ
arestyrurj-238	117	12	classification	classification	NOUN
arestyrurj-238	117	13	tasks	task	NOUN
arestyrurj-238	117	14	.	.	PUNCT
arestyrurj-238	118	1	however	however	ADV
arestyrurj-238	118	2	,	,	PUNCT
arestyrurj-238	118	3	it	it	PRON
arestyrurj-238	118	4	is	be	AUX
arestyrurj-238	118	5	a	a	DET
arestyrurj-238	118	6	more	more	ADV
arestyrurj-238	118	7	robust	robust	ADJ
arestyrurj-238	118	8	approach	approach	NOUN
arestyrurj-238	118	9	than	than	ADP
arestyrurj-238	118	10	cart	cart	NOUN
arestyrurj-238	118	11	because	because	SCONJ
arestyrurj-238	118	12	it	it	PRON
arestyrurj-238	118	13	controls	control	VERB
arestyrurj-238	118	14	overfitting	overfitte	VERB
arestyrurj-238	118	15	.	.	PUNCT
arestyrurj-238	119	1	functions	function	NOUN
arestyrurj-238	119	2	from	from	ADP
arestyrurj-238	119	3	the	the	DET
arestyrurj-238	119	4	randomforest	randomfor	ADJ
arestyrurj-238	119	5	r	r	NOUN
arestyrurj-238	119	6	package	package	NOUN
arestyrurj-238	119	7	were	be	AUX
arestyrurj-238	119	8	implemented	implement	VERB
arestyrurj-238	119	9	to	to	PART
arestyrurj-238	119	10	construct	construct	VERB
arestyrurj-238	119	11	a	a	DET
arestyrurj-238	119	12	random	random	ADJ
arestyrurj-238	119	13	forest	forest	NOUN
arestyrurj-238	119	14	aresty	aresty	ADJ
arestyrurj-238	119	15	rutgers	rutgers	PROPN
arestyrurj-238	119	16	undergraduate	undergraduate	PROPN
arestyrurj-238	119	17	research	research	PROPN
arestyrurj-238	119	18	journal	journal	PROPN
arestyrurj-238	119	19	,	,	PUNCT
arestyrurj-238	119	20	volume	volume	NOUN
arestyrurj-238	119	21	i	i	PRON
arestyrurj-238	119	22	,	,	PUNCT
arestyrurj-238	119	23	issue	issue	VERB
arestyrurj-238	119	24	v	v	NUM
arestyrurj-238	119	25	regression	regression	NOUN
arestyrurj-238	119	26	model	model	NOUN
arestyrurj-238	119	27	.	.	PUNCT
arestyrurj-238	120	1	the	the	DET
arestyrurj-238	120	2	model	model	NOUN
arestyrurj-238	120	3	included	include	VERB
arestyrurj-238	120	4	all	all	DET
arestyrurj-238	120	5	seven	seven	NUM
arestyrurj-238	120	6	biophysical	biophysical	ADJ
arestyrurj-238	120	7	properties	property	NOUN
arestyrurj-238	120	8	as	as	ADP
arestyrurj-238	120	9	the	the	DET
arestyrurj-238	120	10	explanatory	explanatory	ADJ
arestyrurj-238	120	11	variables	variable	NOUN
arestyrurj-238	120	12	with	with	ADP
arestyrurj-238	120	13	log2(mic	log2(mic	PROPN
arestyrurj-238	120	14	)	)	PUNCT
arestyrurj-238	120	15	as	as	ADP
arestyrurj-238	120	16	the	the	DET
arestyrurj-238	120	17	response	response	NOUN
arestyrurj-238	120	18	variable	variable	NOUN
arestyrurj-238	120	19	.	.	PUNCT
arestyrurj-238	121	1	based	base	VERB
arestyrurj-238	121	2	on	on	ADP
arestyrurj-238	121	3	the	the	DET
arestyrurj-238	121	4	method	method	NOUN
arestyrurj-238	121	5	used	use	VERB
arestyrurj-238	121	6	to	to	PART
arestyrurj-238	121	7	generate	generate	VERB
arestyrurj-238	121	8	the	the	DET
arestyrurj-238	121	9	prediction	prediction	NOUN
arestyrurj-238	121	10	algorithm	algorithm	NOUN
arestyrurj-238	121	11	by	by	ADP
arestyrurj-238	121	12	thomas	thomas	PROPN
arestyrurj-238	121	13	et	et	PROPN
arestyrurj-238	121	14	al	al	PROPN
arestyrurj-238	121	15	.	.	PROPN
arestyrurj-238	122	1	(	(	PUNCT
arestyrurj-238	122	2	2010	2010	NUM
arestyrurj-238	122	3	)	)	PUNCT
arestyrurj-238	122	4	,	,	PUNCT
arestyrurj-238	122	5	70	70	NUM
arestyrurj-238	122	6	%	%	NOUN
arestyrurj-238	122	7	of	of	ADP
arestyrurj-238	122	8	the	the	DET
arestyrurj-238	122	9	4,218	4,218	NUM
arestyrurj-238	122	10	peptides	peptide	NOUN
arestyrurj-238	122	11	in	in	ADP
arestyrurj-238	122	12	the	the	DET
arestyrurj-238	122	13	dbaasp	dbaasp	NOUN
arestyrurj-238	122	14	data	datum	NOUN
arestyrurj-238	122	15	set	set	VERB
arestyrurj-238	122	16	were	be	AUX
arestyrurj-238	122	17	used	use	VERB
arestyrurj-238	122	18	as	as	ADP
arestyrurj-238	122	19	the	the	DET
arestyrurj-238	122	20	training	training	NOUN
arestyrurj-238	122	21	set	set	NOUN
arestyrurj-238	122	22	and	and	CCONJ
arestyrurj-238	122	23	30	30	NUM
arestyrurj-238	122	24	%	%	NOUN
arestyrurj-238	122	25	were	be	AUX
arestyrurj-238	122	26	used	use	VERB
arestyrurj-238	122	27	as	as	ADP
arestyrurj-238	122	28	the	the	DET
arestyrurj-238	122	29	testing	testing	NOUN
arestyrurj-238	122	30	set	set	NOUN
arestyrurj-238	122	31	.	.	PUNCT
arestyrurj-238	123	1	the	the	DET
arestyrurj-238	123	2	training	training	NOUN
arestyrurj-238	123	3	set	set	NOUN
arestyrurj-238	123	4	was	be	AUX
arestyrurj-238	123	5	used	use	VERB
arestyrurj-238	123	6	to	to	PART
arestyrurj-238	123	7	build	build	VERB
arestyrurj-238	123	8	a	a	DET
arestyrurj-238	123	9	random	random	ADJ
arestyrurj-238	123	10	forest	forest	NOUN
arestyrurj-238	123	11	regression	regression	NOUN
arestyrurj-238	123	12	model	model	NOUN
arestyrurj-238	123	13	that	that	PRON
arestyrurj-238	123	14	would	would	AUX
arestyrurj-238	123	15	predict	predict	VERB
arestyrurj-238	123	16	the	the	DET
arestyrurj-238	123	17	log2(mic	log2(mic	NOUN
arestyrurj-238	123	18	)	)	PUNCT
arestyrurj-238	123	19	of	of	ADP
arestyrurj-238	123	20	peptide	peptide	ADJ
arestyrurj-238	123	21	sequences	sequence	NOUN
arestyrurj-238	123	22	.	.	PUNCT
arestyrurj-238	124	1	designing	design	VERB
arestyrurj-238	124	2	and	and	CCONJ
arestyrurj-238	124	3	testing	test	VERB
arestyrurj-238	124	4	peptides	peptide	NOUN
arestyrurj-238	124	5	designing	design	VERB
arestyrurj-238	124	6	peptides	peptide	NOUN
arestyrurj-238	124	7	.	.	PUNCT
arestyrurj-238	125	1	based	base	VERB
arestyrurj-238	125	2	on	on	ADP
arestyrurj-238	125	3	the	the	DET
arestyrurj-238	125	4	features	feature	NOUN
arestyrurj-238	125	5	learned	learn	VERB
arestyrurj-238	125	6	from	from	ADP
arestyrurj-238	125	7	the	the	DET
arestyrurj-238	125	8	bioinformatic	bioinformatic	ADJ
arestyrurj-238	125	9	analyses	analysis	NOUN
arestyrurj-238	125	10	of	of	ADP
arestyrurj-238	125	11	the	the	DET
arestyrurj-238	125	12	dbaasp	dbaasp	NOUN
arestyrurj-238	125	13	,	,	PUNCT
arestyrurj-238	125	14	we	we	PRON
arestyrurj-238	125	15	wanted	want	VERB
arestyrurj-238	125	16	to	to	PART
arestyrurj-238	125	17	design	design	VERB
arestyrurj-238	125	18	new	new	ADJ
arestyrurj-238	125	19	,	,	PUNCT
arestyrurj-238	125	20	synthetic	synthetic	ADJ
arestyrurj-238	125	21	peptide	peptide	NOUN
arestyrurj-238	125	22	sequences	sequence	NOUN
arestyrurj-238	125	23	.	.	PUNCT
arestyrurj-238	126	1	we	we	PRON
arestyrurj-238	126	2	generated	generate	VERB
arestyrurj-238	126	3	a	a	DET
arestyrurj-238	126	4	set	set	NOUN
arestyrurj-238	126	5	of	of	ADP
arestyrurj-238	126	6	50,000	50,000	NUM
arestyrurj-238	126	7	random	random	ADJ
arestyrurj-238	126	8	peptide	peptide	NOUN
arestyrurj-238	126	9	sequences	sequence	NOUN
arestyrurj-238	126	10	that	that	PRON
arestyrurj-238	126	11	had	have	VERB
arestyrurj-238	126	12	the	the	DET
arestyrurj-238	126	13	same	same	ADJ
arestyrurj-238	126	14	length	length	NOUN
arestyrurj-238	126	15	and	and	CCONJ
arestyrurj-238	126	16	amino	amino	NOUN
arestyrurj-238	126	17	acid	acid	NOUN
arestyrurj-238	126	18	distributions	distribution	NOUN
arestyrurj-238	126	19	as	as	ADP
arestyrurj-238	126	20	those	those	PRON
arestyrurj-238	126	21	in	in	ADP
arestyrurj-238	126	22	our	our	PRON
arestyrurj-238	126	23	dbaasp	dbaasp	NOUN
arestyrurj-238	126	24	subset	subset	NOUN
arestyrurj-238	126	25	(	(	PUNCT
arestyrurj-238	126	26	figure	figure	NOUN
arestyrurj-238	126	27	1	1	NUM
arestyrurj-238	126	28	)	)	PUNCT
arestyrurj-238	126	29	.	.	PUNCT
arestyrurj-238	127	1	to	to	PART
arestyrurj-238	127	2	control	control	VERB
arestyrurj-238	127	3	the	the	DET
arestyrurj-238	127	4	amino	amino	NOUN
arestyrurj-238	127	5	acid	acid	NOUN
arestyrurj-238	127	6	distribution	distribution	NOUN
arestyrurj-238	127	7	,	,	PUNCT
arestyrurj-238	127	8	we	we	PRON
arestyrurj-238	127	9	assigned	assign	VERB
arestyrurj-238	127	10	each	each	DET
arestyrurj-238	127	11	amino	amino	NOUN
arestyrurj-238	127	12	acid	acid	NOUN
arestyrurj-238	127	13	with	with	ADP
arestyrurj-238	127	14	a	a	DET
arestyrurj-238	127	15	probability	probability	NOUN
arestyrurj-238	127	16	of	of	ADP
arestyrurj-238	127	17	occurrence	occurrence	NOUN
arestyrurj-238	127	18	based	base	VERB
arestyrurj-238	127	19	on	on	ADP
arestyrurj-238	127	20	the	the	DET
arestyrurj-238	127	21	frequency	frequency	NOUN
arestyrurj-238	127	22	that	that	PRON
arestyrurj-238	127	23	each	each	PRON
arestyrurj-238	127	24	appeared	appear	VERB
arestyrurj-238	127	25	in	in	ADP
arestyrurj-238	127	26	the	the	DET
arestyrurj-238	127	27	dbaasp	dbaasp	NOUN
arestyrurj-238	127	28	subset	subset	NOUN
arestyrurj-238	127	29	.	.	PUNCT
arestyrurj-238	128	1	we	we	PRON
arestyrurj-238	128	2	then	then	ADV
arestyrurj-238	128	3	computed	compute	VERB
arestyrurj-238	128	4	the	the	DET
arestyrurj-238	128	5	seven	seven	NUM
arestyrurj-238	128	6	biophysical	biophysical	ADJ
arestyrurj-238	128	7	properties	property	NOUN
arestyrurj-238	128	8	of	of	ADP
arestyrurj-238	128	9	interest	interest	NOUN
arestyrurj-238	128	10	for	for	ADP
arestyrurj-238	128	11	all	all	DET
arestyrurj-238	128	12	50,000	50,000	NUM
arestyrurj-238	128	13	peptide	peptide	ADJ
arestyrurj-238	128	14	sequences	sequence	NOUN
arestyrurj-238	128	15	.	.	PUNCT
arestyrurj-238	129	1	from	from	ADP
arestyrurj-238	129	2	there	there	ADV
arestyrurj-238	129	3	,	,	PUNCT
arestyrurj-238	129	4	we	we	PRON
arestyrurj-238	129	5	were	be	AUX
arestyrurj-238	129	6	able	able	ADJ
arestyrurj-238	129	7	to	to	PART
arestyrurj-238	129	8	use	use	VERB
arestyrurj-238	129	9	the	the	DET
arestyrurj-238	129	10	random	random	ADJ
arestyrurj-238	129	11	forest	forest	NOUN
arestyrurj-238	129	12	regression	regression	NOUN
arestyrurj-238	129	13	model	model	NOUN
arestyrurj-238	129	14	to	to	PART
arestyrurj-238	129	15	generate	generate	VERB
arestyrurj-238	129	16	predictions	prediction	NOUN
arestyrurj-238	129	17	for	for	ADP
arestyrurj-238	129	18	their	their	PRON
arestyrurj-238	129	19	log2(mic	log2(mic	ADJ
arestyrurj-238	129	20	)	)	PUNCT
arestyrurj-238	129	21	values	value	NOUN
arestyrurj-238	129	22	.	.	PUNCT
arestyrurj-238	130	1	selecting	select	VERB
arestyrurj-238	130	2	peptides	peptide	NOUN
arestyrurj-238	130	3	for	for	ADP
arestyrurj-238	130	4	experimental	experimental	ADJ
arestyrurj-238	130	5	testing	testing	NOUN
arestyrurj-238	130	6	.	.	PUNCT
arestyrurj-238	131	1	our	our	PRON
arestyrurj-238	131	2	goal	goal	NOUN
arestyrurj-238	131	3	was	be	AUX
arestyrurj-238	131	4	to	to	PART
arestyrurj-238	131	5	determine	determine	VERB
arestyrurj-238	131	6	if	if	SCONJ
arestyrurj-238	131	7	any	any	PRON
arestyrurj-238	131	8	of	of	ADP
arestyrurj-238	131	9	the	the	DET
arestyrurj-238	131	10	designed	design	VERB
arestyrurj-238	131	11	peptides	peptide	NOUN
arestyrurj-238	131	12	were	be	AUX
arestyrurj-238	131	13	effective	effective	ADJ
arestyrurj-238	131	14	in	in	ADP
arestyrurj-238	131	15	vitro	vitro	X
arestyrurj-238	131	16	against	against	ADP
arestyrurj-238	131	17	p.	p.	NOUN
arestyrurj-238	131	18	aeruginosa	aeruginosa	PROPN
arestyrurj-238	131	19	infections	infection	NOUN
arestyrurj-238	131	20	.	.	PUNCT
arestyrurj-238	132	1	assuming	assume	VERB
arestyrurj-238	132	2	that	that	SCONJ
arestyrurj-238	132	3	the	the	DET
arestyrurj-238	132	4	peptides	peptide	NOUN
arestyrurj-238	132	5	with	with	ADP
arestyrurj-238	132	6	the	the	DET
arestyrurj-238	132	7	lowest	low	ADJ
arestyrurj-238	132	8	predicted	predict	VERB
arestyrurj-238	132	9	mics	mic	NOUN
arestyrurj-238	132	10	have	have	VERB
arestyrurj-238	132	11	the	the	DET
arestyrurj-238	132	12	greatest	great	ADJ
arestyrurj-238	132	13	likelihoods	likelihood	NOUN
arestyrurj-238	132	14	for	for	ADP
arestyrurj-238	132	15	being	be	AUX
arestyrurj-238	132	16	effective	effective	ADJ
arestyrurj-238	132	17	,	,	PUNCT
arestyrurj-238	132	18	we	we	PRON
arestyrurj-238	132	19	decided	decide	VERB
arestyrurj-238	132	20	to	to	PART
arestyrurj-238	132	21	examine	examine	VERB
arestyrurj-238	132	22	20	20	NUM
arestyrurj-238	132	23	generated	generate	VERB
arestyrurj-238	132	24	peptide	peptide	NOUN
arestyrurj-238	132	25	sequences	sequence	NOUN
arestyrurj-238	132	26	with	with	ADP
arestyrurj-238	132	27	the	the	DET
arestyrurj-238	132	28	lowest	low	ADJ
arestyrurj-238	132	29	predicted	predict	VERB
arestyrurj-238	132	30	log2(mic	log2(mic	PROPN
arestyrurj-238	132	31	)	)	PUNCT
arestyrurj-238	132	32	values	value	NOUN
arestyrurj-238	132	33	more	more	ADV
arestyrurj-238	132	34	closely	closely	ADV
arestyrurj-238	132	35	.	.	PUNCT
arestyrurj-238	133	1	for	for	ADP
arestyrurj-238	133	2	the	the	DET
arestyrurj-238	133	3	20	20	NUM
arestyrurj-238	133	4	peptide	peptide	NOUN
arestyrurj-238	133	5	sequences	sequence	NOUN
arestyrurj-238	133	6	,	,	PUNCT
arestyrurj-238	133	7	we	we	PRON
arestyrurj-238	133	8	used	use	VERB
arestyrurj-238	133	9	the	the	DET
arestyrurj-238	133	10	hemolytic	hemolytic	ADJ
arestyrurj-238	133	11	activity	activity	NOUN
arestyrurj-238	133	12	prediction	prediction	NOUN
arestyrurj-238	133	13	for	for	ADP
arestyrurj-238	133	14	peptides	peptide	NOUN
arestyrurj-238	133	15	employing	employ	VERB
arestyrurj-238	133	16	neural	neural	ADJ
arestyrurj-238	133	17	networks	network	NOUN
arestyrurj-238	133	18	(	(	PUNCT
arestyrurj-238	133	19	happenn	happenn	PROPN
arestyrurj-238	133	20	)	)	PUNCT
arestyrurj-238	133	21	tool	tool	NOUN
arestyrurj-238	133	22	to	to	PART
arestyrurj-238	133	23	calculate	calculate	VERB
arestyrurj-238	133	24	the	the	DET
arestyrurj-238	133	25	predicted	predict	VERB
arestyrurj-238	133	26	hemolytic	hemolytic	ADJ
arestyrurj-238	133	27	activity	activity	NOUN
arestyrurj-238	133	28	of	of	ADP
arestyrurj-238	133	29	the	the	DET
arestyrurj-238	133	30	peptides	peptide	NOUN
arestyrurj-238	133	31	(	(	PUNCT
arestyrurj-238	133	32	timmons	timmon	NOUN
arestyrurj-238	133	33	&	&	CCONJ
arestyrurj-238	133	34	hewage	hewage	NOUN
arestyrurj-238	133	35	,	,	PUNCT
arestyrurj-238	133	36	2020	2020	NUM
arestyrurj-238	133	37	)	)	PUNCT
arestyrurj-238	133	38	.	.	PUNCT
arestyrurj-238	134	1	the	the	DET
arestyrurj-238	134	2	happenn	happenn	PROPN
arestyrurj-238	134	3	tool	tool	PROPN
arestyrurj-238	134	4	provides	provide	VERB
arestyrurj-238	134	5	a	a	DET
arestyrurj-238	134	6	prob	prob	ADJ
arestyrurj-238	134	7	score	score	NOUN
arestyrurj-238	134	8	between	between	ADP
arestyrurj-238	134	9	0	0	NUM
arestyrurj-238	134	10	and	and	CCONJ
arestyrurj-238	134	11	1	1	NUM
arestyrurj-238	134	12	.	.	PUNCT
arestyrurj-238	135	1	a	a	DET
arestyrurj-238	135	2	peptide	peptide	NOUN
arestyrurj-238	135	3	with	with	ADP
arestyrurj-238	135	4	a	a	DET
arestyrurj-238	135	5	score	score	NOUN
arestyrurj-238	135	6	of	of	ADP
arestyrurj-238	135	7	0	0	NUM
arestyrurj-238	135	8	is	be	AUX
arestyrurj-238	135	9	predicted	predict	VERB
arestyrurj-238	135	10	to	to	PART
arestyrurj-238	135	11	be	be	AUX
arestyrurj-238	135	12	most	most	ADV
arestyrurj-238	135	13	likely	likely	ADJ
arestyrurj-238	135	14	non	non	ADJ
arestyrurj-238	135	15	-	-	ADJ
arestyrurj-238	135	16	hemolytic	hemolytic	ADJ
arestyrurj-238	135	17	,	,	PUNCT
arestyrurj-238	135	18	while	while	SCONJ
arestyrurj-238	135	19	a	a	DET
arestyrurj-238	135	20	peptide	peptide	NOUN
arestyrurj-238	135	21	with	with	ADP
arestyrurj-238	135	22	a	a	DET
arestyrurj-238	135	23	score	score	NOUN
arestyrurj-238	135	24	of	of	ADP
arestyrurj-238	135	25	1	1	NUM
arestyrurj-238	135	26	is	be	AUX
arestyrurj-238	135	27	predicted	predict	VERB
arestyrurj-238	135	28	to	to	PART
arestyrurj-238	135	29	be	be	AUX
arestyrurj-238	135	30	most	most	ADV
arestyrurj-238	135	31	likely	likely	ADJ
arestyrurj-238	135	32	hemolytic	hemolytic	ADJ
arestyrurj-238	135	33	.	.	PUNCT
arestyrurj-238	136	1	because	because	SCONJ
arestyrurj-238	136	2	the	the	DET
arestyrurj-238	136	3	happenn	happenn	PROPN
arestyrurj-238	136	4	tool	tool	NOUN
arestyrurj-238	136	5	can	can	AUX
arestyrurj-238	136	6	only	only	ADV
arestyrurj-238	136	7	make	make	VERB
arestyrurj-238	136	8	predictions	prediction	NOUN
arestyrurj-238	136	9	on	on	ADP
arestyrurj-238	136	10	sequences	sequence	NOUN
arestyrurj-238	136	11	with	with	ADP
arestyrurj-238	136	12	lengths	length	NOUN
arestyrurj-238	136	13	between	between	ADP
arestyrurj-238	136	14	7	7	NUM
arestyrurj-238	136	15	and	and	CCONJ
arestyrurj-238	136	16	35	35	NUM
arestyrurj-238	136	17	amino	amino	NOUN
arestyrurj-238	136	18	acids	acid	NOUN
arestyrurj-238	136	19	long	long	ADV
arestyrurj-238	136	20	,	,	PUNCT
arestyrurj-238	136	21	we	we	PRON
arestyrurj-238	136	22	were	be	AUX
arestyrurj-238	136	23	only	only	ADV
arestyrurj-238	136	24	able	able	ADJ
arestyrurj-238	136	25	to	to	PART
arestyrurj-238	136	26	deduce	deduce	VERB
arestyrurj-238	136	27	the	the	DET
arestyrurj-238	136	28	potential	potential	ADJ
arestyrurj-238	136	29	hemolytic	hemolytic	ADJ
arestyrurj-238	136	30	activity	activity	NOUN
arestyrurj-238	136	31	for	for	ADP
arestyrurj-238	136	32	11	11	NUM
arestyrurj-238	136	33	out	out	ADP
arestyrurj-238	136	34	of	of	ADP
arestyrurj-238	136	35	the	the	DET
arestyrurj-238	136	36	20	20	NUM
arestyrurj-238	136	37	peptides	peptide	NOUN
arestyrurj-238	136	38	.	.	PUNCT
arestyrurj-238	137	1	of	of	ADP
arestyrurj-238	137	2	those	those	DET
arestyrurj-238	137	3	11	11	NUM
arestyrurj-238	137	4	peptides	peptide	NOUN
arestyrurj-238	137	5	,	,	PUNCT
arestyrurj-238	137	6	8	8	NUM
arestyrurj-238	137	7	peptides	peptide	NOUN
arestyrurj-238	137	8	were	be	AUX
arestyrurj-238	137	9	predicted	predict	VERB
arestyrurj-238	137	10	to	to	PART
arestyrurj-238	137	11	be	be	AUX
arestyrurj-238	137	12	most	most	ADV
arestyrurj-238	137	13	likely	likely	ADJ
arestyrurj-238	137	14	non	non	ADJ
arestyrurj-238	137	15	-	-	ADJ
arestyrurj-238	137	16	hemolytic	hemolytic	ADJ
arestyrurj-238	137	17	.	.	PUNCT
arestyrurj-238	138	1	therefore	therefore	ADV
arestyrurj-238	138	2	,	,	PUNCT
arestyrurj-238	138	3	we	we	PRON
arestyrurj-238	138	4	decided	decide	VERB
arestyrurj-238	138	5	to	to	PART
arestyrurj-238	138	6	select	select	VERB
arestyrurj-238	138	7	those	those	DET
arestyrurj-238	138	8	8	8	NUM
arestyrurj-238	138	9	peptides	peptide	NOUN
arestyrurj-238	138	10	for	for	ADP
arestyrurj-238	138	11	experimental	experimental	ADJ
arestyrurj-238	138	12	testing	testing	NOUN
arestyrurj-238	138	13	.	.	PUNCT
arestyrurj-238	139	1	figure	figure	VERB
arestyrurj-238	139	2	1	1	NUM
arestyrurj-238	139	3	:	:	PUNCT
arestyrurj-238	139	4	(	(	PUNCT
arestyrurj-238	139	5	a	a	X
arestyrurj-238	139	6	)	)	PUNCT
arestyrurj-238	139	7	distribution	distribution	NOUN
arestyrurj-238	139	8	of	of	ADP
arestyrurj-238	139	9	lengths	length	NOUN
arestyrurj-238	139	10	for	for	ADP
arestyrurj-238	139	11	n	n	NOUN
arestyrurj-238	139	12	=	=	SYM
arestyrurj-238	139	13	4,218	4,218	NUM
arestyrurj-238	139	14	peptides	peptide	NOUN
arestyrurj-238	139	15	.	.	PUNCT
arestyrurj-238	140	1	(	(	PUNCT
arestyrurj-238	140	2	b	b	X
arestyrurj-238	140	3	)	)	PUNCT
arestyrurj-238	140	4	distribution	distribution	NOUN
arestyrurj-238	140	5	of	of	ADP
arestyrurj-238	140	6	amino	amino	NOUN
arestyrurj-238	140	7	acid	acid	NOUN
arestyrurj-238	140	8	residues	residue	NOUN
arestyrurj-238	140	9	that	that	PRON
arestyrurj-238	140	10	make	make	VERB
arestyrurj-238	140	11	up	up	ADP
arestyrurj-238	140	12	the	the	DET
arestyrurj-238	140	13	n	n	NOUN
arestyrurj-238	140	14	=	=	SYM
arestyrurj-238	140	15	4,218	4,218	NUM
arestyrurj-238	140	16	peptides	peptide	NOUN
arestyrurj-238	140	17	aresty	aresty	ADJ
arestyrurj-238	140	18	rutgers	rutgers	PROPN
arestyrurj-238	140	19	undergraduate	undergraduate	PROPN
arestyrurj-238	140	20	research	research	PROPN
arestyrurj-238	140	21	journal	journal	PROPN
arestyrurj-238	140	22	,	,	PUNCT
arestyrurj-238	140	23	volume	volume	NOUN
arestyrurj-238	140	24	i	i	PRON
arestyrurj-238	140	25	,	,	PUNCT
arestyrurj-238	140	26	issue	issue	NOUN
arestyrurj-238	140	27	v	v	PRON
arestyrurj-238	140	28	sequence	sequence	NOUN
arestyrurj-238	140	29	predicted	predict	VERB
arestyrurj-238	140	30	𝒍𝒐𝒈𝟐(mic	𝒍𝒐𝒈𝟐(mic	ADJ
arestyrurj-238	140	31	)	)	PUNCT
arestyrurj-238	140	32	akrtqrfprwkkclrlgfvgckgnilkaa	akrtqrfprwkkclrlgfvgckgnilkaa	PROPN
arestyrurj-238	140	33	-0.175	-0.175	PROPN
arestyrurj-238	141	1	rvrkgagtsrklkivknlgrhivwfkgip	rvrkgagtsrklkivknlgrhivwfkgip	VERB
arestyrurj-238	141	2	0.105	0.105	NUM
arestyrurj-238	141	3	irkyrpglfakfhkllknrkiggknl	irkyrpglfakfhkllknrkiggknl	PROPN
arestyrurj-238	141	4	0.141	0.141	NUM
arestyrurj-238	141	5	mkskptvimryrfwrvgkl	mkskptvimryrfwrvgkl	NOUN
arestyrurj-238	141	6	0.307	0.307	NUM
arestyrurj-238	141	7	rqacgtkakarlrkprcltigrrvvrkfskwr	rqacgtkakarlrkprcltigrrvvrkfskwr	NOUN
arestyrurj-238	141	8	0.329	0.329	NUM
arestyrurj-238	141	9	kmvakkvkikrckrkvhklpgfgsisil	kmvakkvkikrckrkvhklpgfgsisil	NOUN
arestyrurj-238	141	10	0.335	0.335	NUM
arestyrurj-238	141	11	liakygkhakfkakkkpqgisgvpkrfykalwig	liakygkhakfkakkkpqgisgvpkrfykalwig	PROPN
arestyrurj-238	141	12	0.432	0.432	NUM
arestyrurj-238	141	13	prriktgaakrkpklskkwnqkllkkltpfgw	prriktgaakrkpklskkwnqkllkkltpfgw	NOUN
arestyrurj-238	141	14	0.464	0.464	NUM
arestyrurj-238	141	15	table	table	NOUN
arestyrurj-238	141	16	1	1	NUM
arestyrurj-238	141	17	:	:	PUNCT
arestyrurj-238	141	18	list	list	NOUN
arestyrurj-238	141	19	of	of	ADP
arestyrurj-238	141	20	8	8	NUM
arestyrurj-238	141	21	peptide	peptide	NOUN
arestyrurj-238	141	22	sequences	sequence	NOUN
arestyrurj-238	141	23	selected	select	VERB
arestyrurj-238	141	24	from	from	ADP
arestyrurj-238	141	25	50,000	50,000	NUM
arestyrurj-238	141	26	computer	computer	NOUN
arestyrurj-238	141	27	generated	generate	VERB
arestyrurj-238	141	28	sequences	sequence	NOUN
arestyrurj-238	141	29	.	.	PUNCT
arestyrurj-238	142	1	these	these	DET
arestyrurj-238	142	2	peptides	peptide	NOUN
arestyrurj-238	142	3	are	be	AUX
arestyrurj-238	142	4	predicted	predict	VERB
arestyrurj-238	142	5	to	to	PART
arestyrurj-238	142	6	be	be	AUX
arestyrurj-238	142	7	both	both	CCONJ
arestyrurj-238	142	8	antimicrobial	antimicrobial	ADJ
arestyrurj-238	142	9	and	and	CCONJ
arestyrurj-238	142	10	nonhemolytic	nonhemolytic	ADJ
arestyrurj-238	142	11	.	.	PUNCT
arestyrurj-238	142	12	4	4	NUM
arestyrurj-238	142	13	results	result	NOUN
arestyrurj-238	142	14	and	and	CCONJ
arestyrurj-238	142	15	discussion	discussion	NOUN
arestyrurj-238	142	16	relationship	relationship	NOUN
arestyrurj-238	142	17	between	between	ADP
arestyrurj-238	142	18	molecular	molecular	ADJ
arestyrurj-238	142	19	properties	property	NOUN
arestyrurj-238	142	20	the	the	DET
arestyrurj-238	142	21	scatterplot	scatterplot	NOUN
arestyrurj-238	142	22	matrix	matrix	NOUN
arestyrurj-238	142	23	illustrates	illustrate	VERB
arestyrurj-238	142	24	the	the	DET
arestyrurj-238	142	25	relationship	relationship	NOUN
arestyrurj-238	142	26	between	between	ADP
arestyrurj-238	142	27	each	each	DET
arestyrurj-238	142	28	pair	pair	NOUN
arestyrurj-238	142	29	of	of	ADP
arestyrurj-238	142	30	molecular	molecular	ADJ
arestyrurj-238	142	31	properties	property	NOUN
arestyrurj-238	142	32	(	(	PUNCT
arestyrurj-238	142	33	figure	figure	NOUN
arestyrurj-238	142	34	2	2	NUM
arestyrurj-238	142	35	)	)	PUNCT
arestyrurj-238	142	36	.	.	PUNCT
arestyrurj-238	143	1	since	since	SCONJ
arestyrurj-238	143	2	none	none	NOUN
arestyrurj-238	143	3	of	of	ADP
arestyrurj-238	143	4	the	the	DET
arestyrurj-238	143	5	correlation	correlation	NOUN
arestyrurj-238	143	6	coefficients	coefficient	NOUN
arestyrurj-238	143	7	exceeds	exceed	VERB
arestyrurj-238	143	8	0.70	0.70	NUM
arestyrurj-238	143	9	,	,	PUNCT
arestyrurj-238	143	10	it	it	PRON
arestyrurj-238	143	11	is	be	AUX
arestyrurj-238	143	12	generally	generally	ADV
arestyrurj-238	143	13	agreed	agree	VERB
arestyrurj-238	143	14	upon	upon	SCONJ
arestyrurj-238	143	15	that	that	SCONJ
arestyrurj-238	143	16	none	none	NOUN
arestyrurj-238	143	17	of	of	ADP
arestyrurj-238	143	18	the	the	DET
arestyrurj-238	143	19	molecular	molecular	ADJ
arestyrurj-238	143	20	properties	property	NOUN
arestyrurj-238	143	21	is	be	AUX
arestyrurj-238	143	22	strongly	strongly	ADV
arestyrurj-238	143	23	linearly	linearly	ADV
arestyrurj-238	143	24	correlated	correlate	VERB
arestyrurj-238	143	25	with	with	ADP
arestyrurj-238	143	26	each	each	DET
arestyrurj-238	143	27	other	other	ADJ
arestyrurj-238	143	28	(	(	PUNCT
arestyrurj-238	143	29	ratner	ratner	NOUN
arestyrurj-238	143	30	,	,	PUNCT
arestyrurj-238	143	31	2009	2009	NUM
arestyrurj-238	143	32	)	)	PUNCT
arestyrurj-238	143	33	.	.	PUNCT
arestyrurj-238	144	1	this	this	PRON
arestyrurj-238	144	2	demonstrates	demonstrate	VERB
arestyrurj-238	144	3	that	that	SCONJ
arestyrurj-238	144	4	the	the	DET
arestyrurj-238	144	5	properties	property	NOUN
arestyrurj-238	144	6	are	be	AUX
arestyrurj-238	144	7	non	non	ADJ
arestyrurj-238	144	8	-	-	ADJ
arestyrurj-238	144	9	redundant	redundant	ADJ
arestyrurj-238	144	10	,	,	PUNCT
arestyrurj-238	144	11	and	and	CCONJ
arestyrurj-238	144	12	they	they	PRON
arestyrurj-238	144	13	may	may	AUX
arestyrurj-238	144	14	all	all	ADV
arestyrurj-238	144	15	influence	influence	VERB
arestyrurj-238	144	16	a	a	DET
arestyrurj-238	144	17	peptide	peptide	NOUN
arestyrurj-238	144	18	’s	’s	PART
arestyrurj-238	144	19	effectiveness	effectiveness	NOUN
arestyrurj-238	144	20	.	.	PUNCT
arestyrurj-238	145	1	however	however	ADV
arestyrurj-238	145	2	,	,	PUNCT
arestyrurj-238	145	3	it	it	PRON
arestyrurj-238	145	4	is	be	AUX
arestyrurj-238	145	5	important	important	ADJ
arestyrurj-238	145	6	to	to	PART
arestyrurj-238	145	7	note	note	VERB
arestyrurj-238	145	8	that	that	SCONJ
arestyrurj-238	145	9	there	there	PRON
arestyrurj-238	145	10	exists	exist	VERB
arestyrurj-238	145	11	a	a	DET
arestyrurj-238	145	12	moderate	moderate	ADJ
arestyrurj-238	145	13	,	,	PUNCT
arestyrurj-238	145	14	positive	positive	ADJ
arestyrurj-238	145	15	correlation	correlation	NOUN
arestyrurj-238	145	16	between	between	ADP
arestyrurj-238	145	17	hydrophobic	hydrophobic	NOUN
arestyrurj-238	145	18	proportion	proportion	NOUN
arestyrurj-238	145	19	and	and	CCONJ
arestyrurj-238	145	20	maximum	maximum	ADJ
arestyrurj-238	145	21	average	average	ADJ
arestyrurj-238	145	22	hydrophobic	hydrophobic	NOUN
arestyrurj-238	145	23	residue	residue	NOUN
arestyrurj-238	145	24	.	.	PUNCT
arestyrurj-238	146	1	this	this	PRON
arestyrurj-238	146	2	was	be	AUX
arestyrurj-238	146	3	expected	expect	VERB
arestyrurj-238	146	4	because	because	SCONJ
arestyrurj-238	146	5	both	both	DET
arestyrurj-238	146	6	hydrophobicity	hydrophobicity	NOUN
arestyrurj-238	146	7	-	-	PUNCT
arestyrurj-238	146	8	based	base	VERB
arestyrurj-238	146	9	calculations	calculation	NOUN
arestyrurj-238	146	10	were	be	AUX
arestyrurj-238	146	11	dependent	dependent	ADJ
arestyrurj-238	146	12	on	on	ADP
arestyrurj-238	146	13	fauchere	fauchere	ADJ
arestyrurj-238	146	14	and	and	CCONJ
arestyrurj-238	146	15	pliska	pliska	NOUN
arestyrurj-238	146	16	’s	’s	PART
arestyrurj-238	146	17	scale	scale	NOUN
arestyrurj-238	146	18	.	.	PUNCT
arestyrurj-238	147	1	figure	figure	NOUN
arestyrurj-238	147	2	2	2	NUM
arestyrurj-238	147	3	:	:	PUNCT
arestyrurj-238	147	4	scatterplot	scatterplot	NOUN
arestyrurj-238	147	5	matrix	matrix	NOUN
arestyrurj-238	147	6	.	.	PUNCT
arestyrurj-238	148	1	the	the	DET
arestyrurj-238	148	2	diagonal	diagonal	ADJ
arestyrurj-238	148	3	panels	panel	NOUN
arestyrurj-238	148	4	provide	provide	VERB
arestyrurj-238	148	5	histograms	histogram	NOUN
arestyrurj-238	148	6	for	for	ADP
arestyrurj-238	148	7	each	each	DET
arestyrurj-238	148	8	molecular	molecular	ADJ
arestyrurj-238	148	9	property	property	NOUN
arestyrurj-238	148	10	.	.	PUNCT
arestyrurj-238	149	1	the	the	DET
arestyrurj-238	149	2	panels	panel	NOUN
arestyrurj-238	149	3	below	below	ADP
arestyrurj-238	149	4	the	the	DET
arestyrurj-238	149	5	diagonal	diagonal	ADJ
arestyrurj-238	149	6	depict	depict	NOUN
arestyrurj-238	149	7	bivariate	bivariate	ADJ
arestyrurj-238	149	8	scatter	scatter	NOUN
arestyrurj-238	149	9	plots	plot	NOUN
arestyrurj-238	149	10	,	,	PUNCT
arestyrurj-238	149	11	which	which	PRON
arestyrurj-238	149	12	provide	provide	VERB
arestyrurj-238	149	13	a	a	DET
arestyrurj-238	149	14	visual	visual	ADJ
arestyrurj-238	149	15	representation	representation	NOUN
arestyrurj-238	149	16	of	of	ADP
arestyrurj-238	149	17	the	the	DET
arestyrurj-238	149	18	relationship	relationship	NOUN
arestyrurj-238	149	19	between	between	ADP
arestyrurj-238	149	20	two	two	NUM
arestyrurj-238	149	21	variables	variable	NOUN
arestyrurj-238	149	22	,	,	PUNCT
arestyrurj-238	149	23	allowing	allow	VERB
arestyrurj-238	149	24	for	for	ADP
arestyrurj-238	149	25	pattern	pattern	NOUN
arestyrurj-238	149	26	identification	identification	NOUN
arestyrurj-238	149	27	,	,	PUNCT
arestyrurj-238	149	28	outlier	outlier	NOUN
arestyrurj-238	149	29	detection	detection	NOUN
arestyrurj-238	149	30	,	,	PUNCT
arestyrurj-238	149	31	and	and	CCONJ
arestyrurj-238	149	32	linear	linear	ADJ
arestyrurj-238	149	33	correlation	correlation	NOUN
arestyrurj-238	149	34	assessment	assessment	NOUN
arestyrurj-238	149	35	.	.	PUNCT
arestyrurj-238	150	1	the	the	DET
arestyrurj-238	150	2	panels	panel	NOUN
arestyrurj-238	150	3	above	above	ADP
arestyrurj-238	150	4	the	the	DET
arestyrurj-238	150	5	diagonal	diagonal	ADJ
arestyrurj-238	150	6	report	report	NOUN
arestyrurj-238	150	7	the	the	DET
arestyrurj-238	150	8	pearson	pearson	PROPN
arestyrurj-238	150	9	correlation	correlation	NOUN
arestyrurj-238	150	10	coefficients	coefficient	NOUN
arestyrurj-238	150	11	associated	associate	VERB
arestyrurj-238	150	12	with	with	ADP
arestyrurj-238	150	13	the	the	DET
arestyrurj-238	150	14	regression	regression	NOUN
arestyrurj-238	150	15	line	line	NOUN
arestyrurj-238	150	16	in	in	ADP
arestyrurj-238	150	17	each	each	DET
arestyrurj-238	150	18	scatter	scatter	NOUN
arestyrurj-238	150	19	plot	plot	NOUN
arestyrurj-238	150	20	—	—	PUNCT
arestyrurj-238	150	21	a	a	DET
arestyrurj-238	150	22	value	value	NOUN
arestyrurj-238	150	23	close	close	ADV
arestyrurj-238	150	24	to	to	ADP
arestyrurj-238	150	25	+1	+1	PROPN
arestyrurj-238	150	26	or	or	CCONJ
arestyrurj-238	150	27	-1	-1	ADV
arestyrurj-238	150	28	signifies	signify	VERB
arestyrurj-238	150	29	strong	strong	ADJ
arestyrurj-238	150	30	correlation	correlation	NOUN
arestyrurj-238	150	31	while	while	SCONJ
arestyrurj-238	150	32	a	a	DET
arestyrurj-238	150	33	value	value	NOUN
arestyrurj-238	150	34	close	close	ADV
arestyrurj-238	150	35	to	to	PART
arestyrurj-238	150	36	0	0	NUM
arestyrurj-238	150	37	signifies	signify	VERB
arestyrurj-238	150	38	weak	weak	ADJ
arestyrurj-238	150	39	correlation	correlation	NOUN
arestyrurj-238	150	40	.	.	PUNCT
arestyrurj-238	151	1	aresty	aresty	ADJ
arestyrurj-238	151	2	rutgers	rutgers	PROPN
arestyrurj-238	151	3	undergraduate	undergraduate	PROPN
arestyrurj-238	151	4	research	research	PROPN
arestyrurj-238	151	5	journal	journal	PROPN
arestyrurj-238	151	6	,	,	PUNCT
arestyrurj-238	151	7	volume	volume	NOUN
arestyrurj-238	151	8	i	i	PRON
arestyrurj-238	151	9	,	,	PUNCT
arestyrurj-238	151	10	issue	issue	NOUN
arestyrurj-238	151	11	v	v	ADP
arestyrurj-238	151	12	the	the	DET
arestyrurj-238	151	13	pca	pca	NOUN
arestyrurj-238	151	14	projects	project	NOUN
arestyrurj-238	151	15	information	information	NOUN
arestyrurj-238	151	16	from	from	ADP
arestyrurj-238	151	17	the	the	DET
arestyrurj-238	151	18	seven	seven	NUM
arestyrurj-238	151	19	-	-	PUNCT
arestyrurj-238	151	20	dimensional	dimensional	ADJ
arestyrurj-238	151	21	space	space	NOUN
arestyrurj-238	151	22	onto	onto	ADP
arestyrurj-238	151	23	orthogonal	orthogonal	ADJ
arestyrurj-238	151	24	axes	axis	NOUN
arestyrurj-238	151	25	that	that	PRON
arestyrurj-238	151	26	are	be	AUX
arestyrurj-238	151	27	linear	linear	ADJ
arestyrurj-238	151	28	combinations	combination	NOUN
arestyrurj-238	151	29	and	and	CCONJ
arestyrurj-238	151	30	capture	capture	VERB
arestyrurj-238	151	31	the	the	DET
arestyrurj-238	151	32	variation	variation	NOUN
arestyrurj-238	151	33	of	of	ADP
arestyrurj-238	151	34	the	the	DET
arestyrurj-238	151	35	original	original	ADJ
arestyrurj-238	151	36	variables	variable	NOUN
arestyrurj-238	151	37	.	.	PUNCT
arestyrurj-238	152	1	the	the	DET
arestyrurj-238	152	2	first	first	ADJ
arestyrurj-238	152	3	two	two	NUM
arestyrurj-238	152	4	dimensions	dimension	NOUN
arestyrurj-238	152	5	,	,	PUNCT
arestyrurj-238	152	6	also	also	ADV
arestyrurj-238	152	7	called	call	VERB
arestyrurj-238	152	8	principal	principal	ADJ
arestyrurj-238	152	9	components	component	NOUN
arestyrurj-238	152	10	,	,	PUNCT
arestyrurj-238	152	11	account	account	VERB
arestyrurj-238	152	12	for	for	ADP
arestyrurj-238	152	13	30.1	30.1	NUM
arestyrurj-238	152	14	%	%	NOUN
arestyrurj-238	152	15	and	and	CCONJ
arestyrurj-238	152	16	19.3	19.3	NUM
arestyrurj-238	152	17	%	%	NOUN
arestyrurj-238	152	18	(	(	PUNCT
arestyrurj-238	152	19	figure	figure	NOUN
arestyrurj-238	152	20	3	3	NUM
arestyrurj-238	152	21	)	)	PUNCT
arestyrurj-238	152	22	,	,	PUNCT
arestyrurj-238	152	23	respectively	respectively	ADV
arestyrurj-238	152	24	,	,	PUNCT
arestyrurj-238	152	25	of	of	ADP
arestyrurj-238	152	26	the	the	DET
arestyrurj-238	152	27	total	total	ADJ
arestyrurj-238	152	28	variation	variation	NOUN
arestyrurj-238	152	29	in	in	ADP
arestyrurj-238	152	30	the	the	DET
arestyrurj-238	152	31	dbaasp	dbaasp	NOUN
arestyrurj-238	152	32	subset	subset	NOUN
arestyrurj-238	152	33	.	.	PUNCT
arestyrurj-238	153	1	this	this	PRON
arestyrurj-238	153	2	means	mean	VERB
arestyrurj-238	153	3	that	that	SCONJ
arestyrurj-238	153	4	the	the	DET
arestyrurj-238	153	5	two	two	NUM
arestyrurj-238	153	6	-	-	PUNCT
arestyrurj-238	153	7	dimensional	dimensional	ADJ
arestyrurj-238	153	8	scatter	scatter	NOUN
arestyrurj-238	153	9	plot	plot	NOUN
arestyrurj-238	153	10	,	,	PUNCT
arestyrurj-238	153	11	often	often	ADV
arestyrurj-238	153	12	used	use	VERB
arestyrurj-238	153	13	in	in	ADP
arestyrurj-238	153	14	pca	pca	NOUN
arestyrurj-238	153	15	due	due	ADP
arestyrurj-238	153	16	to	to	ADP
arestyrurj-238	153	17	its	its	PRON
arestyrurj-238	153	18	facility	facility	NOUN
arestyrurj-238	153	19	for	for	ADP
arestyrurj-238	153	20	visual	visual	ADJ
arestyrurj-238	153	21	interpretation	interpretation	NOUN
arestyrurj-238	153	22	,	,	PUNCT
arestyrurj-238	153	23	is	be	AUX
arestyrurj-238	153	24	not	not	PART
arestyrurj-238	153	25	a	a	DET
arestyrurj-238	153	26	faithful	faithful	ADJ
arestyrurj-238	153	27	representation	representation	NOUN
arestyrurj-238	153	28	of	of	ADP
arestyrurj-238	153	29	the	the	DET
arestyrurj-238	153	30	original	original	ADJ
arestyrurj-238	153	31	data	datum	NOUN
arestyrurj-238	153	32	in	in	ADP
arestyrurj-238	153	33	the	the	DET
arestyrurj-238	153	34	seven	seven	NUM
arestyrurj-238	153	35	-	-	PUNCT
arestyrurj-238	153	36	dimensional	dimensional	ADJ
arestyrurj-238	153	37	space	space	NOUN
arestyrurj-238	153	38	,	,	PUNCT
arestyrurj-238	153	39	since	since	SCONJ
arestyrurj-238	153	40	it	it	PRON
arestyrurj-238	153	41	only	only	ADV
arestyrurj-238	153	42	includes	include	VERB
arestyrurj-238	153	43	50	50	NUM
arestyrurj-238	153	44	%	%	NOUN
arestyrurj-238	153	45	of	of	ADP
arestyrurj-238	153	46	the	the	DET
arestyrurj-238	153	47	variation	variation	NOUN
arestyrurj-238	153	48	in	in	ADP
arestyrurj-238	153	49	the	the	DET
arestyrurj-238	153	50	dbaasp	dbaasp	NOUN
arestyrurj-238	153	51	data	datum	NOUN
arestyrurj-238	153	52	set	set	VERB
arestyrurj-238	153	53	.	.	PUNCT
arestyrurj-238	154	1	to	to	PART
arestyrurj-238	154	2	account	account	VERB
arestyrurj-238	154	3	for	for	ADP
arestyrurj-238	154	4	greater	great	ADJ
arestyrurj-238	154	5	variation	variation	NOUN
arestyrurj-238	154	6	,	,	PUNCT
arestyrurj-238	154	7	higher	high	ADJ
arestyrurj-238	154	8	dimensions	dimension	NOUN
arestyrurj-238	154	9	are	be	AUX
arestyrurj-238	154	10	needed	need	VERB
arestyrurj-238	154	11	.	.	PUNCT
arestyrurj-238	155	1	nevertheless	nevertheless	ADV
arestyrurj-238	155	2	,	,	PUNCT
arestyrurj-238	155	3	the	the	DET
arestyrurj-238	155	4	pca	pca	NOUN
arestyrurj-238	155	5	provides	provide	VERB
arestyrurj-238	155	6	insight	insight	NOUN
arestyrurj-238	155	7	into	into	ADP
arestyrurj-238	155	8	how	how	SCONJ
arestyrurj-238	155	9	variation	variation	NOUN
arestyrurj-238	155	10	is	be	AUX
arestyrurj-238	155	11	distributed	distribute	VERB
arestyrurj-238	155	12	among	among	ADP
arestyrurj-238	155	13	the	the	DET
arestyrurj-238	155	14	molecular	molecular	ADJ
arestyrurj-238	155	15	properties	property	NOUN
arestyrurj-238	155	16	.	.	PUNCT
arestyrurj-238	156	1	the	the	DET
arestyrurj-238	156	2	pca	pca	PROPN
arestyrurj-238	156	3	shows	show	VERB
arestyrurj-238	156	4	that	that	SCONJ
arestyrurj-238	156	5	the	the	DET
arestyrurj-238	156	6	greatest	great	ADJ
arestyrurj-238	156	7	contributors	contributor	NOUN
arestyrurj-238	156	8	to	to	ADP
arestyrurj-238	156	9	the	the	DET
arestyrurj-238	156	10	variation	variation	NOUN
arestyrurj-238	156	11	are	be	AUX
arestyrurj-238	156	12	length	length	NOUN
arestyrurj-238	156	13	,	,	PUNCT
arestyrurj-238	156	14	hydrophobic	hydrophobic	NOUN
arestyrurj-238	156	15	proportion	proportion	NOUN
arestyrurj-238	156	16	,	,	PUNCT
arestyrurj-238	156	17	and	and	CCONJ
arestyrurj-238	156	18	maximum	maximum	ADJ
arestyrurj-238	156	19	average	average	ADJ
arestyrurj-238	156	20	hydrophobic	hydrophobic	NOUN
arestyrurj-238	156	21	residue	residue	NOUN
arestyrurj-238	156	22	.	.	PUNCT
arestyrurj-238	157	1	figure	figure	VERB
arestyrurj-238	157	2	3	3	NUM
arestyrurj-238	157	3	:	:	PUNCT
arestyrurj-238	157	4	principal	principal	ADJ
arestyrurj-238	157	5	component	component	NOUN
arestyrurj-238	157	6	analysis	analysis	NOUN
arestyrurj-238	157	7	.	.	PUNCT
arestyrurj-238	158	1	(	(	PUNCT
arestyrurj-238	158	2	a	a	X
arestyrurj-238	158	3	)	)	PUNCT
arestyrurj-238	158	4	plot	plot	NOUN
arestyrurj-238	158	5	of	of	ADP
arestyrurj-238	158	6	molecular	molecular	ADJ
arestyrurj-238	158	7	properties	property	NOUN
arestyrurj-238	158	8	and	and	CCONJ
arestyrurj-238	158	9	their	their	PRON
arestyrurj-238	158	10	respective	respective	ADJ
arestyrurj-238	158	11	contributions	contribution	NOUN
arestyrurj-238	158	12	.	.	PUNCT
arestyrurj-238	159	1	(	(	PUNCT
arestyrurj-238	159	2	b	b	X
arestyrurj-238	159	3	)	)	PUNCT
arestyrurj-238	159	4	biplot	biplot	NOUN
arestyrurj-238	159	5	of	of	ADP
arestyrurj-238	159	6	individual	individual	ADJ
arestyrurj-238	159	7	peptide	peptide	NOUN
arestyrurj-238	159	8	data	datum	NOUN
arestyrurj-238	159	9	points	point	NOUN
arestyrurj-238	159	10	and	and	CCONJ
arestyrurj-238	159	11	their	their	PRON
arestyrurj-238	159	12	molecular	molecular	ADJ
arestyrurj-238	159	13	properties	property	NOUN
arestyrurj-238	159	14	.	.	PUNCT
arestyrurj-238	160	1	figure	figure	VERB
arestyrurj-238	160	2	4	4	NUM
arestyrurj-238	160	3	:	:	PUNCT
arestyrurj-238	160	4	cart	cart	NOUN
arestyrurj-238	160	5	.	.	PUNCT
arestyrurj-238	161	1	for	for	ADP
arestyrurj-238	161	2	both	both	CCONJ
arestyrurj-238	161	3	classification	classification	NOUN
arestyrurj-238	161	4	and	and	CCONJ
arestyrurj-238	161	5	regression	regression	NOUN
arestyrurj-238	161	6	trees	tree	NOUN
arestyrurj-238	161	7	,	,	PUNCT
arestyrurj-238	161	8	each	each	DET
arestyrurj-238	161	9	decision	decision	NOUN
arestyrurj-238	161	10	node	node	NOUN
arestyrurj-238	161	11	is	be	AUX
arestyrurj-238	161	12	associated	associate	VERB
arestyrurj-238	161	13	with	with	ADP
arestyrurj-238	161	14	a	a	DET
arestyrurj-238	161	15	condition	condition	NOUN
arestyrurj-238	161	16	.	.	PUNCT
arestyrurj-238	162	1	if	if	SCONJ
arestyrurj-238	162	2	the	the	DET
arestyrurj-238	162	3	condition	condition	NOUN
arestyrurj-238	162	4	is	be	AUX
arestyrurj-238	162	5	true	true	ADJ
arestyrurj-238	162	6	(	(	PUNCT
arestyrurj-238	162	7	or	or	CCONJ
arestyrurj-238	162	8	yes	yes	INTJ
arestyrurj-238	162	9	)	)	PUNCT
arestyrurj-238	162	10	for	for	ADP
arestyrurj-238	162	11	a	a	DET
arestyrurj-238	162	12	peptide	peptide	NOUN
arestyrurj-238	162	13	,	,	PUNCT
arestyrurj-238	162	14	the	the	DET
arestyrurj-238	162	15	peptide	peptide	NOUN
arestyrurj-238	162	16	will	will	AUX
arestyrurj-238	162	17	be	be	AUX
arestyrurj-238	162	18	sorted	sort	VERB
arestyrurj-238	162	19	down	down	ADP
arestyrurj-238	162	20	the	the	DET
arestyrurj-238	162	21	left	left	ADJ
arestyrurj-238	162	22	branch	branch	NOUN
arestyrurj-238	162	23	and	and	CCONJ
arestyrurj-238	162	24	either	either	CCONJ
arestyrurj-238	162	25	reach	reach	VERB
arestyrurj-238	162	26	a	a	DET
arestyrurj-238	162	27	terminal	terminal	ADJ
arestyrurj-238	162	28	node	node	NOUN
arestyrurj-238	162	29	or	or	CCONJ
arestyrurj-238	162	30	proceed	proceed	VERB
arestyrurj-238	162	31	to	to	ADP
arestyrurj-238	162	32	the	the	DET
arestyrurj-238	162	33	next	next	ADJ
arestyrurj-238	162	34	condition	condition	NOUN
arestyrurj-238	162	35	.	.	PUNCT
arestyrurj-238	163	1	(	(	PUNCT
arestyrurj-238	163	2	a	a	X
arestyrurj-238	163	3	)	)	PUNCT
arestyrurj-238	163	4	classification	classification	NOUN
arestyrurj-238	163	5	tree	tree	NOUN
arestyrurj-238	163	6	built	build	VERB
arestyrurj-238	163	7	for	for	ADP
arestyrurj-238	163	8	an	an	DET
arestyrurj-238	163	9	n	n	NOUN
arestyrurj-238	163	10	=	=	SYM
arestyrurj-238	163	11	4,218	4,218	NUM
arestyrurj-238	163	12	sample	sample	NOUN
arestyrurj-238	163	13	,	,	PUNCT
arestyrurj-238	163	14	where	where	SCONJ
arestyrurj-238	163	15	partitions	partition	NOUN
arestyrurj-238	163	16	are	be	AUX
arestyrurj-238	163	17	based	base	VERB
arestyrurj-238	163	18	on	on	ADP
arestyrurj-238	163	19	mic	mic	ADJ
arestyrurj-238	163	20	=	=	SYM
arestyrurj-238	163	21	4	4	NUM
arestyrurj-238	163	22	µm	µm	NOUN
arestyrurj-238	163	23	threshold	threshold	NOUN
arestyrurj-238	163	24	.	.	PUNCT
arestyrurj-238	164	1	each	each	DET
arestyrurj-238	164	2	box	box	NOUN
arestyrurj-238	164	3	displays	display	VERB
arestyrurj-238	164	4	the	the	DET
arestyrurj-238	164	5	overall	overall	ADJ
arestyrurj-238	164	6	classification	classification	NOUN
arestyrurj-238	164	7	at	at	ADP
arestyrurj-238	164	8	that	that	DET
arestyrurj-238	164	9	node	node	NOUN
arestyrurj-238	164	10	,	,	PUNCT
arestyrurj-238	164	11	and	and	CCONJ
arestyrurj-238	164	12	the	the	DET
arestyrurj-238	164	13	left	left	ADJ
arestyrurj-238	164	14	value	value	NOUN
arestyrurj-238	164	15	represents	represent	VERB
arestyrurj-238	164	16	the	the	DET
arestyrurj-238	164	17	number	number	NOUN
arestyrurj-238	164	18	of	of	ADP
arestyrurj-238	164	19	peptides	peptide	NOUN
arestyrurj-238	164	20	that	that	PRON
arestyrurj-238	164	21	are	be	AUX
arestyrurj-238	164	22	effective	effective	ADJ
arestyrurj-238	164	23	while	while	SCONJ
arestyrurj-238	164	24	the	the	DET
arestyrurj-238	164	25	right	right	ADJ
arestyrurj-238	164	26	value	value	NOUN
arestyrurj-238	164	27	represents	represent	VERB
arestyrurj-238	164	28	the	the	DET
arestyrurj-238	164	29	number	number	NOUN
arestyrurj-238	164	30	of	of	ADP
arestyrurj-238	164	31	peptides	peptide	NOUN
arestyrurj-238	164	32	that	that	PRON
arestyrurj-238	164	33	are	be	AUX
arestyrurj-238	164	34	not	not	PART
arestyrurj-238	164	35	effective	effective	ADJ
arestyrurj-238	164	36	.	.	PUNCT
arestyrurj-238	165	1	(	(	PUNCT
arestyrurj-238	165	2	b	b	X
arestyrurj-238	165	3	)	)	PUNCT
arestyrurj-238	165	4	regression	regression	NOUN
arestyrurj-238	165	5	tree	tree	NOUN
arestyrurj-238	165	6	built	build	VERB
arestyrurj-238	165	7	for	for	ADP
arestyrurj-238	165	8	an	an	DET
arestyrurj-238	165	9	n	n	NOUN
arestyrurj-238	165	10	=	=	SYM
arestyrurj-238	165	11	4,218	4,218	NUM
arestyrurj-238	165	12	sample	sample	NOUN
arestyrurj-238	165	13	,	,	PUNCT
arestyrurj-238	165	14	where	where	SCONJ
arestyrurj-238	165	15	the	the	DET
arestyrurj-238	165	16	response	response	NOUN
arestyrurj-238	165	17	variable	variable	NOUN
arestyrurj-238	165	18	is	be	AUX
arestyrurj-238	165	19	log2(mic	log2(mic	PROPN
arestyrurj-238	165	20	)	)	PUNCT
arestyrurj-238	165	21	.	.	PUNCT
arestyrurj-238	166	1	each	each	DET
arestyrurj-238	166	2	node	node	PROPN
arestyrurj-238	166	3	box	box	PROPN
arestyrurj-238	166	4	displays	display	VERB
arestyrurj-238	166	5	the	the	DET
arestyrurj-238	166	6	predicted	predict	VERB
arestyrurj-238	166	7	log2(mic	log2(mic	PROPN
arestyrurj-238	166	8	)	)	PUNCT
arestyrurj-238	166	9	value	value	NOUN
arestyrurj-238	166	10	and	and	CCONJ
arestyrurj-238	167	1	the	the	DET
arestyrurj-238	167	2	n	n	ADJ
arestyrurj-238	167	3	number	number	NOUN
arestyrurj-238	167	4	of	of	ADP
arestyrurj-238	167	5	peptides	peptide	NOUN
arestyrurj-238	167	6	that	that	PRON
arestyrurj-238	167	7	contributed	contribute	VERB
arestyrurj-238	167	8	to	to	ADP
arestyrurj-238	167	9	that	that	DET
arestyrurj-238	167	10	predicted	predict	VERB
arestyrurj-238	167	11	value	value	NOUN
arestyrurj-238	167	12	.	.	PUNCT
arestyrurj-238	168	1	relationship	relationship	NOUN
arestyrurj-238	168	2	between	between	ADP
arestyrurj-238	168	3	molecular	molecular	ADJ
arestyrurj-238	168	4	properties	property	NOUN
arestyrurj-238	168	5	and	and	CCONJ
arestyrurj-238	168	6	peptide	peptide	ADJ
arestyrurj-238	168	7	effectiveness	effectiveness	NOUN
arestyrurj-238	168	8	the	the	DET
arestyrurj-238	168	9	conditions	condition	NOUN
arestyrurj-238	168	10	used	use	VERB
arestyrurj-238	168	11	in	in	ADP
arestyrurj-238	168	12	the	the	DET
arestyrurj-238	168	13	classification	classification	NOUN
arestyrurj-238	168	14	tree	tree	NOUN
arestyrurj-238	168	15	to	to	PART
arestyrurj-238	168	16	split	split	VERB
arestyrurj-238	168	17	the	the	DET
arestyrurj-238	168	18	dbaasp	dbaasp	NOUN
arestyrurj-238	168	19	subset	subset	NOUN
arestyrurj-238	168	20	indicate	indicate	VERB
arestyrurj-238	168	21	that	that	SCONJ
arestyrurj-238	168	22	all	all	DET
arestyrurj-238	168	23	the	the	DET
arestyrurj-238	168	24	molecular	molecular	ADJ
arestyrurj-238	168	25	properties	property	NOUN
arestyrurj-238	168	26	,	,	PUNCT
arestyrurj-238	168	27	except	except	SCONJ
arestyrurj-238	168	28	for	for	ADP
arestyrurj-238	168	29	cation	cation	NOUN
arestyrurj-238	168	30	-	-	PUNCT
arestyrurj-238	168	31	pi	pi	NOUN
arestyrurj-238	168	32	interactions	interaction	NOUN
arestyrurj-238	168	33	,	,	PUNCT
arestyrurj-238	168	34	are	be	AUX
arestyrurj-238	168	35	important	important	ADJ
arestyrurj-238	168	36	in	in	ADP
arestyrurj-238	168	37	partitioning	partition	VERB
arestyrurj-238	168	38	the	the	DET
arestyrurj-238	168	39	data	datum	NOUN
arestyrurj-238	168	40	.	.	PUNCT
arestyrurj-238	169	1	for	for	ADP
arestyrurj-238	169	2	classification	classification	NOUN
arestyrurj-238	169	3	purposes	purpose	NOUN
arestyrurj-238	169	4	,	,	PUNCT
arestyrurj-238	169	5	we	we	PRON
arestyrurj-238	169	6	defined	define	VERB
arestyrurj-238	169	7	a	a	DET
arestyrurj-238	169	8	peptide	peptide	NOUN
arestyrurj-238	169	9	as	as	ADP
arestyrurj-238	169	10	effective	effective	ADJ
arestyrurj-238	169	11	if	if	SCONJ
arestyrurj-238	169	12	aresty	aresty	ADJ
arestyrurj-238	169	13	rutgers	rutgers	PROPN
arestyrurj-238	169	14	undergraduate	undergraduate	PROPN
arestyrurj-238	169	15	research	research	PROPN
arestyrurj-238	169	16	journal	journal	PROPN
arestyrurj-238	169	17	,	,	PUNCT
arestyrurj-238	169	18	volume	volume	NOUN
arestyrurj-238	169	19	i	i	PRON
arestyrurj-238	169	20	,	,	PUNCT
arestyrurj-238	169	21	issue	issue	NOUN
arestyrurj-238	169	22	v	v	ADP
arestyrurj-238	169	23	its	its	PRON
arestyrurj-238	169	24	mic	mic	ADJ
arestyrurj-238	169	25	value	value	NOUN
arestyrurj-238	169	26	for	for	ADP
arestyrurj-238	169	27	p.	p.	PROPN
arestyrurj-238	169	28	aeruginosa	aeruginosa	PROPN
arestyrurj-238	169	29	is	be	AUX
arestyrurj-238	169	30	less	less	ADJ
arestyrurj-238	169	31	than	than	ADP
arestyrurj-238	169	32	4	4	NUM
arestyrurj-238	169	33	µm	µm	NOUN
arestyrurj-238	169	34	.	.	PUNCT
arestyrurj-238	170	1	based	base	VERB
arestyrurj-238	170	2	on	on	ADP
arestyrurj-238	170	3	the	the	DET
arestyrurj-238	170	4	classification	classification	NOUN
arestyrurj-238	170	5	tree	tree	NOUN
arestyrurj-238	170	6	that	that	PRON
arestyrurj-238	170	7	we	we	PRON
arestyrurj-238	170	8	generated	generate	VERB
arestyrurj-238	170	9	,	,	PUNCT
arestyrurj-238	170	10	it	it	PRON
arestyrurj-238	170	11	appears	appear	VERB
arestyrurj-238	170	12	that	that	SCONJ
arestyrurj-238	170	13	the	the	DET
arestyrurj-238	170	14	lowest	low	ADJ
arestyrurj-238	170	15	ratio	ratio	NOUN
arestyrurj-238	170	16	of	of	ADP
arestyrurj-238	170	17	noneffective	noneffective	ADJ
arestyrurj-238	170	18	to	to	ADP
arestyrurj-238	170	19	effective	effective	ADJ
arestyrurj-238	170	20	peptides	peptide	NOUN
arestyrurj-238	170	21	(	(	PUNCT
arestyrurj-238	170	22	69	69	NUM
arestyrurj-238	170	23	to	to	PART
arestyrurj-238	170	24	139	139	NUM
arestyrurj-238	170	25	)	)	PUNCT
arestyrurj-238	170	26	is	be	AUX
arestyrurj-238	170	27	associated	associate	VERB
arestyrurj-238	170	28	with	with	ADP
arestyrurj-238	170	29	a	a	DET
arestyrurj-238	170	30	group	group	NOUN
arestyrurj-238	170	31	of	of	ADP
arestyrurj-238	170	32	peptides	peptide	NOUN
arestyrurj-238	170	33	that	that	PRON
arestyrurj-238	170	34	satisfies	satisfy	VERB
arestyrurj-238	170	35	the	the	DET
arestyrurj-238	170	36	following	follow	VERB
arestyrurj-238	170	37	conditions	condition	NOUN
arestyrurj-238	170	38	:	:	PUNCT
arestyrurj-238	170	39	net	net	ADJ
arestyrurj-238	170	40	charge	charge	NOUN
arestyrurj-238	170	41	≥	≥	NUM
arestyrurj-238	170	42	4.5	4.5	NUM
arestyrurj-238	170	43	,	,	PUNCT
arestyrurj-238	170	44	maximum	maximum	ADJ
arestyrurj-238	170	45	average	average	ADJ
arestyrurj-238	170	46	hydrophobic	hydrophobic	NOUN
arestyrurj-238	170	47	moment	moment	NOUN
arestyrurj-238	170	48	≥	≥	NOUN
arestyrurj-238	170	49	0.6981	0.6981	NUM
arestyrurj-238	170	50	,	,	PUNCT
arestyrurj-238	170	51	and	and	CCONJ
arestyrurj-238	170	52	length	length	NOUN
arestyrurj-238	170	53	≥	≥	NOUN
arestyrurj-238	170	54	29.5	29.5	NUM
arestyrurj-238	170	55	amino	amino	NOUN
arestyrurj-238	170	56	acids	acid	NOUN
arestyrurj-238	170	57	(	(	PUNCT
arestyrurj-238	170	58	figure	figure	NOUN
arestyrurj-238	170	59	4a	4a	NUM
arestyrurj-238	170	60	)	)	PUNCT
arestyrurj-238	170	61	.	.	PUNCT
arestyrurj-238	171	1	regarding	regard	VERB
arestyrurj-238	171	2	the	the	DET
arestyrurj-238	171	3	regression	regression	NOUN
arestyrurj-238	171	4	tree	tree	NOUN
arestyrurj-238	171	5	that	that	PRON
arestyrurj-238	171	6	we	we	PRON
arestyrurj-238	171	7	generated	generate	VERB
arestyrurj-238	171	8	,	,	PUNCT
arestyrurj-238	171	9	the	the	DET
arestyrurj-238	171	10	subgroup	subgroup	NOUN
arestyrurj-238	171	11	of	of	ADP
arestyrurj-238	171	12	peptides	peptide	NOUN
arestyrurj-238	171	13	with	with	ADP
arestyrurj-238	171	14	the	the	DET
arestyrurj-238	171	15	lowest	low	ADJ
arestyrurj-238	171	16	average	average	ADJ
arestyrurj-238	171	17	log2(mic	log2(mic	PROPN
arestyrurj-238	171	18	)	)	PUNCT
arestyrurj-238	171	19	is	be	AUX
arestyrurj-238	171	20	composed	compose	VERB
arestyrurj-238	171	21	of	of	ADP
arestyrurj-238	171	22	208	208	NUM
arestyrurj-238	171	23	peptides	peptide	NOUN
arestyrurj-238	171	24	and	and	CCONJ
arestyrurj-238	171	25	satisfies	satisfy	VERB
arestyrurj-238	171	26	the	the	DET
arestyrurj-238	171	27	following	follow	VERB
arestyrurj-238	171	28	conditions	condition	NOUN
arestyrurj-238	171	29	:	:	PUNCT
arestyrurj-238	171	30	net	net	ADJ
arestyrurj-238	171	31	charge	charge	NOUN
arestyrurj-238	171	32	≥	≥	NUM
arestyrurj-238	171	33	4.5	4.5	NUM
arestyrurj-238	171	34	,	,	PUNCT
arestyrurj-238	171	35	maximum	maximum	ADJ
arestyrurj-238	171	36	average	average	ADJ
arestyrurj-238	171	37	hydrophobic	hydrophobic	NOUN
arestyrurj-238	171	38	moment	moment	NOUN
arestyrurj-238	171	39	≥	≥	NOUN
arestyrurj-238	171	40	0.6977	0.6977	NUM
arestyrurj-238	171	41	,	,	PUNCT
arestyrurj-238	171	42	and	and	CCONJ
arestyrurj-238	171	43	length	length	NOUN
arestyrurj-238	171	44	≥	≥	NOUN
arestyrurj-238	171	45	29.5	29.5	NUM
arestyrurj-238	171	46	amino	amino	NOUN
arestyrurj-238	171	47	acids	acid	NOUN
arestyrurj-238	171	48	(	(	PUNCT
arestyrurj-238	171	49	figure	figure	NOUN
arestyrurj-238	171	50	4b	4b	PROPN
arestyrurj-238	171	51	)	)	PUNCT
arestyrurj-238	171	52	.	.	PUNCT
arestyrurj-238	172	1	these	these	DET
arestyrurj-238	172	2	conditions	condition	NOUN
arestyrurj-238	172	3	are	be	AUX
arestyrurj-238	172	4	similar	similar	ADJ
arestyrurj-238	172	5	to	to	ADP
arestyrurj-238	172	6	those	those	PRON
arestyrurj-238	172	7	described	describe	VERB
arestyrurj-238	172	8	for	for	ADP
arestyrurj-238	172	9	the	the	DET
arestyrurj-238	172	10	classification	classification	NOUN
arestyrurj-238	172	11	tree	tree	NOUN
arestyrurj-238	172	12	,	,	PUNCT
arestyrurj-238	172	13	suggesting	suggest	VERB
arestyrurj-238	172	14	that	that	SCONJ
arestyrurj-238	172	15	the	the	DET
arestyrurj-238	172	16	information	information	NOUN
arestyrurj-238	172	17	provided	provide	VERB
arestyrurj-238	172	18	by	by	ADP
arestyrurj-238	172	19	the	the	DET
arestyrurj-238	172	20	two	two	NUM
arestyrurj-238	172	21	trees	tree	NOUN
arestyrurj-238	172	22	agree	agree	VERB
arestyrurj-238	172	23	.	.	PUNCT
arestyrurj-238	173	1	using	use	VERB
arestyrurj-238	173	2	these	these	DET
arestyrurj-238	173	3	conditions	condition	NOUN
arestyrurj-238	173	4	,	,	PUNCT
arestyrurj-238	173	5	we	we	PRON
arestyrurj-238	173	6	can	can	AUX
arestyrurj-238	173	7	make	make	VERB
arestyrurj-238	173	8	predictions	prediction	NOUN
arestyrurj-238	173	9	for	for	ADP
arestyrurj-238	173	10	new	new	ADJ
arestyrurj-238	173	11	peptide	peptide	NOUN
arestyrurj-238	173	12	sequences	sequence	NOUN
arestyrurj-238	173	13	that	that	PRON
arestyrurj-238	173	14	were	be	AUX
arestyrurj-238	173	15	not	not	PART
arestyrurj-238	173	16	included	include	VERB
arestyrurj-238	173	17	in	in	ADP
arestyrurj-238	173	18	the	the	DET
arestyrurj-238	173	19	dbaasp	dbaasp	NOUN
arestyrurj-238	173	20	subset	subset	NOUN
arestyrurj-238	173	21	.	.	PUNCT
arestyrurj-238	174	1	while	while	SCONJ
arestyrurj-238	174	2	the	the	DET
arestyrurj-238	174	3	decision	decision	NOUN
arestyrurj-238	174	4	trees	tree	NOUN
arestyrurj-238	174	5	provide	provide	VERB
arestyrurj-238	174	6	simple	simple	ADJ
arestyrurj-238	174	7	visualizations	visualization	NOUN
arestyrurj-238	174	8	and	and	CCONJ
arestyrurj-238	174	9	predictive	predictive	ADJ
arestyrurj-238	174	10	methods	method	NOUN
arestyrurj-238	174	11	,	,	PUNCT
arestyrurj-238	174	12	the	the	DET
arestyrurj-238	174	13	predictions	prediction	NOUN
arestyrurj-238	174	14	are	be	AUX
arestyrurj-238	174	15	not	not	PART
arestyrurj-238	174	16	always	always	ADV
arestyrurj-238	174	17	accurate	accurate	ADJ
arestyrurj-238	174	18	.	.	PUNCT
arestyrurj-238	175	1	by	by	ADP
arestyrurj-238	175	2	using	use	VERB
arestyrurj-238	175	3	multiple	multiple	ADJ
arestyrurj-238	175	4	trees	tree	NOUN
arestyrurj-238	175	5	,	,	PUNCT
arestyrurj-238	175	6	random	random	ADJ
arestyrurj-238	175	7	forests	forest	NOUN
arestyrurj-238	175	8	produce	produce	VERB
arestyrurj-238	175	9	more	more	ADV
arestyrurj-238	175	10	accurate	accurate	ADJ
arestyrurj-238	175	11	predictions	prediction	NOUN
arestyrurj-238	175	12	and	and	CCONJ
arestyrurj-238	175	13	provide	provide	VERB
arestyrurj-238	175	14	more	more	ADV
arestyrurj-238	175	15	reliable	reliable	ADJ
arestyrurj-238	175	16	information	information	NOUN
arestyrurj-238	175	17	of	of	ADP
arestyrurj-238	175	18	variable	variable	ADJ
arestyrurj-238	175	19	importance	importance	NOUN
arestyrurj-238	175	20	.	.	PUNCT
arestyrurj-238	176	1	the	the	DET
arestyrurj-238	176	2	feature	feature	NOUN
arestyrurj-238	176	3	importance	importance	NOUN
arestyrurj-238	176	4	attribute	attribute	NOUN
arestyrurj-238	176	5	of	of	ADP
arestyrurj-238	176	6	the	the	DET
arestyrurj-238	176	7	random	random	ADJ
arestyrurj-238	176	8	forest	forest	NOUN
arestyrurj-238	176	9	regression	regression	NOUN
arestyrurj-238	176	10	model	model	NOUN
arestyrurj-238	176	11	indicates	indicate	VERB
arestyrurj-238	176	12	that	that	SCONJ
arestyrurj-238	176	13	net	net	ADJ
arestyrurj-238	176	14	charge	charge	NOUN
arestyrurj-238	176	15	and	and	CCONJ
arestyrurj-238	176	16	the	the	DET
arestyrurj-238	176	17	maximum	maximum	ADJ
arestyrurj-238	176	18	average	average	ADJ
arestyrurj-238	176	19	hydrophobic	hydrophobic	NOUN
arestyrurj-238	176	20	moment	moment	NOUN
arestyrurj-238	176	21	are	be	AUX
arestyrurj-238	176	22	the	the	DET
arestyrurj-238	176	23	most	most	ADV
arestyrurj-238	176	24	distinctive	distinctive	ADJ
arestyrurj-238	176	25	biophysical	biophysical	ADJ
arestyrurj-238	176	26	properties	property	NOUN
arestyrurj-238	176	27	influencing	influence	VERB
arestyrurj-238	176	28	peptide	peptide	NOUN
arestyrurj-238	176	29	effectiveness	effectiveness	NOUN
arestyrurj-238	176	30	(	(	PUNCT
arestyrurj-238	176	31	figure	figure	NOUN
arestyrurj-238	176	32	5	5	NUM
arestyrurj-238	176	33	)	)	PUNCT
arestyrurj-238	176	34	.	.	PUNCT
arestyrurj-238	177	1	the	the	DET
arestyrurj-238	177	2	feature	feature	NOUN
arestyrurj-238	177	3	importance	importance	NOUN
arestyrurj-238	177	4	attribute	attribute	NOUN
arestyrurj-238	177	5	also	also	ADV
arestyrurj-238	177	6	confirms	confirm	VERB
arestyrurj-238	177	7	that	that	SCONJ
arestyrurj-238	177	8	the	the	DET
arestyrurj-238	177	9	presence	presence	NOUN
arestyrurj-238	177	10	of	of	ADP
arestyrurj-238	177	11	cation	cation	NOUN
arestyrurj-238	177	12	-	-	PUNCT
arestyrurj-238	177	13	pi	pi	NOUN
arestyrurj-238	177	14	interactions	interaction	NOUN
arestyrurj-238	177	15	contributes	contribute	VERB
arestyrurj-238	177	16	marginally	marginally	ADV
arestyrurj-238	177	17	to	to	ADP
arestyrurj-238	177	18	the	the	DET
arestyrurj-238	177	19	fit	fit	NOUN
arestyrurj-238	177	20	of	of	ADP
arestyrurj-238	177	21	the	the	DET
arestyrurj-238	177	22	regression	regression	NOUN
arestyrurj-238	177	23	model	model	NOUN
arestyrurj-238	177	24	.	.	PUNCT
arestyrurj-238	178	1	the	the	DET
arestyrurj-238	178	2	other	other	ADJ
arestyrurj-238	178	3	four	four	NUM
arestyrurj-238	178	4	properties	property	NOUN
arestyrurj-238	178	5	were	be	AUX
arestyrurj-238	178	6	of	of	ADP
arestyrurj-238	178	7	similar	similar	ADJ
arestyrurj-238	178	8	importance	importance	NOUN
arestyrurj-238	178	9	.	.	PUNCT
arestyrurj-238	179	1	overall	overall	ADV
arestyrurj-238	179	2	,	,	PUNCT
arestyrurj-238	179	3	the	the	DET
arestyrurj-238	179	4	random	random	ADJ
arestyrurj-238	179	5	forest	forest	NOUN
arestyrurj-238	179	6	regression	regression	NOUN
arestyrurj-238	179	7	model	model	NOUN
arestyrurj-238	179	8	had	have	VERB
arestyrurj-238	179	9	a	a	DET
arestyrurj-238	179	10	mean	mean	NOUN
arestyrurj-238	179	11	of	of	ADP
arestyrurj-238	179	12	squared	square	VERB
arestyrurj-238	179	13	residuals	residual	NOUN
arestyrurj-238	179	14	of	of	ADP
arestyrurj-238	179	15	4.409	4.409	NUM
arestyrurj-238	179	16	,	,	PUNCT
arestyrurj-238	179	17	which	which	PRON
arestyrurj-238	179	18	suggests	suggest	VERB
arestyrurj-238	179	19	that	that	SCONJ
arestyrurj-238	179	20	the	the	DET
arestyrurj-238	179	21	model	model	NOUN
arestyrurj-238	179	22	is	be	AUX
arestyrurj-238	179	23	incorrect	incorrect	ADJ
arestyrurj-238	179	24	by	by	ADP
arestyrurj-238	179	25	2.1	2.1	NUM
arestyrurj-238	179	26	log2(mic	log2(mic	NUM
arestyrurj-238	179	27	)	)	PUNCT
arestyrurj-238	179	28	units	unit	NOUN
arestyrurj-238	179	29	on	on	ADP
arestyrurj-238	179	30	average	average	ADJ
arestyrurj-238	179	31	,	,	PUNCT
arestyrurj-238	179	32	and	and	CCONJ
arestyrurj-238	179	33	the	the	DET
arestyrurj-238	179	34	%	%	NOUN
arestyrurj-238	179	35	variance	variance	NOUN
arestyrurj-238	179	36	explained	explain	VERB
arestyrurj-238	179	37	by	by	ADP
arestyrurj-238	179	38	the	the	DET
arestyrurj-238	179	39	model	model	NOUN
arestyrurj-238	179	40	is	be	AUX
arestyrurj-238	179	41	37.83	37.83	NUM
arestyrurj-238	179	42	%	%	NOUN
arestyrurj-238	179	43	.	.	PUNCT
arestyrurj-238	180	1	while	while	SCONJ
arestyrurj-238	180	2	the	the	DET
arestyrurj-238	180	3	fit	fit	NOUN
arestyrurj-238	180	4	of	of	ADP
arestyrurj-238	180	5	the	the	DET
arestyrurj-238	180	6	model	model	NOUN
arestyrurj-238	180	7	is	be	AUX
arestyrurj-238	180	8	lacking	lack	VERB
arestyrurj-238	180	9	,	,	PUNCT
arestyrurj-238	180	10	the	the	DET
arestyrurj-238	180	11	regression	regression	NOUN
arestyrurj-238	180	12	model	model	NOUN
arestyrurj-238	180	13	is	be	AUX
arestyrurj-238	180	14	still	still	ADV
arestyrurj-238	180	15	worth	worth	ADJ
arestyrurj-238	180	16	exploring	explore	VERB
arestyrurj-238	180	17	,	,	PUNCT
arestyrurj-238	180	18	as	as	SCONJ
arestyrurj-238	180	19	our	our	PRON
arestyrurj-238	180	20	goal	goal	NOUN
arestyrurj-238	180	21	is	be	AUX
arestyrurj-238	180	22	not	not	PART
arestyrurj-238	180	23	to	to	PART
arestyrurj-238	180	24	be	be	AUX
arestyrurj-238	180	25	able	able	ADJ
arestyrurj-238	180	26	to	to	PART
arestyrurj-238	180	27	predict	predict	VERB
arestyrurj-238	180	28	exact	exact	ADJ
arestyrurj-238	180	29	mics	mic	NOUN
arestyrurj-238	180	30	,	,	PUNCT
arestyrurj-238	180	31	but	but	CCONJ
arestyrurj-238	180	32	to	to	PART
arestyrurj-238	180	33	develop	develop	VERB
arestyrurj-238	180	34	a	a	DET
arestyrurj-238	180	35	selection	selection	NOUN
arestyrurj-238	180	36	method	method	NOUN
arestyrurj-238	180	37	for	for	ADP
arestyrurj-238	180	38	identifying	identify	VERB
arestyrurj-238	180	39	effective	effective	ADJ
arestyrurj-238	180	40	peptides	peptide	NOUN
arestyrurj-238	180	41	based	base	VERB
arestyrurj-238	180	42	on	on	ADP
arestyrurj-238	180	43	their	their	PRON
arestyrurj-238	180	44	biophysical	biophysical	ADJ
arestyrurj-238	180	45	properties	property	NOUN
arestyrurj-238	180	46	.	.	PUNCT
arestyrurj-238	181	1	figure	figure	VERB
arestyrurj-238	181	2	5	5	NUM
arestyrurj-238	181	3	:	:	PUNCT
arestyrurj-238	181	4	the	the	DET
arestyrurj-238	181	5	importance	importance	NOUN
arestyrurj-238	181	6	of	of	ADP
arestyrurj-238	181	7	a	a	DET
arestyrurj-238	181	8	biophysical	biophysical	ADJ
arestyrurj-238	181	9	property	property	NOUN
arestyrurj-238	181	10	is	be	AUX
arestyrurj-238	181	11	determined	determine	VERB
arestyrurj-238	181	12	by	by	ADP
arestyrurj-238	181	13	measuring	measure	VERB
arestyrurj-238	181	14	the	the	DET
arestyrurj-238	181	15	increase	increase	NOUN
arestyrurj-238	181	16	in	in	ADP
arestyrurj-238	181	17	mean	mean	ADJ
arestyrurj-238	181	18	square	square	ADJ
arestyrurj-238	181	19	error	error	NOUN
arestyrurj-238	181	20	and	and	CCONJ
arestyrurj-238	181	21	the	the	DET
arestyrurj-238	181	22	increase	increase	NOUN
arestyrurj-238	181	23	in	in	ADP
arestyrurj-238	181	24	node	node	ADJ
arestyrurj-238	181	25	purity	purity	NOUN
arestyrurj-238	181	26	when	when	SCONJ
arestyrurj-238	181	27	that	that	DET
arestyrurj-238	181	28	property	property	NOUN
arestyrurj-238	181	29	is	be	AUX
arestyrurj-238	181	30	randomly	randomly	ADV
arestyrurj-238	181	31	permuted	permute	VERB
arestyrurj-238	181	32	.	.	PUNCT
arestyrurj-238	182	1	important	important	ADJ
arestyrurj-238	182	2	properties	property	NOUN
arestyrurj-238	182	3	result	result	VERB
arestyrurj-238	182	4	in	in	ADP
arestyrurj-238	182	5	substantial	substantial	ADJ
arestyrurj-238	182	6	changes	change	NOUN
arestyrurj-238	182	7	when	when	SCONJ
arestyrurj-238	182	8	randomly	randomly	ADV
arestyrurj-238	182	9	permuted	permute	VERB
arestyrurj-238	182	10	,	,	PUNCT
arestyrurj-238	182	11	leading	lead	VERB
arestyrurj-238	182	12	to	to	ADP
arestyrurj-238	182	13	greater	great	ADJ
arestyrurj-238	182	14	increases	increase	NOUN
arestyrurj-238	182	15	in	in	ADP
arestyrurj-238	182	16	mean	mean	ADJ
arestyrurj-238	182	17	square	square	ADJ
arestyrurj-238	182	18	error	error	NOUN
arestyrurj-238	182	19	and	and	CCONJ
arestyrurj-238	182	20	node	node	ADJ
arestyrurj-238	182	21	purity	purity	NOUN
arestyrurj-238	182	22	.	.	PUNCT
arestyrurj-238	183	1	aresty	aresty	PROPN
arestyrurj-238	183	2	rutgers	rutgers	PROPN
arestyrurj-238	183	3	undergraduate	undergraduate	PROPN
arestyrurj-238	183	4	research	research	PROPN
arestyrurj-238	183	5	journal	journal	PROPN
arestyrurj-238	183	6	,	,	PUNCT
arestyrurj-238	183	7	volume	volume	NOUN
arestyrurj-238	183	8	i	i	PRON
arestyrurj-238	183	9	,	,	PUNCT
arestyrurj-238	183	10	issue	issue	VERB
arestyrurj-238	183	11	v	v	NUM
arestyrurj-238	183	12	5	5	NUM
arestyrurj-238	183	13	conclusion	conclusion	NOUN
arestyrurj-238	183	14	amps	amp	NOUN
arestyrurj-238	183	15	serve	serve	VERB
arestyrurj-238	183	16	as	as	ADP
arestyrurj-238	183	17	a	a	DET
arestyrurj-238	183	18	rich	rich	ADJ
arestyrurj-238	183	19	source	source	NOUN
arestyrurj-238	183	20	of	of	ADP
arestyrurj-238	183	21	alternatives	alternative	NOUN
arestyrurj-238	183	22	to	to	ADP
arestyrurj-238	183	23	conventional	conventional	ADJ
arestyrurj-238	183	24	antibiotics	antibiotic	NOUN
arestyrurj-238	183	25	and	and	CCONJ
arestyrurj-238	183	26	provide	provide	VERB
arestyrurj-238	183	27	a	a	DET
arestyrurj-238	183	28	potential	potential	ADJ
arestyrurj-238	183	29	solution	solution	NOUN
arestyrurj-238	183	30	for	for	ADP
arestyrurj-238	183	31	the	the	DET
arestyrurj-238	183	32	antibiotic	antibiotic	ADJ
arestyrurj-238	183	33	resistance	resistance	NOUN
arestyrurj-238	183	34	crisis	crisis	NOUN
arestyrurj-238	183	35	.	.	PUNCT
arestyrurj-238	184	1	existing	exist	VERB
arestyrurj-238	184	2	amp	amp	NOUN
arestyrurj-238	184	3	databases	database	NOUN
arestyrurj-238	184	4	are	be	AUX
arestyrurj-238	184	5	continuously	continuously	ADV
arestyrurj-238	184	6	being	be	AUX
arestyrurj-238	184	7	updated	update	VERB
arestyrurj-238	184	8	to	to	PART
arestyrurj-238	184	9	account	account	VERB
arestyrurj-238	184	10	for	for	ADP
arestyrurj-238	184	11	the	the	DET
arestyrurj-238	184	12	expanding	expand	VERB
arestyrurj-238	184	13	knowledge	knowledge	NOUN
arestyrurj-238	184	14	known	know	VERB
arestyrurj-238	184	15	about	about	ADP
arestyrurj-238	184	16	them	they	PRON
arestyrurj-238	184	17	.	.	PUNCT
arestyrurj-238	185	1	however	however	ADV
arestyrurj-238	185	2	,	,	PUNCT
arestyrurj-238	185	3	a	a	DET
arestyrurj-238	185	4	comprehensive	comprehensive	ADJ
arestyrurj-238	185	5	understanding	understanding	NOUN
arestyrurj-238	185	6	of	of	ADP
arestyrurj-238	185	7	the	the	DET
arestyrurj-238	185	8	relationship	relationship	NOUN
arestyrurj-238	185	9	between	between	ADP
arestyrurj-238	185	10	molecular	molecular	ADJ
arestyrurj-238	185	11	properties	property	NOUN
arestyrurj-238	185	12	of	of	ADP
arestyrurj-238	185	13	amps	amp	NOUN
arestyrurj-238	185	14	and	and	CCONJ
arestyrurj-238	185	15	their	their	PRON
arestyrurj-238	185	16	effectiveness	effectiveness	NOUN
arestyrurj-238	185	17	against	against	ADP
arestyrurj-238	185	18	bacterial	bacterial	ADJ
arestyrurj-238	185	19	infections	infection	NOUN
arestyrurj-238	185	20	,	,	PUNCT
arestyrurj-238	185	21	especially	especially	ADV
arestyrurj-238	185	22	from	from	ADP
arestyrurj-238	185	23	a	a	DET
arestyrurj-238	185	24	clinical	clinical	ADJ
arestyrurj-238	185	25	perspective	perspective	NOUN
arestyrurj-238	185	26	,	,	PUNCT
arestyrurj-238	185	27	remains	remain	VERB
arestyrurj-238	185	28	elusive	elusive	ADJ
arestyrurj-238	185	29	.	.	PUNCT
arestyrurj-238	186	1	to	to	PART
arestyrurj-238	186	2	develop	develop	VERB
arestyrurj-238	186	3	this	this	DET
arestyrurj-238	186	4	comprehension	comprehension	NOUN
arestyrurj-238	186	5	and	and	CCONJ
arestyrurj-238	186	6	to	to	PART
arestyrurj-238	186	7	accelerate	accelerate	VERB
arestyrurj-238	186	8	the	the	DET
arestyrurj-238	186	9	process	process	NOUN
arestyrurj-238	186	10	for	for	ADP
arestyrurj-238	186	11	screening	screen	VERB
arestyrurj-238	186	12	peptides	peptide	NOUN
arestyrurj-238	186	13	,	,	PUNCT
arestyrurj-238	186	14	this	this	DET
arestyrurj-238	186	15	study	study	NOUN
arestyrurj-238	186	16	aimed	aim	VERB
arestyrurj-238	186	17	to	to	PART
arestyrurj-238	186	18	create	create	VERB
arestyrurj-238	186	19	a	a	DET
arestyrurj-238	186	20	biophysical	biophysical	ADJ
arestyrurj-238	186	21	understanding	understanding	NOUN
arestyrurj-238	186	22	and	and	CCONJ
arestyrurj-238	186	23	predictive	predictive	ADJ
arestyrurj-238	186	24	model	model	NOUN
arestyrurj-238	186	25	for	for	ADP
arestyrurj-238	186	26	classifying	classify	VERB
arestyrurj-238	186	27	peptides	peptide	NOUN
arestyrurj-238	186	28	as	as	ADP
arestyrurj-238	186	29	effective	effective	ADJ
arestyrurj-238	186	30	or	or	CCONJ
arestyrurj-238	186	31	noneffective	noneffective	ADJ
arestyrurj-238	186	32	.	.	PUNCT
arestyrurj-238	187	1	to	to	PART
arestyrurj-238	187	2	do	do	VERB
arestyrurj-238	187	3	so	so	ADV
arestyrurj-238	187	4	,	,	PUNCT
arestyrurj-238	187	5	we	we	PRON
arestyrurj-238	187	6	used	use	VERB
arestyrurj-238	187	7	a	a	DET
arestyrurj-238	187	8	relevant	relevant	ADJ
arestyrurj-238	187	9	subset	subset	NOUN
arestyrurj-238	187	10	of	of	ADP
arestyrurj-238	187	11	4,218	4,218	NUM
arestyrurj-238	187	12	amps	amp	NOUN
arestyrurj-238	187	13	from	from	ADP
arestyrurj-238	187	14	the	the	DET
arestyrurj-238	187	15	dbaasp	dbaasp	NOUN
arestyrurj-238	187	16	.	.	PUNCT
arestyrurj-238	188	1	to	to	PART
arestyrurj-238	188	2	ensure	ensure	VERB
arestyrurj-238	188	3	that	that	SCONJ
arestyrurj-238	188	4	the	the	DET
arestyrurj-238	188	5	selected	select	VERB
arestyrurj-238	188	6	molecular	molecular	ADJ
arestyrurj-238	188	7	properties	property	NOUN
arestyrurj-238	188	8	are	be	AUX
arestyrurj-238	188	9	not	not	PART
arestyrurj-238	188	10	correlated	correlate	VERB
arestyrurj-238	188	11	with	with	ADP
arestyrurj-238	188	12	each	each	DET
arestyrurj-238	188	13	other	other	ADJ
arestyrurj-238	188	14	and	and	CCONJ
arestyrurj-238	188	15	thus	thus	ADV
arestyrurj-238	188	16	all	all	PRON
arestyrurj-238	188	17	contribute	contribute	VERB
arestyrurj-238	188	18	separately	separately	ADV
arestyrurj-238	188	19	to	to	ADP
arestyrurj-238	188	20	peptide	peptide	NOUN
arestyrurj-238	188	21	effectiveness	effectiveness	NOUN
arestyrurj-238	188	22	,	,	PUNCT
arestyrurj-238	188	23	we	we	PRON
arestyrurj-238	188	24	constructed	construct	VERB
arestyrurj-238	188	25	a	a	DET
arestyrurj-238	188	26	scatterplot	scatterplot	NOUN
arestyrurj-238	188	27	matrix	matrix	NOUN
arestyrurj-238	188	28	.	.	PUNCT
arestyrurj-238	189	1	it	it	PRON
arestyrurj-238	189	2	is	be	AUX
arestyrurj-238	189	3	apparent	apparent	ADJ
arestyrurj-238	189	4	that	that	SCONJ
arestyrurj-238	189	5	none	none	NOUN
arestyrurj-238	189	6	of	of	ADP
arestyrurj-238	189	7	the	the	DET
arestyrurj-238	189	8	properties	property	NOUN
arestyrurj-238	189	9	are	be	AUX
arestyrurj-238	189	10	strongly	strongly	ADV
arestyrurj-238	189	11	linearly	linearly	ADV
arestyrurj-238	189	12	correlated	correlate	VERB
arestyrurj-238	189	13	with	with	ADP
arestyrurj-238	189	14	each	each	DET
arestyrurj-238	189	15	other	other	ADJ
arestyrurj-238	189	16	.	.	PUNCT
arestyrurj-238	190	1	this	this	PRON
arestyrurj-238	190	2	was	be	AUX
arestyrurj-238	190	3	unexpected	unexpected	ADJ
arestyrurj-238	190	4	,	,	PUNCT
arestyrurj-238	190	5	considering	consider	VERB
arestyrurj-238	190	6	that	that	SCONJ
arestyrurj-238	190	7	three	three	NUM
arestyrurj-238	190	8	of	of	ADP
arestyrurj-238	190	9	the	the	DET
arestyrurj-238	190	10	seven	seven	NUM
arestyrurj-238	190	11	selected	select	VERB
arestyrurj-238	190	12	properties	property	NOUN
arestyrurj-238	190	13	were	be	AUX
arestyrurj-238	190	14	related	relate	VERB
arestyrurj-238	190	15	to	to	ADP
arestyrurj-238	190	16	the	the	DET
arestyrurj-238	190	17	hydrophobicity	hydrophobicity	NOUN
arestyrurj-238	190	18	of	of	ADP
arestyrurj-238	190	19	the	the	DET
arestyrurj-238	190	20	peptide	peptide	NOUN
arestyrurj-238	190	21	.	.	PUNCT
arestyrurj-238	191	1	at	at	ADP
arestyrurj-238	191	2	the	the	DET
arestyrurj-238	191	3	same	same	ADJ
arestyrurj-238	191	4	time	time	NOUN
arestyrurj-238	191	5	,	,	PUNCT
arestyrurj-238	191	6	this	this	PRON
arestyrurj-238	191	7	was	be	AUX
arestyrurj-238	191	8	promising	promising	ADJ
arestyrurj-238	191	9	because	because	SCONJ
arestyrurj-238	191	10	it	it	PRON
arestyrurj-238	191	11	indicates	indicate	VERB
arestyrurj-238	191	12	that	that	SCONJ
arestyrurj-238	191	13	multicollinearity	multicollinearity	NOUN
arestyrurj-238	191	14	was	be	AUX
arestyrurj-238	191	15	not	not	PART
arestyrurj-238	191	16	present	present	ADJ
arestyrurj-238	191	17	in	in	ADP
arestyrurj-238	191	18	our	our	PRON
arestyrurj-238	191	19	model	model	NOUN
arestyrurj-238	191	20	,	,	PUNCT
arestyrurj-238	191	21	and	and	CCONJ
arestyrurj-238	191	22	thus	thus	ADV
arestyrurj-238	191	23	each	each	DET
arestyrurj-238	191	24	property	property	NOUN
arestyrurj-238	191	25	individually	individually	ADV
arestyrurj-238	191	26	contributes	contribute	VERB
arestyrurj-238	191	27	to	to	ADP
arestyrurj-238	191	28	peptide	peptide	ADJ
arestyrurj-238	191	29	effectiveness	effectiveness	NOUN
arestyrurj-238	191	30	.	.	PUNCT
arestyrurj-238	192	1	to	to	PART
arestyrurj-238	192	2	further	far	ADV
arestyrurj-238	192	3	examine	examine	VERB
arestyrurj-238	192	4	the	the	DET
arestyrurj-238	192	5	contributions	contribution	NOUN
arestyrurj-238	192	6	of	of	ADP
arestyrurj-238	192	7	each	each	DET
arestyrurj-238	192	8	molecular	molecular	ADJ
arestyrurj-238	192	9	property	property	NOUN
arestyrurj-238	192	10	to	to	ADP
arestyrurj-238	192	11	the	the	DET
arestyrurj-238	192	12	total	total	ADJ
arestyrurj-238	192	13	variation	variation	NOUN
arestyrurj-238	192	14	within	within	ADP
arestyrurj-238	192	15	the	the	DET
arestyrurj-238	192	16	dbaasp	dbaasp	NOUN
arestyrurj-238	192	17	,	,	PUNCT
arestyrurj-238	192	18	we	we	PRON
arestyrurj-238	192	19	performed	perform	VERB
arestyrurj-238	192	20	a	a	DET
arestyrurj-238	192	21	pca	pca	PROPN
arestyrurj-238	192	22	.	.	PROPN
arestyrurj-238	192	23	length	length	NOUN
arestyrurj-238	192	24	,	,	PUNCT
arestyrurj-238	192	25	hydrophobic	hydrophobic	NOUN
arestyrurj-238	192	26	proportion	proportion	NOUN
arestyrurj-238	192	27	,	,	PUNCT
arestyrurj-238	192	28	and	and	CCONJ
arestyrurj-238	192	29	maximum	maximum	ADJ
arestyrurj-238	192	30	average	average	ADJ
arestyrurj-238	192	31	hydrophobic	hydrophobic	NOUN
arestyrurj-238	192	32	residue	residue	NOUN
arestyrurj-238	192	33	had	have	VERB
arestyrurj-238	192	34	the	the	DET
arestyrurj-238	192	35	greatest	great	ADJ
arestyrurj-238	192	36	amount	amount	NOUN
arestyrurj-238	192	37	of	of	ADP
arestyrurj-238	192	38	information	information	NOUN
arestyrurj-238	192	39	captured	capture	VERB
arestyrurj-238	192	40	in	in	ADP
arestyrurj-238	192	41	the	the	DET
arestyrurj-238	192	42	first	first	ADJ
arestyrurj-238	192	43	two	two	NUM
arestyrurj-238	192	44	dimensions	dimension	NOUN
arestyrurj-238	192	45	.	.	PUNCT
arestyrurj-238	193	1	we	we	PRON
arestyrurj-238	193	2	used	use	VERB
arestyrurj-238	193	3	cart	cart	NOUN
arestyrurj-238	193	4	to	to	PART
arestyrurj-238	193	5	gain	gain	VERB
arestyrurj-238	193	6	insight	insight	NOUN
arestyrurj-238	193	7	into	into	ADP
arestyrurj-238	193	8	which	which	PRON
arestyrurj-238	193	9	biophysical	biophysical	ADJ
arestyrurj-238	193	10	properties	property	NOUN
arestyrurj-238	193	11	were	be	AUX
arestyrurj-238	193	12	most	most	ADV
arestyrurj-238	193	13	important	important	ADJ
arestyrurj-238	193	14	for	for	ADP
arestyrurj-238	193	15	deciding	decide	VERB
arestyrurj-238	193	16	peptide	peptide	ADJ
arestyrurj-238	193	17	effectiveness	effectiveness	NOUN
arestyrurj-238	193	18	.	.	PUNCT
arestyrurj-238	194	1	both	both	CCONJ
arestyrurj-238	194	2	the	the	DET
arestyrurj-238	194	3	classification	classification	NOUN
arestyrurj-238	194	4	tree	tree	NOUN
arestyrurj-238	194	5	and	and	CCONJ
arestyrurj-238	194	6	regression	regression	NOUN
arestyrurj-238	194	7	tree	tree	NOUN
arestyrurj-238	194	8	reached	reach	VERB
arestyrurj-238	194	9	a	a	DET
arestyrurj-238	194	10	consensus	consensus	NOUN
arestyrurj-238	194	11	that	that	SCONJ
arestyrurj-238	194	12	peptides	peptide	NOUN
arestyrurj-238	194	13	with	with	ADP
arestyrurj-238	194	14	the	the	DET
arestyrurj-238	194	15	highest	high	ADJ
arestyrurj-238	194	16	potential	potential	NOUN
arestyrurj-238	194	17	to	to	PART
arestyrurj-238	194	18	become	become	VERB
arestyrurj-238	194	19	efficacious	efficacious	ADJ
arestyrurj-238	194	20	drugs	drug	NOUN
arestyrurj-238	194	21	have	have	VERB
arestyrurj-238	194	22	a	a	DET
arestyrurj-238	194	23	maximum	maximum	ADJ
arestyrurj-238	194	24	average	average	ADJ
arestyrurj-238	194	25	hydrophobic	hydrophobic	NOUN
arestyrurj-238	194	26	moment	moment	NOUN
arestyrurj-238	194	27	≥	≥	NOUN
arestyrurj-238	194	28	0.75	0.75	NUM
arestyrurj-238	194	29	and	and	CCONJ
arestyrurj-238	194	30	have	have	VERB
arestyrurj-238	194	31	a	a	DET
arestyrurj-238	194	32	net	net	ADJ
arestyrurj-238	194	33	charge	charge	NOUN
arestyrurj-238	194	34	≥	≥	NOUN
arestyrurj-238	194	35	4	4	NUM
arestyrurj-238	194	36	.	.	PUNCT
arestyrurj-238	195	1	the	the	DET
arestyrurj-238	195	2	finding	finding	NOUN
arestyrurj-238	195	3	about	about	ADP
arestyrurj-238	195	4	net	net	ADJ
arestyrurj-238	195	5	charge	charge	NOUN
arestyrurj-238	195	6	is	be	AUX
arestyrurj-238	195	7	not	not	PART
arestyrurj-238	195	8	surprising	surprising	ADJ
arestyrurj-238	195	9	and	and	CCONJ
arestyrurj-238	195	10	is	be	AUX
arestyrurj-238	195	11	consistent	consistent	ADJ
arestyrurj-238	195	12	with	with	ADP
arestyrurj-238	195	13	available	available	ADJ
arestyrurj-238	195	14	literature	literature	NOUN
arestyrurj-238	195	15	(	(	PUNCT
arestyrurj-238	195	16	jiang	jiang	PROPN
arestyrurj-238	195	17	et	et	PROPN
arestyrurj-238	195	18	al	al	PROPN
arestyrurj-238	195	19	.	.	PROPN
arestyrurj-238	195	20	,	,	PUNCT
arestyrurj-238	195	21	2008	2008	NUM
arestyrurj-238	195	22	)	)	PUNCT
arestyrurj-238	195	23	.	.	PUNCT
arestyrurj-238	196	1	a	a	DET
arestyrurj-238	196	2	predictive	predictive	ADJ
arestyrurj-238	196	3	regression	regression	NOUN
arestyrurj-238	196	4	model	model	NOUN
arestyrurj-238	196	5	using	use	VERB
arestyrurj-238	196	6	the	the	DET
arestyrurj-238	196	7	random	random	ADJ
arestyrurj-238	196	8	forest	forest	NOUN
arestyrurj-238	196	9	algorithm	algorithm	NOUN
arestyrurj-238	196	10	was	be	AUX
arestyrurj-238	196	11	generated	generate	VERB
arestyrurj-238	196	12	to	to	PART
arestyrurj-238	196	13	assess	assess	VERB
arestyrurj-238	196	14	the	the	DET
arestyrurj-238	196	15	potential	potential	ADJ
arestyrurj-238	196	16	antimicrobial	antimicrobial	ADJ
arestyrurj-238	196	17	activity	activity	NOUN
arestyrurj-238	196	18	of	of	ADP
arestyrurj-238	196	19	a	a	DET
arestyrurj-238	196	20	given	give	VERB
arestyrurj-238	196	21	peptide	peptide	ADJ
arestyrurj-238	196	22	sequence	sequence	NOUN
arestyrurj-238	196	23	.	.	PUNCT
arestyrurj-238	197	1	this	this	DET
arestyrurj-238	197	2	predictive	predictive	ADJ
arestyrurj-238	197	3	tool	tool	NOUN
arestyrurj-238	197	4	was	be	AUX
arestyrurj-238	197	5	used	use	VERB
arestyrurj-238	197	6	to	to	PART
arestyrurj-238	197	7	evaluate	evaluate	VERB
arestyrurj-238	197	8	a	a	DET
arestyrurj-238	197	9	set	set	NOUN
arestyrurj-238	197	10	of	of	ADP
arestyrurj-238	197	11	50,000	50,000	NUM
arestyrurj-238	197	12	computer	computer	NOUN
arestyrurj-238	197	13	generated	generate	VERB
arestyrurj-238	197	14	peptide	peptide	ADJ
arestyrurj-238	197	15	sequences	sequence	NOUN
arestyrurj-238	197	16	.	.	PUNCT
arestyrurj-238	198	1	based	base	VERB
arestyrurj-238	198	2	on	on	ADP
arestyrurj-238	198	3	the	the	DET
arestyrurj-238	198	4	predicted	predict	VERB
arestyrurj-238	198	5	antimicrobial	antimicrobial	ADJ
arestyrurj-238	198	6	and	and	CCONJ
arestyrurj-238	198	7	hemolytic	hemolytic	ADJ
arestyrurj-238	198	8	activities	activity	NOUN
arestyrurj-238	198	9	of	of	ADP
arestyrurj-238	198	10	those	those	DET
arestyrurj-238	198	11	peptide	peptide	ADJ
arestyrurj-238	198	12	sequences	sequence	NOUN
arestyrurj-238	198	13	,	,	PUNCT
arestyrurj-238	198	14	we	we	PRON
arestyrurj-238	198	15	identified	identify	VERB
arestyrurj-238	198	16	a	a	DET
arestyrurj-238	198	17	set	set	NOUN
arestyrurj-238	198	18	of	of	ADP
arestyrurj-238	198	19	eight	eight	NUM
arestyrurj-238	198	20	peptides	peptide	NOUN
arestyrurj-238	198	21	that	that	PRON
arestyrurj-238	198	22	may	may	AUX
arestyrurj-238	198	23	have	have	VERB
arestyrurj-238	198	24	activity	activity	NOUN
arestyrurj-238	198	25	against	against	ADP
arestyrurj-238	198	26	p.	p.	NOUN
arestyrurj-238	198	27	aeruginosa	aeruginosa	PROPN
arestyrurj-238	198	28	lung	lung	NOUN
arestyrurj-238	198	29	infections	infection	NOUN
arestyrurj-238	198	30	.	.	PUNCT
arestyrurj-238	199	1	in	in	ADP
arestyrurj-238	199	2	the	the	DET
arestyrurj-238	199	3	future	future	NOUN
arestyrurj-238	199	4	,	,	PUNCT
arestyrurj-238	199	5	we	we	PRON
arestyrurj-238	199	6	wish	wish	VERB
arestyrurj-238	199	7	to	to	PART
arestyrurj-238	199	8	assess	assess	VERB
arestyrurj-238	199	9	the	the	DET
arestyrurj-238	199	10	accuracy	accuracy	NOUN
arestyrurj-238	199	11	of	of	ADP
arestyrurj-238	199	12	the	the	DET
arestyrurj-238	199	13	random	random	ADJ
arestyrurj-238	199	14	forest	forest	NOUN
arestyrurj-238	199	15	predictive	predictive	ADJ
arestyrurj-238	199	16	tool	tool	NOUN
arestyrurj-238	199	17	,	,	PUNCT
arestyrurj-238	199	18	and	and	CCONJ
arestyrurj-238	199	19	we	we	PRON
arestyrurj-238	199	20	hope	hope	VERB
arestyrurj-238	199	21	to	to	PART
arestyrurj-238	199	22	confirm	confirm	VERB
arestyrurj-238	199	23	the	the	DET
arestyrurj-238	199	24	activity	activity	NOUN
arestyrurj-238	199	25	of	of	ADP
arestyrurj-238	199	26	those	those	DET
arestyrurj-238	199	27	8	8	NUM
arestyrurj-238	199	28	peptides	peptide	NOUN
arestyrurj-238	199	29	experimentally	experimentally	ADV
arestyrurj-238	199	30	by	by	ADP
arestyrurj-238	199	31	conducting	conduct	VERB
arestyrurj-238	199	32	mic	mic	ADJ
arestyrurj-238	199	33	assays	assay	NOUN
arestyrurj-238	199	34	.	.	PUNCT
arestyrurj-238	200	1	furthermore	furthermore	ADV
arestyrurj-238	200	2	,	,	PUNCT
arestyrurj-238	200	3	we	we	PRON
arestyrurj-238	200	4	wish	wish	VERB
arestyrurj-238	200	5	to	to	PART
arestyrurj-238	200	6	expand	expand	VERB
arestyrurj-238	200	7	upon	upon	SCONJ
arestyrurj-238	200	8	our	our	PRON
arestyrurj-238	200	9	understanding	understanding	NOUN
arestyrurj-238	200	10	of	of	ADP
arestyrurj-238	200	11	amps	amp	NOUN
arestyrurj-238	200	12	by	by	ADP
arestyrurj-238	200	13	exploring	explore	VERB
arestyrurj-238	200	14	other	other	ADJ
arestyrurj-238	200	15	methods	method	NOUN
arestyrurj-238	200	16	,	,	PUNCT
arestyrurj-238	200	17	including	include	VERB
arestyrurj-238	200	18	non	non	ADJ
arestyrurj-238	200	19	-	-	ADJ
arestyrurj-238	200	20	linear	linear	ADJ
arestyrurj-238	200	21	dimensionality	dimensionality	NOUN
arestyrurj-238	200	22	reduction	reduction	NOUN
arestyrurj-238	200	23	,	,	PUNCT
arestyrurj-238	200	24	pca	pca	NOUN
arestyrurj-238	200	25	regression	regression	NOUN
arestyrurj-238	200	26	,	,	PUNCT
arestyrurj-238	200	27	and	and	CCONJ
arestyrurj-238	200	28	implementing	implement	VERB
arestyrurj-238	200	29	a	a	DET
arestyrurj-238	200	30	more	more	ADV
arestyrurj-238	200	31	formal	formal	ADJ
arestyrurj-238	200	32	search	search	NOUN
arestyrurj-238	200	33	for	for	ADP
arestyrurj-238	200	34	designing	design	VERB
arestyrurj-238	200	35	peptides	peptide	NOUN
arestyrurj-238	200	36	through	through	ADP
arestyrurj-238	200	37	following	follow	VERB
arestyrurj-238	200	38	a	a	DET
arestyrurj-238	200	39	genetic	genetic	ADJ
arestyrurj-238	200	40	algorithm	algorithm	NOUN
arestyrurj-238	200	41	framework∎	framework∎	NOUN
arestyrurj-238	200	42	6	6	NUM
arestyrurj-238	200	43	acknowledgements	acknowledgement	NOUN
arestyrurj-238	200	44	this	this	DET
arestyrurj-238	200	45	work	work	NOUN
arestyrurj-238	200	46	is	be	AUX
arestyrurj-238	200	47	supported	support	VERB
arestyrurj-238	200	48	by	by	ADP
arestyrurj-238	200	49	grant	grant	NOUN
arestyrurj-238	200	50	#	#	SYM
arestyrurj-238	200	51	r21ai151746	r21ai151746	NOUN
arestyrurj-238	200	52	from	from	ADP
arestyrurj-238	200	53	the	the	DET
arestyrurj-238	200	54	national	national	PROPN
arestyrurj-238	200	55	institutes	institutes	PROPN
arestyrurj-238	200	56	of	of	ADP
arestyrurj-238	200	57	health	health	NOUN
arestyrurj-238	200	58	.	.	PUNCT
arestyrurj-238	201	1	7	7	NUM
arestyrurj-238	201	2	references	reference	NOUN
arestyrurj-238	201	3	[	[	X
arestyrurj-238	201	4	1	1	NUM
arestyrurj-238	201	5	]	]	PUNCT
arestyrurj-238	201	6	ageitos	ageito	NOUN
arestyrurj-238	201	7	,	,	PUNCT
arestyrurj-238	201	8	j.	j.	PROPN
arestyrurj-238	201	9	m.	m.	PROPN
arestyrurj-238	201	10	,	,	PUNCT
arestyrurj-238	201	11	sánchez	sánchez	NOUN
arestyrurj-238	201	12	-	-	PUNCT
arestyrurj-238	201	13	pérez	pérez	NOUN
arestyrurj-238	201	14	,	,	PUNCT
arestyrurj-238	201	15	a.	a.	NOUN
arestyrurj-238	201	16	,	,	PUNCT
arestyrurj-238	201	17	calo	calo	PROPN
arestyrurj-238	201	18	-	-	PUNCT
arestyrurj-238	201	19	mata	mata	PROPN
arestyrurj-238	201	20	,	,	PUNCT
arestyrurj-238	201	21	p.	p.	PROPN
arestyrurj-238	201	22	,	,	PUNCT
arestyrurj-238	201	23	&	&	CCONJ
arestyrurj-238	201	24	villa	villa	PROPN
arestyrurj-238	201	25	,	,	PUNCT
arestyrurj-238	201	26	t.	t.	PROPN
arestyrurj-238	201	27	g.	g.	PROPN
arestyrurj-238	201	28	(	(	PUNCT
arestyrurj-238	201	29	2017	2017	NUM
arestyrurj-238	201	30	)	)	PUNCT
arestyrurj-238	201	31	.	.	PUNCT
arestyrurj-238	202	1	antimicrobial	antimicrobial	ADJ
arestyrurj-238	202	2	peptides	peptide	NOUN
arestyrurj-238	202	3	(	(	PUNCT
arestyrurj-238	202	4	amps	amp	NOUN
arestyrurj-238	202	5	):	):	PUNCT
arestyrurj-238	202	6	ancient	ancient	ADJ
arestyrurj-238	202	7	compounds	compound	NOUN
arestyrurj-238	202	8	that	that	PRON
arestyrurj-238	202	9	represent	represent	VERB
arestyrurj-238	202	10	novel	novel	ADJ
arestyrurj-238	202	11	weapons	weapon	NOUN
arestyrurj-238	202	12	in	in	ADP
arestyrurj-238	202	13	the	the	DET
arestyrurj-238	202	14	fight	fight	NOUN
arestyrurj-238	202	15	against	against	ADP
arestyrurj-238	202	16	bacteria	bacteria	NOUN
arestyrurj-238	202	17	.	.	PUNCT
arestyrurj-238	203	1	biochemical	biochemical	ADJ
arestyrurj-238	203	2	pharmacology	pharmacology	NOUN
arestyrurj-238	203	3	,	,	PUNCT
arestyrurj-238	203	4	133	133	NUM
arestyrurj-238	203	5	,	,	PUNCT
arestyrurj-238	203	6	117–138	117–138	NUM
arestyrurj-238	203	7	.	.	PUNCT
arestyrurj-238	204	1	https://doi.org/10.1016/j.bcp.2016.09.018	https://doi.org/10.1016/j.bcp.2016.09.018	NOUN
arestyrurj-238	205	1	[	[	X
arestyrurj-238	205	2	2	2	NUM
arestyrurj-238	205	3	]	]	X
arestyrurj-238	205	4	allen	allen	PROPN
arestyrurj-238	205	5	,	,	PUNCT
arestyrurj-238	205	6	p.	p.	NOUN
arestyrurj-238	205	7	,	,	PUNCT
arestyrurj-238	205	8	borick	borick	NOUN
arestyrurj-238	205	9	,	,	PUNCT
arestyrurj-238	205	10	j.	j.	PROPN
arestyrurj-238	205	11	,	,	PUNCT
arestyrurj-238	205	12	&	&	CCONJ
arestyrurj-238	205	13	borick	borick	PROPN
arestyrurj-238	205	14	,	,	PUNCT
arestyrurj-238	205	15	j.	j.	PROPN
arestyrurj-238	205	16	(	(	PUNCT
arestyrurj-238	205	17	2020	2020	NUM
arestyrurj-238	205	18	)	)	PUNCT
arestyrurj-238	205	19	.	.	PUNCT
arestyrurj-238	206	1	acute	acute	ADJ
arestyrurj-238	206	2	and	and	CCONJ
arestyrurj-238	206	3	chronic	chronic	ADJ
arestyrurj-238	206	4	infection	infection	NOUN
arestyrurj-238	206	5	management	management	NOUN
arestyrurj-238	206	6	in	in	ADP
arestyrurj-238	206	7	cf	cf	NOUN
arestyrurj-238	206	8	.	.	PUNCT
arestyrurj-238	207	1	cystic	cystic	ADJ
arestyrurj-238	207	2	fibrosis	fibrosis	NOUN
arestyrurj-238	207	3	in	in	ADP
arestyrurj-238	207	4	primary	primary	ADJ
arestyrurj-238	207	5	care	care	NOUN
arestyrurj-238	207	6	,	,	PUNCT
arestyrurj-238	207	7	69–87	69–87	NUM
arestyrurj-238	207	8	.	.	PUNCT
arestyrurj-238	208	1	https://doi.org/10.1007/978-3-030-25909-9_8	https://doi.org/10.1007/978-3-030-25909-9_8	NOUN
arestyrurj-238	209	1	[	[	X
arestyrurj-238	209	2	3	3	NUM
arestyrurj-238	209	3	]	]	PUNCT
arestyrurj-238	209	4	breiman	breiman	NOUN
arestyrurj-238	209	5	,	,	PUNCT
arestyrurj-238	209	6	l.	l.	PROPN
arestyrurj-238	209	7	(	(	PUNCT
arestyrurj-238	209	8	2001	2001	NUM
arestyrurj-238	209	9	)	)	PUNCT
arestyrurj-238	209	10	.	.	PUNCT
arestyrurj-238	210	1	random	random	ADJ
arestyrurj-238	210	2	forests	forest	NOUN
arestyrurj-238	210	3	.	.	PUNCT
arestyrurj-238	211	1	machine	machine	NOUN
arestyrurj-238	211	2	learning	learn	VERB
arestyrurj-238	211	3	45	45	NUM
arestyrurj-238	211	4	,	,	PUNCT
arestyrurj-238	211	5	5–32	5–32	NOUN
arestyrurj-238	211	6	.	.	PUNCT
arestyrurj-238	212	1	https://doi.org/10.1023/a:1010933404324	https://doi.org/10.1023/a:1010933404324	ADJ
arestyrurj-238	212	2	[	[	X
arestyrurj-238	212	3	4	4	NUM
arestyrurj-238	212	4	]	]	ADJ
arestyrurj-238	212	5	centers	center	NOUN
arestyrurj-238	212	6	for	for	ADP
arestyrurj-238	212	7	disease	disease	NOUN
arestyrurj-238	212	8	control	control	NOUN
arestyrurj-238	212	9	and	and	CCONJ
arestyrurj-238	212	10	prevention	prevention	NOUN
arestyrurj-238	212	11	.	.	PUNCT
arestyrurj-238	213	1	(	(	PUNCT
arestyrurj-238	213	2	2019	2019	NUM
arestyrurj-238	213	3	)	)	PUNCT
arestyrurj-238	213	4	.	.	PUNCT
arestyrurj-238	214	1	antibiotic	antibiotic	ADJ
arestyrurj-238	214	2	resistant	resistant	ADJ
arestyrurj-238	214	3	threats	threat	NOUN
arestyrurj-238	214	4	in	in	ADP
arestyrurj-238	214	5	the	the	DET
arestyrurj-238	214	6	united	united	PROPN
arestyrurj-238	214	7	states	states	PROPN
arestyrurj-238	214	8	.	.	PUNCT
arestyrurj-238	215	1	u.s	u.s	PROPN
arestyrurj-238	215	2	.	.	PROPN
arestyrurj-238	215	3	department	department	PROPN
arestyrurj-238	215	4	of	of	ADP
arestyrurj-238	215	5	health	health	PROPN
arestyrurj-238	215	6	and	and	CCONJ
arestyrurj-238	215	7	human	human	ADJ
arestyrurj-238	215	8	services	service	NOUN
arestyrurj-238	215	9	.	.	PUNCT
arestyrurj-238	216	1	https://www.cdc.gov/drugresistance/pdf/threats-report/2019-ar-threats-report-508.pdf	https://www.cdc.gov/drugresistance/pdf/threats-report/2019-ar-threats-report-508.pdf	PROPN
arestyrurj-238	217	1	[	[	X
arestyrurj-238	217	2	5	5	NUM
arestyrurj-238	217	3	]	]	X
arestyrurj-238	217	4	chen	chen	PROPN
arestyrurj-238	217	5	,	,	PUNCT
arestyrurj-238	217	6	c.h	c.h	PROPN
arestyrurj-238	217	7	.	.	PROPN
arestyrurj-238	217	8	;	;	PUNCT
arestyrurj-238	217	9	lu	lu	PROPN
arestyrurj-238	217	10	,	,	PUNCT
arestyrurj-238	217	11	t.k	t.k	PROPN
arestyrurj-238	217	12	.	.	PROPN
arestyrurj-238	217	13	(	(	PUNCT
arestyrurj-238	217	14	2020	2020	NUM
arestyrurj-238	217	15	)	)	PUNCT
arestyrurj-238	217	16	.	.	PUNCT
arestyrurj-238	217	17	development	development	NOUN
arestyrurj-238	217	18	and	and	CCONJ
arestyrurj-238	217	19	challenges	challenge	NOUN
arestyrurj-238	217	20	of	of	ADP
arestyrurj-238	217	21	antimicrobial	antimicrobial	ADJ
arestyrurj-238	217	22	peptides	peptide	NOUN
arestyrurj-238	217	23	for	for	ADP
arestyrurj-238	217	24	therapeutic	therapeutic	ADJ
arestyrurj-238	217	25	applications	application	NOUN
arestyrurj-238	217	26	.	.	PUNCT
arestyrurj-238	218	1	antibiotics	antibiotic	NOUN
arestyrurj-238	218	2	,	,	PUNCT
arestyrurj-238	218	3	9	9	NUM
arestyrurj-238	218	4	,	,	PUNCT
arestyrurj-238	218	5	24	24	NUM
arestyrurj-238	218	6	.	.	PUNCT
arestyrurj-238	219	1	[	[	X
arestyrurj-238	219	2	6	6	NUM
arestyrurj-238	219	3	]	]	PUNCT
arestyrurj-238	219	4	edwards	edwards	PROPN
arestyrurj-238	219	5	,	,	PUNCT
arestyrurj-238	219	6	i.	i.	PROPN
arestyrurj-238	219	7	a.	a.	PROPN
arestyrurj-238	219	8	,	,	PUNCT
arestyrurj-238	219	9	elliott	elliott	PROPN
arestyrurj-238	219	10	,	,	PUNCT
arestyrurj-238	219	11	a.	a.	PROPN
arestyrurj-238	219	12	g.	g.	PROPN
arestyrurj-238	219	13	,	,	PUNCT
arestyrurj-238	219	14	kavanagh	kavanagh	PROPN
arestyrurj-238	219	15	,	,	PUNCT
arestyrurj-238	219	16	a.	a.	NOUN
arestyrurj-238	219	17	m.	m.	NOUN
arestyrurj-238	219	18	,	,	PUNCT
arestyrurj-238	219	19	zuegg	zuegg	PROPN
arestyrurj-238	219	20	,	,	PUNCT
arestyrurj-238	219	21	j.	j.	PROPN
arestyrurj-238	219	22	,	,	PUNCT
arestyrurj-238	219	23	blaskovich	blaskovich	PROPN
arestyrurj-238	219	24	,	,	PUNCT
arestyrurj-238	219	25	m.	m.	NOUN
arestyrurj-238	219	26	a.	a.	PROPN
arestyrurj-238	219	27	,	,	PUNCT
arestyrurj-238	219	28	&	&	CCONJ
arestyrurj-238	219	29	cooper	cooper	PROPN
arestyrurj-238	219	30	,	,	PUNCT
arestyrurj-238	219	31	m.	m.	NOUN
arestyrurj-238	219	32	a.	a.	PROPN
arestyrurj-238	219	33	(	(	PUNCT
arestyrurj-238	219	34	2016	2016	NUM
arestyrurj-238	219	35	)	)	PUNCT
arestyrurj-238	219	36	.	.	PUNCT
arestyrurj-238	220	1	contribution	contribution	NOUN
arestyrurj-238	220	2	of	of	ADP
arestyrurj-238	220	3	amphipathicity	amphipathicity	NOUN
arestyrurj-238	220	4	and	and	CCONJ
arestyrurj-238	220	5	hydrophobicity	hydrophobicity	NOUN
arestyrurj-238	220	6	to	to	ADP
arestyrurj-238	220	7	the	the	DET
arestyrurj-238	220	8	https://doi.org/10.1016/j.bcp.2016.09.018	https://doi.org/10.1016/j.bcp.2016.09.018	NOUN
arestyrurj-238	220	9	https://doi.org/10.1007/978-3-030-25909-9_8	https://doi.org/10.1007/978-3-030-25909-9_8	VERB
arestyrurj-238	220	10	https://doi.org/10.1023/a:1010933404324	https://doi.org/10.1023/a:1010933404324	PROPN
arestyrurj-238	220	11	https://www.cdc.gov/drugresistance/pdf/threats-report/2019-ar-threats-report-508.pdf	https://www.cdc.gov/drugresistance/pdf/threats-report/2019-ar-threats-report-508.pdf	PROPN
arestyrurj-238	220	12	https://www.cdc.gov/drugresistance/pdf/threats-report/2019-ar-threats-report-508.pdf	https://www.cdc.gov/drugresistance/pdf/threats-report/2019-ar-threats-report-508.pdf	PROPN
arestyrurj-238	220	13	aresty	aresty	ADJ
arestyrurj-238	220	14	rutgers	rutgers	PROPN
arestyrurj-238	220	15	undergraduate	undergraduate	PROPN
arestyrurj-238	220	16	research	research	PROPN
arestyrurj-238	220	17	journal	journal	PROPN
arestyrurj-238	220	18	,	,	PUNCT
arestyrurj-238	220	19	volume	volume	NOUN
arestyrurj-238	220	20	i	i	PRON
arestyrurj-238	220	21	,	,	PUNCT
arestyrurj-238	220	22	issue	issue	VERB
arestyrurj-238	220	23	v	v	ADP
arestyrurj-238	220	24	antimicrobial	antimicrobial	ADJ
arestyrurj-238	220	25	activity	activity	NOUN
arestyrurj-238	220	26	and	and	CCONJ
arestyrurj-238	220	27	cytotoxicity	cytotoxicity	NOUN
arestyrurj-238	220	28	of	of	ADP
arestyrurj-238	220	29	βhairpin	βhairpin	ADJ
arestyrurj-238	220	30	peptides	peptide	NOUN
arestyrurj-238	220	31	.	.	PUNCT
arestyrurj-238	221	1	acs	acs	PROPN
arestyrurj-238	221	2	infectious	infectious	ADJ
arestyrurj-238	221	3	diseases	disease	NOUN
arestyrurj-238	221	4	,	,	PUNCT
arestyrurj-238	221	5	2(6	2(6	NUM
arestyrurj-238	221	6	)	)	PUNCT
arestyrurj-238	221	7	,	,	PUNCT
arestyrurj-238	221	8	442–450	442–450	NUM
arestyrurj-238	221	9	.	.	PUNCT
arestyrurj-238	222	1	https://doi.org/10.1021/acsinfecdis.6b00045	https://doi.org/10.1021/acsinfecdis.6b00045	ADJ
arestyrurj-238	222	2	[	[	X
arestyrurj-238	222	3	7	7	NUM
arestyrurj-238	222	4	]	]	X
arestyrurj-238	222	5	eisenberg	eisenberg	PROPN
arestyrurj-238	222	6	,	,	PUNCT
arestyrurj-238	222	7	d.	d.	PROPN
arestyrurj-238	222	8	,	,	PUNCT
arestyrurj-238	222	9	weiss	weiss	PROPN
arestyrurj-238	222	10	,	,	PUNCT
arestyrurj-238	222	11	r.m	r.m	PROPN
arestyrurj-238	222	12	.	.	PROPN
arestyrurj-238	222	13	,	,	PUNCT
arestyrurj-238	222	14	terwilliger	terwilliger	NOUN
arestyrurj-238	222	15	,	,	PUNCT
arestyrurj-238	222	16	t.c	t.c	PROPN
arestyrurj-238	222	17	.	.	PROPN
arestyrurj-238	222	18	,	,	PUNCT
arestyrurj-238	222	19	&	&	CCONJ
arestyrurj-238	222	20	wilcox	wilcox	PROPN
arestyrurj-238	222	21	,	,	PUNCT
arestyrurj-238	222	22	w.	w.	PROPN
arestyrurj-238	222	23	(	(	PUNCT
arestyrurj-238	222	24	1982	1982	NUM
arestyrurj-238	222	25	)	)	PUNCT
arestyrurj-238	222	26	.	.	PUNCT
arestyrurj-238	223	1	hydrophobic	hydrophobic	NOUN
arestyrurj-238	223	2	moments	moment	NOUN
arestyrurj-238	223	3	and	and	CCONJ
arestyrurj-238	223	4	protein	protein	NOUN
arestyrurj-238	223	5	structure	structure	NOUN
arestyrurj-238	223	6	.	.	PUNCT
arestyrurj-238	224	1	faraday	faraday	PROPN
arestyrurj-238	224	2	symp	symp	PROPN
arestyrurj-238	224	3	.	.	PUNCT
arestyrurj-238	225	1	chem	chem	PROPN
arestyrurj-238	225	2	.	.	PUNCT
arestyrurj-238	226	1	soc	soc	PROPN
arestyrurj-238	226	2	.	.	PUNCT
arestyrurj-238	226	3	,	,	PUNCT
arestyrurj-238	226	4	17	17	NUM
arestyrurj-238	226	5	,	,	PUNCT
arestyrurj-238	226	6	109	109	NUM
arestyrurj-238	226	7	-	-	SYM
arestyrurj-238	226	8	120	120	NUM
arestyrurj-238	226	9	.	.	PUNCT
arestyrurj-238	227	1	[	[	X
arestyrurj-238	227	2	8	8	NUM
arestyrurj-238	227	3	]	]	X
arestyrurj-238	227	4	eisenberg	eisenberg	PROPN
arestyrurj-238	227	5	,	,	PUNCT
arestyrurj-238	227	6	d.	d.	PROPN
arestyrurj-238	227	7	,	,	PUNCT
arestyrurj-238	227	8	weiss	weiss	PROPN
arestyrurj-238	227	9	,	,	PUNCT
arestyrurj-238	227	10	r.	r.	PROPN
arestyrurj-238	227	11	m.	m.	PROPN
arestyrurj-238	227	12	,	,	PUNCT
arestyrurj-238	227	13	&	&	CCONJ
arestyrurj-238	227	14	terwilliger	terwilliger	PROPN
arestyrurj-238	227	15	,	,	PUNCT
arestyrurj-238	227	16	t.	t.	PROPN
arestyrurj-238	227	17	c.	c.	PROPN
arestyrurj-238	227	18	(	(	PUNCT
arestyrurj-238	227	19	1984	1984	NUM
arestyrurj-238	227	20	)	)	PUNCT
arestyrurj-238	227	21	.	.	PUNCT
arestyrurj-238	228	1	the	the	DET
arestyrurj-238	228	2	hydrophobic	hydrophobic	ADJ
arestyrurj-238	228	3	moment	moment	NOUN
arestyrurj-238	228	4	detects	detect	NOUN
arestyrurj-238	228	5	periodicity	periodicity	NOUN
arestyrurj-238	228	6	in	in	ADP
arestyrurj-238	228	7	protein	protein	NOUN
arestyrurj-238	228	8	hydrophobicity	hydrophobicity	NOUN
arestyrurj-238	228	9	.	.	PUNCT
arestyrurj-238	229	1	proceedings	proceeding	NOUN
arestyrurj-238	229	2	of	of	ADP
arestyrurj-238	229	3	the	the	DET
arestyrurj-238	229	4	national	national	PROPN
arestyrurj-238	229	5	academy	academy	PROPN
arestyrurj-238	229	6	of	of	ADP
arestyrurj-238	229	7	sciences	sciences	PROPN
arestyrurj-238	229	8	of	of	ADP
arestyrurj-238	229	9	the	the	DET
arestyrurj-238	229	10	united	united	PROPN
arestyrurj-238	229	11	states	states	PROPN
arestyrurj-238	229	12	of	of	ADP
arestyrurj-238	229	13	america	america	PROPN
arestyrurj-238	229	14	,	,	PUNCT
arestyrurj-238	229	15	81(1	81(1	NUM
arestyrurj-238	229	16	)	)	PUNCT
arestyrurj-238	229	17	,	,	PUNCT
arestyrurj-238	229	18	140–144	140–144	NUM
arestyrurj-238	229	19	.	.	PUNCT
arestyrurj-238	230	1	https://doi.org/10.1073/pnas.81.1.140	https://doi.org/10.1073/pnas.81.1.140	NOUN
arestyrurj-238	230	2	[	[	X
arestyrurj-238	230	3	9	9	NUM
arestyrurj-238	230	4	]	]	SYM
arestyrurj-238	230	5	fauchere	fauchere	X
arestyrurj-238	230	6	,	,	PUNCT
arestyrurj-238	230	7	j.	j.	PROPN
arestyrurj-238	230	8	,	,	PUNCT
arestyrurj-238	230	9	pliska	pliska	PROPN
arestyrurj-238	230	10	,	,	PUNCT
arestyrurj-238	230	11	v	v	NOUN
arestyrurj-238	230	12	(	(	PUNCT
arestyrurj-238	230	13	1983	1983	NUM
arestyrurj-238	230	14	)	)	PUNCT
arestyrurj-238	230	15	.	.	PUNCT
arestyrurj-238	231	1	hydrophobic	hydrophobic	NOUN
arestyrurj-238	231	2	parameters	parameter	NOUN
arestyrurj-238	231	3	p	p	NOUN
arestyrurj-238	231	4	of	of	ADP
arestyrurj-238	231	5	amino	amino	NOUN
arestyrurj-238	231	6	-	-	PUNCT
arestyrurj-238	231	7	acid	acid	ADJ
arestyrurj-238	231	8	side	side	NOUN
arestyrurj-238	231	9	chains	chain	NOUN
arestyrurj-238	231	10	from	from	ADP
arestyrurj-238	231	11	the	the	DET
arestyrurj-238	231	12	partitioning	partitioning	NOUN
arestyrurj-238	231	13	of	of	ADP
arestyrurj-238	231	14	n	n	CCONJ
arestyrurj-238	231	15	-	-	PUNCT
arestyrurj-238	231	16	acetyl	acetyl	NOUN
arestyrurj-238	231	17	-	-	PUNCT
arestyrurj-238	231	18	amino	amino	NOUN
arestyrurj-238	231	19	-	-	PUNCT
arestyrurj-238	231	20	acid	acid	NOUN
arestyrurj-238	231	21	amides	amide	NOUN
arestyrurj-238	231	22	.	.	PUNCT
arestyrurj-238	232	1	eur	eur	PROPN
arestyrurj-238	232	2	.	.	PUNCT
arestyrurj-238	233	1	j.	j.	PROPN
arestyrurj-238	233	2	med	med	PROPN
arestyrurj-238	233	3	.	.	PROPN
arestyrurj-238	233	4	chem	chem	PROPN
arestyrurj-238	233	5	,	,	PUNCT
arestyrurj-238	233	6	8	8	NUM
arestyrurj-238	233	7	,	,	PUNCT
arestyrurj-238	233	8	369–375	369–375	NUM
arestyrurj-238	233	9	.	.	PUNCT
arestyrurj-238	234	1	[	[	X
arestyrurj-238	234	2	10	10	NUM
arestyrurj-238	234	3	]	]	PUNCT
arestyrurj-238	234	4	hincapié	hincapié	NOUN
arestyrurj-238	234	5	,	,	PUNCT
arestyrurj-238	234	6	o.	o.	PROPN
arestyrurj-238	234	7	,	,	PUNCT
arestyrurj-238	234	8	giraldo	giraldo	NOUN
arestyrurj-238	234	9	,	,	PUNCT
arestyrurj-238	234	10	p.	p.	PROPN
arestyrurj-238	234	11	,	,	PUNCT
arestyrurj-238	234	12	&	&	CCONJ
arestyrurj-238	234	13	orduz	orduz	PROPN
arestyrurj-238	234	14	,	,	PUNCT
arestyrurj-238	234	15	s.	s.	PROPN
arestyrurj-238	234	16	(	(	PUNCT
arestyrurj-238	234	17	2018	2018	NUM
arestyrurj-238	234	18	)	)	PUNCT
arestyrurj-238	234	19	.	.	PUNCT
arestyrurj-238	235	1	in	in	ADP
arestyrurj-238	235	2	silico	silico	NOUN
arestyrurj-238	235	3	design	design	NOUN
arestyrurj-238	235	4	of	of	ADP
arestyrurj-238	235	5	polycationic	polycationic	ADJ
arestyrurj-238	235	6	antimicrobial	antimicrobial	ADJ
arestyrurj-238	235	7	peptides	peptide	NOUN
arestyrurj-238	235	8	active	active	ADJ
arestyrurj-238	235	9	against	against	ADP
arestyrurj-238	235	10	pseudomonas	pseudomona	NOUN
arestyrurj-238	235	11	aeruginosa	aeruginosa	NOUN
arestyrurj-238	235	12	and	and	CCONJ
arestyrurj-238	235	13	staphylococcus	staphylococcus	NOUN
arestyrurj-238	235	14	aureus	aureus	NOUN
arestyrurj-238	235	15	.	.	PUNCT
arestyrurj-238	236	1	antonie	antonie	PROPN
arestyrurj-238	236	2	van	van	PROPN
arestyrurj-238	236	3	leeuwenhoek	leeuwenhoek	PROPN
arestyrurj-238	236	4	,	,	PUNCT
arestyrurj-238	236	5	111(10	111(10	NUM
arestyrurj-238	236	6	)	)	PUNCT
arestyrurj-238	236	7	,	,	PUNCT
arestyrurj-238	236	8	1871–1882	1871–1882	NUM
arestyrurj-238	236	9	.	.	PUNCT
arestyrurj-238	236	10	https://doi.org/10.1007/s10482-018-1080-2	https://doi.org/10.1007/s10482-018-1080-2	PUNCT
arestyrurj-238	237	1	[	[	X
arestyrurj-238	237	2	11	11	NUM
arestyrurj-238	237	3	]	]	X
arestyrurj-238	237	4	jiang	jiang	PROPN
arestyrurj-238	237	5	,	,	PUNCT
arestyrurj-238	237	6	z.	z.	PROPN
arestyrurj-238	237	7	,	,	PUNCT
arestyrurj-238	237	8	vasil	vasil	PROPN
arestyrurj-238	237	9	,	,	PUNCT
arestyrurj-238	237	10	a.	a.	NOUN
arestyrurj-238	237	11	i.	i.	PROPN
arestyrurj-238	237	12	,	,	PUNCT
arestyrurj-238	237	13	hale	hale	PROPN
arestyrurj-238	237	14	,	,	PUNCT
arestyrurj-238	237	15	j.	j.	PROPN
arestyrurj-238	237	16	d.	d.	PROPN
arestyrurj-238	237	17	,	,	PUNCT
arestyrurj-238	237	18	hancock	hancock	PROPN
arestyrurj-238	237	19	,	,	PUNCT
arestyrurj-238	237	20	r.	r.	PROPN
arestyrurj-238	237	21	e.	e.	PROPN
arestyrurj-238	237	22	,	,	PUNCT
arestyrurj-238	237	23	vasil	vasil	PROPN
arestyrurj-238	237	24	,	,	PUNCT
arestyrurj-238	237	25	m.	m.	NOUN
arestyrurj-238	237	26	l.	l.	PROPN
arestyrurj-238	237	27	,	,	PUNCT
arestyrurj-238	237	28	&	&	CCONJ
arestyrurj-238	237	29	hodges	hodges	PROPN
arestyrurj-238	237	30	,	,	PUNCT
arestyrurj-238	237	31	r.	r.	PROPN
arestyrurj-238	237	32	s.	s.	PROPN
arestyrurj-238	237	33	(	(	PUNCT
arestyrurj-238	237	34	2008	2008	NUM
arestyrurj-238	237	35	)	)	PUNCT
arestyrurj-238	237	36	.	.	PUNCT
arestyrurj-238	238	1	effects	effect	NOUN
arestyrurj-238	238	2	of	of	ADP
arestyrurj-238	238	3	net	net	ADJ
arestyrurj-238	238	4	charge	charge	NOUN
arestyrurj-238	238	5	and	and	CCONJ
arestyrurj-238	238	6	the	the	DET
arestyrurj-238	238	7	number	number	NOUN
arestyrurj-238	238	8	of	of	ADP
arestyrurj-238	238	9	positively	positively	ADV
arestyrurj-238	238	10	charged	charge	VERB
arestyrurj-238	238	11	residues	residue	NOUN
arestyrurj-238	238	12	on	on	ADP
arestyrurj-238	238	13	the	the	DET
arestyrurj-238	238	14	biological	biological	ADJ
arestyrurj-238	238	15	activity	activity	NOUN
arestyrurj-238	238	16	of	of	ADP
arestyrurj-238	238	17	amphipathic	amphipathic	ADJ
arestyrurj-238	238	18	alpha	alpha	ADJ
arestyrurj-238	238	19	-	-	PUNCT
arestyrurj-238	238	20	helical	helical	ADJ
arestyrurj-238	238	21	cationic	cationic	ADJ
arestyrurj-238	238	22	antimicrobial	antimicrobial	ADJ
arestyrurj-238	238	23	peptides	peptide	NOUN
arestyrurj-238	238	24	.	.	PUNCT
arestyrurj-238	239	1	biopolymers	biopolymer	NOUN
arestyrurj-238	239	2	,	,	PUNCT
arestyrurj-238	239	3	90(3	90(3	NOUN
arestyrurj-238	239	4	)	)	PUNCT
arestyrurj-238	239	5	,	,	PUNCT
arestyrurj-238	239	6	369–383	369–383	NUM
arestyrurj-238	239	7	.	.	PUNCT
arestyrurj-238	240	1	https://doi.org/10.1002/bip.20911	https://doi.org/10.1002/bip.20911	PROPN
arestyrurj-238	241	1	[	[	X
arestyrurj-238	241	2	12	12	NUM
arestyrurj-238	241	3	]	]	PUNCT
arestyrurj-238	241	4	jolliffe	jolliffe	PROPN
arestyrurj-238	241	5	i.t	i.t	PROPN
arestyrurj-238	241	6	.	.	PROPN
arestyrurj-238	242	1	and	and	CCONJ
arestyrurj-238	242	2	cadima	cadima	PROPN
arestyrurj-238	242	3	j.	j.	PROPN
arestyrurj-238	242	4	(	(	PUNCT
arestyrurj-238	242	5	2016	2016	NUM
arestyrurj-238	242	6	)	)	PUNCT
arestyrurj-238	242	7	.	.	PUNCT
arestyrurj-238	243	1	principal	principal	ADJ
arestyrurj-238	243	2	component	component	NOUN
arestyrurj-238	243	3	analysis	analysis	NOUN
arestyrurj-238	243	4	:	:	PUNCT
arestyrurj-238	243	5	a	a	DET
arestyrurj-238	243	6	review	review	NOUN
arestyrurj-238	243	7	and	and	CCONJ
arestyrurj-238	243	8	recent	recent	ADJ
arestyrurj-238	243	9	developments	development	NOUN
arestyrurj-238	243	10	.	.	PUNCT
arestyrurj-238	244	1	phil	phil	PROPN
arestyrurj-238	244	2	.	.	PUNCT
arestyrurj-238	245	1	trans	trans	PROPN
arestyrurj-238	245	2	.	.	PUNCT
arestyrurj-238	245	3	r.	r.	PROPN
arestyrurj-238	245	4	soc	soc	PROPN
arestyrurj-238	245	5	.	.	PUNCT
arestyrurj-238	246	1	a.3742015020220150202	a.3742015020220150202	NOUN
arestyrurj-238	246	2	.	.	PUNCT
arestyrurj-238	247	1	https://doi.org/10.1098/rsta.2015.0202	https://doi.org/10.1098/rsta.2015.0202	PROPN
arestyrurj-238	247	2	[	[	X
arestyrurj-238	247	3	13	13	NUM
arestyrurj-238	247	4	]	]	PUNCT
arestyrurj-238	247	5	krzywinski	krzywinski	NOUN
arestyrurj-238	247	6	,	,	PUNCT
arestyrurj-238	247	7	m.	m.	NOUN
arestyrurj-238	247	8	,	,	PUNCT
arestyrurj-238	247	9	altman	altman	PROPN
arestyrurj-238	247	10	,	,	PUNCT
arestyrurj-238	247	11	n.	n.	PROPN
arestyrurj-238	247	12	(	(	PUNCT
arestyrurj-238	247	13	2017	2017	NUM
arestyrurj-238	247	14	)	)	PUNCT
arestyrurj-238	247	15	.	.	PUNCT
arestyrurj-238	248	1	classification	classification	NOUN
arestyrurj-238	248	2	and	and	CCONJ
arestyrurj-238	248	3	regression	regression	NOUN
arestyrurj-238	248	4	trees	tree	NOUN
arestyrurj-238	248	5	.	.	PUNCT
arestyrurj-238	249	1	nat	nat	NOUN
arestyrurj-238	249	2	methods	method	NOUN
arestyrurj-238	249	3	14	14	NUM
arestyrurj-238	249	4	,	,	PUNCT
arestyrurj-238	249	5	757–758	757–758	NUM
arestyrurj-238	249	6	.	.	PUNCT
arestyrurj-238	249	7	https://doi.org/10.1038/nmeth.4370	https://doi.org/10.1038/nmeth.4370	NOUN
arestyrurj-238	250	1	[	[	X
arestyrurj-238	250	2	14	14	NUM
arestyrurj-238	250	3	]	]	X
arestyrurj-238	250	4	lei	lei	PROPN
arestyrurj-238	250	5	,	,	PUNCT
arestyrurj-238	250	6	j.	j.	PROPN
arestyrurj-238	250	7	,	,	PUNCT
arestyrurj-238	250	8	sun	sun	PROPN
arestyrurj-238	250	9	,	,	PUNCT
arestyrurj-238	250	10	l.	l.	PROPN
arestyrurj-238	250	11	,	,	PUNCT
arestyrurj-238	250	12	huang	huang	PROPN
arestyrurj-238	250	13	,	,	PUNCT
arestyrurj-238	250	14	s.	s.	PROPN
arestyrurj-238	250	15	,	,	PUNCT
arestyrurj-238	250	16	zhu	zhu	PROPN
arestyrurj-238	250	17	,	,	PUNCT
arestyrurj-238	250	18	c.	c.	PROPN
arestyrurj-238	250	19	,	,	PUNCT
arestyrurj-238	250	20	li	li	PROPN
arestyrurj-238	250	21	,	,	PUNCT
arestyrurj-238	250	22	p.	p.	PROPN
arestyrurj-238	250	23	,	,	PUNCT
arestyrurj-238	250	24	he	he	PRON
arestyrurj-238	250	25	,	,	PUNCT
arestyrurj-238	250	26	j.	j.	PROPN
arestyrurj-238	250	27	,	,	PUNCT
arestyrurj-238	250	28	mackey	mackey	PROPN
arestyrurj-238	250	29	,	,	PUNCT
arestyrurj-238	250	30	v.	v.	PROPN
arestyrurj-238	250	31	,	,	PUNCT
arestyrurj-238	250	32	coy	coy	ADJ
arestyrurj-238	250	33	,	,	PUNCT
arestyrurj-238	250	34	d.	d.	PROPN
arestyrurj-238	250	35	h.	h.	PROPN
arestyrurj-238	250	36	,	,	PUNCT
arestyrurj-238	250	37	&	&	CCONJ
arestyrurj-238	250	38	he	he	PRON
arestyrurj-238	250	39	,	,	PUNCT
arestyrurj-238	250	40	q.	q.	PROPN
arestyrurj-238	250	41	(	(	PUNCT
arestyrurj-238	250	42	2019	2019	NUM
arestyrurj-238	250	43	)	)	PUNCT
arestyrurj-238	250	44	.	.	PUNCT
arestyrurj-238	251	1	the	the	DET
arestyrurj-238	251	2	antimicrobial	antimicrobial	ADJ
arestyrurj-238	251	3	peptides	peptide	NOUN
arestyrurj-238	251	4	and	and	CCONJ
arestyrurj-238	251	5	their	their	PRON
arestyrurj-238	251	6	potential	potential	ADJ
arestyrurj-238	251	7	clinical	clinical	ADJ
arestyrurj-238	251	8	applications	application	NOUN
arestyrurj-238	251	9	.	.	PUNCT
arestyrurj-238	252	1	american	american	PROPN
arestyrurj-238	252	2	journal	journal	PROPN
arestyrurj-238	252	3	of	of	ADP
arestyrurj-238	252	4	translational	translational	ADJ
arestyrurj-238	252	5	research	research	NOUN
arestyrurj-238	252	6	,	,	PUNCT
arestyrurj-238	252	7	11(7	11(7	NUM
arestyrurj-238	252	8	)	)	PUNCT
arestyrurj-238	252	9	,	,	PUNCT
arestyrurj-238	252	10	3919	3919	NUM
arestyrurj-238	252	11	–	–	PUNCT
arestyrurj-238	252	12	3931	3931	NUM
arestyrurj-238	252	13	.	.	PUNCT
arestyrurj-238	253	1	[	[	X
arestyrurj-238	253	2	15	15	NUM
arestyrurj-238	253	3	]	]	X
arestyrurj-238	253	4	li	li	PROPN
arestyrurj-238	253	5	,	,	PUNCT
arestyrurj-238	253	6	s.	s.	PROPN
arestyrurj-238	253	7	,	,	PUNCT
arestyrurj-238	253	8	wang	wang	PROPN
arestyrurj-238	253	9	,	,	PUNCT
arestyrurj-238	253	10	y.	y.	PROPN
arestyrurj-238	253	11	,	,	PUNCT
arestyrurj-238	253	12	xue	xue	PROPN
arestyrurj-238	253	13	,	,	PUNCT
arestyrurj-238	253	14	z.	z.	PROPN
arestyrurj-238	253	15	,	,	PUNCT
arestyrurj-238	253	16	jia	jia	PROPN
arestyrurj-238	253	17	,	,	PUNCT
arestyrurj-238	253	18	y.	y.	PROPN
arestyrurj-238	253	19	,	,	PUNCT
arestyrurj-238	253	20	li	li	PROPN
arestyrurj-238	253	21	,	,	PUNCT
arestyrurj-238	253	22	r.	r.	PROPN
arestyrurj-238	253	23	,	,	PUNCT
arestyrurj-238	253	24	he	he	PRON
arestyrurj-238	253	25	,	,	PUNCT
arestyrurj-238	253	26	c.	c.	PROPN
arestyrurj-238	253	27	,	,	PUNCT
arestyrurj-238	253	28	&	&	CCONJ
arestyrurj-238	253	29	chen	chen	PROPN
arestyrurj-238	253	30	,	,	PUNCT
arestyrurj-238	253	31	h.	h.	PROPN
arestyrurj-238	253	32	(	(	PUNCT
arestyrurj-238	253	33	2021	2021	NUM
arestyrurj-238	253	34	)	)	PUNCT
arestyrurj-238	253	35	.	.	PUNCT
arestyrurj-238	254	1	the	the	DET
arestyrurj-238	254	2	structure	structure	NOUN
arestyrurj-238	254	3	-	-	PUNCT
arestyrurj-238	254	4	mechanism	mechanism	NOUN
arestyrurj-238	254	5	relationship	relationship	NOUN
arestyrurj-238	254	6	and	and	CCONJ
arestyrurj-238	254	7	mode	mode	NOUN
arestyrurj-238	254	8	of	of	ADP
arestyrurj-238	254	9	actions	action	NOUN
arestyrurj-238	254	10	of	of	ADP
arestyrurj-238	254	11	antimicrobial	antimicrobial	ADJ
arestyrurj-238	254	12	peptides	peptide	NOUN
arestyrurj-238	254	13	:	:	PUNCT
arestyrurj-238	254	14	a	a	DET
arestyrurj-238	254	15	review	review	NOUN
arestyrurj-238	254	16	.	.	PUNCT
arestyrurj-238	255	1	trends	trend	NOUN
arestyrurj-238	255	2	in	in	ADP
arestyrurj-238	255	3	food	food	NOUN
arestyrurj-238	255	4	science	science	NOUN
arestyrurj-238	255	5	&	&	CCONJ
arestyrurj-238	255	6	technology	technology	PROPN
arestyrurj-238	255	7	,	,	PUNCT
arestyrurj-238	255	8	109	109	NUM
arestyrurj-238	255	9	,	,	PUNCT
arestyrurj-238	255	10	103	103	NUM
arestyrurj-238	255	11	-	-	SYM
arestyrurj-238	255	12	115	115	NUM
arestyrurj-238	255	13	.	.	PUNCT
arestyrurj-238	256	1	doi:10.1016	doi:10.1016	PROPN
arestyrurj-238	256	2	/	/	SYM
arestyrurj-238	256	3	j.tifs.2021.01.005	j.tifs.2021.01.005	PROPN
arestyrurj-238	257	1	[	[	X
arestyrurj-238	257	2	16	16	NUM
arestyrurj-238	257	3	]	]	X
arestyrurj-238	257	4	moreau	moreau	PROPN
arestyrurj-238	257	5	-	-	PUNCT
arestyrurj-238	257	6	marquis	marquis	PROPN
arestyrurj-238	257	7	,	,	PUNCT
arestyrurj-238	257	8	s.	s.	PROPN
arestyrurj-238	257	9	,	,	PUNCT
arestyrurj-238	257	10	stanton	stanton	PROPN
arestyrurj-238	257	11	,	,	PUNCT
arestyrurj-238	257	12	b.	b.	PROPN
arestyrurj-238	257	13	a.	a.	PROPN
arestyrurj-238	257	14	,	,	PUNCT
arestyrurj-238	257	15	&	&	CCONJ
arestyrurj-238	257	16	o’toole	o’toole	PROPN
arestyrurj-238	257	17	,	,	PUNCT
arestyrurj-238	257	18	g.	g.	PROPN
arestyrurj-238	257	19	a.	a.	PROPN
arestyrurj-238	257	20	(	(	PUNCT
arestyrurj-238	257	21	2008	2008	NUM
arestyrurj-238	257	22	)	)	PUNCT
arestyrurj-238	257	23	.	.	PUNCT
arestyrurj-238	258	1	pseudomonas	pseudomona	VERB
arestyrurj-238	258	2	aeruginosa	aeruginosa	PROPN
arestyrurj-238	258	3	biofilm	biofilm	NOUN
arestyrurj-238	258	4	formation	formation	NOUN
arestyrurj-238	258	5	in	in	ADP
arestyrurj-238	258	6	the	the	DET
arestyrurj-238	258	7	cystic	cystic	ADJ
arestyrurj-238	258	8	fibrosis	fibrosis	NOUN
arestyrurj-238	258	9	airway	airway	NOUN
arestyrurj-238	258	10	.	.	PUNCT
arestyrurj-238	259	1	pulmonary	pulmonary	ADJ
arestyrurj-238	259	2	pharmacology	pharmacology	NOUN
arestyrurj-238	259	3	&	&	CCONJ
arestyrurj-238	259	4	therapeutics	therapeutic	NOUN
arestyrurj-238	259	5	,	,	PUNCT
arestyrurj-238	259	6	21(4	21(4	NUM
arestyrurj-238	259	7	)	)	PUNCT
arestyrurj-238	259	8	,	,	PUNCT
arestyrurj-238	259	9	595	595	NUM
arestyrurj-238	259	10	-	-	SYM
arestyrurj-238	259	11	599	599	NUM
arestyrurj-238	259	12	.	.	PUNCT
arestyrurj-238	260	1	https://doi.org/10.1016/j.pupt.2007.12.001	https://doi.org/10.1016/j.pupt.2007.12.001	PROPN
arestyrurj-238	260	2	[	[	PUNCT
arestyrurj-238	260	3	17	17	NUM
arestyrurj-238	260	4	]	]	PUNCT
arestyrurj-238	260	5	pace	pace	NOUN
arestyrurj-238	260	6	,	,	PUNCT
arestyrurj-238	260	7	c.n	c.n	PROPN
arestyrurj-238	260	8	.	.	PROPN
arestyrurj-238	260	9	,	,	PUNCT
arestyrurj-238	260	10	scholtz	scholtz	PROPN
arestyrurj-238	260	11	,	,	PUNCT
arestyrurj-238	260	12	j.m	j.m	PROPN
arestyrurj-238	260	13	.	.	PROPN
arestyrurj-238	260	14	(	(	PUNCT
arestyrurj-238	260	15	1998	1998	NUM
arestyrurj-238	260	16	)	)	PUNCT
arestyrurj-238	260	17	.	.	PUNCT
arestyrurj-238	261	1	a	a	DET
arestyrurj-238	261	2	helix	helix	ADJ
arestyrurj-238	261	3	propensity	propensity	NOUN
arestyrurj-238	261	4	scale	scale	NOUN
arestyrurj-238	261	5	based	base	VERB
arestyrurj-238	261	6	on	on	ADP
arestyrurj-238	261	7	experimental	experimental	ADJ
arestyrurj-238	261	8	studies	study	NOUN
arestyrurj-238	261	9	of	of	ADP
arestyrurj-238	261	10	peptides	peptide	NOUN
arestyrurj-238	261	11	and	and	CCONJ
arestyrurj-238	261	12	proteins	protein	NOUN
arestyrurj-238	261	13	.	.	PUNCT
arestyrurj-238	262	1	biophysical	biophysical	ADJ
arestyrurj-238	262	2	journal	journal	NOUN
arestyrurj-238	262	3	75	75	NUM
arestyrurj-238	262	4	,	,	PUNCT
arestyrurj-238	262	5	422	422	NUM
arestyrurj-238	262	6	-	-	SYM
arestyrurj-238	262	7	427	427	NUM
arestyrurj-238	262	8	.	.	PUNCT
arestyrurj-238	263	1	https://doi.org/10.1016/s0006-3495(98)77529-0	https://doi.org/10.1016/s0006-3495(98)77529-0	X
arestyrurj-238	264	1	[	[	X
arestyrurj-238	264	2	18	18	NUM
arestyrurj-238	264	3	]	]	X
arestyrurj-238	264	4	pirtskhalava	pirtskhalava	NOUN
arestyrurj-238	264	5	,	,	PUNCT
arestyrurj-238	264	6	m.	m.	NOUN
arestyrurj-238	264	7	,	,	PUNCT
arestyrurj-238	264	8	amstrong	amstrong	NOUN
arestyrurj-238	264	9	,	,	PUNCT
arestyrurj-238	264	10	a.	a.	NOUN
arestyrurj-238	264	11	a.	a.	PROPN
arestyrurj-238	264	12	,	,	PUNCT
arestyrurj-238	264	13	grigolava	grigolava	ADV
arestyrurj-238	264	14	,	,	PUNCT
arestyrurj-238	264	15	m.	m.	NOUN
arestyrurj-238	264	16	,	,	PUNCT
arestyrurj-238	264	17	chubinidze	chubinidze	NOUN
arestyrurj-238	264	18	,	,	PUNCT
arestyrurj-238	264	19	m.	m.	NOUN
arestyrurj-238	264	20	,	,	PUNCT
arestyrurj-238	264	21	alimbarashvili	alimbarashvili	PROPN
arestyrurj-238	264	22	,	,	PUNCT
arestyrurj-238	264	23	e.	e.	PROPN
arestyrurj-238	264	24	,	,	PUNCT
arestyrurj-238	264	25	vishnepolsky	vishnepolsky	PROPN
arestyrurj-238	264	26	,	,	PUNCT
arestyrurj-238	264	27	b.	b.	PROPN
arestyrurj-238	264	28	,	,	PUNCT
arestyrurj-238	264	29	gabrielian	gabrielian	PROPN
arestyrurj-238	264	30	,	,	PUNCT
arestyrurj-238	264	31	a.	a.	NOUN
arestyrurj-238	264	32	,	,	PUNCT
arestyrurj-238	264	33	rosenthal	rosenthal	PROPN
arestyrurj-238	264	34	,	,	PUNCT
arestyrurj-238	264	35	a.	a.	NOUN
arestyrurj-238	264	36	,	,	PUNCT
arestyrurj-238	264	37	hurt	hurt	VERB
arestyrurj-238	264	38	,	,	PUNCT
arestyrurj-238	264	39	d.	d.	PROPN
arestyrurj-238	264	40	e.	e.	PROPN
arestyrurj-238	264	41	,	,	PUNCT
arestyrurj-238	264	42	&	&	CCONJ
arestyrurj-238	264	43	tartakovsky	tartakovsky	PROPN
arestyrurj-238	264	44	,	,	PUNCT
arestyrurj-238	264	45	m.	m.	NOUN
arestyrurj-238	264	46	(	(	PUNCT
arestyrurj-238	264	47	2021	2021	NUM
arestyrurj-238	264	48	)	)	PUNCT
arestyrurj-238	264	49	.	.	PUNCT
arestyrurj-238	265	1	dbaasp	dbaasp	PROPN
arestyrurj-238	265	2	v3	v3	PROPN
arestyrurj-238	265	3	:	:	PUNCT
arestyrurj-238	265	4	database	database	NOUN
arestyrurj-238	265	5	of	of	ADP
arestyrurj-238	265	6	antimicrobial	antimicrobial	ADJ
arestyrurj-238	265	7	/	/	SYM
arestyrurj-238	265	8	cytotoxic	cytotoxic	ADJ
arestyrurj-238	265	9	activity	activity	NOUN
arestyrurj-238	265	10	and	and	CCONJ
arestyrurj-238	265	11	structure	structure	NOUN
arestyrurj-238	265	12	of	of	ADP
arestyrurj-238	265	13	peptides	peptide	NOUN
arestyrurj-238	265	14	as	as	ADP
arestyrurj-238	265	15	a	a	DET
arestyrurj-238	265	16	resource	resource	NOUN
arestyrurj-238	265	17	for	for	ADP
arestyrurj-238	265	18	development	development	NOUN
arestyrurj-238	265	19	of	of	ADP
arestyrurj-238	265	20	new	new	ADJ
arestyrurj-238	265	21	therapeutics	therapeutic	NOUN
arestyrurj-238	265	22	.	.	PUNCT
arestyrurj-238	266	1	nucleic	nucleic	ADJ
arestyrurj-238	266	2	acids	acid	NOUN
arestyrurj-238	266	3	research	research	NOUN
arestyrurj-238	266	4	,	,	PUNCT
arestyrurj-238	266	5	49(d1	49(d1	NUM
arestyrurj-238	266	6	)	)	PUNCT
arestyrurj-238	266	7	,	,	PUNCT
arestyrurj-238	266	8	d288	d288	PROPN
arestyrurj-238	266	9	–	–	PUNCT
arestyrurj-238	266	10	d297	d297	PROPN
arestyrurj-238	266	11	.	.	PUNCT
arestyrurj-238	267	1	https://doi.org/10.1093/nar/gkaa991	https://doi.org/10.1093/nar/gkaa991	PROPN
arestyrurj-238	268	1	[	[	X
arestyrurj-238	268	2	19	19	NUM
arestyrurj-238	268	3	]	]	PUNCT
arestyrurj-238	268	4	porto	porto	PROPN
arestyrurj-238	268	5	,	,	PUNCT
arestyrurj-238	268	6	w.f	w.f	PROPN
arestyrurj-238	268	7	.	.	PROPN
arestyrurj-238	268	8	,	,	PUNCT
arestyrurj-238	268	9	irazazabal	irazazabal	PROPN
arestyrurj-238	268	10	,	,	PUNCT
arestyrurj-238	268	11	l.	l.	PROPN
arestyrurj-238	268	12	,	,	PUNCT
arestyrurj-238	268	13	alves	alves	PROPN
arestyrurj-238	268	14	,	,	PUNCT
arestyrurj-238	268	15	e.s.f	e.s.f	PROPN
arestyrurj-238	268	16	.	.	PROPN
arestyrurj-238	268	17	et	et	PROPN
arestyrurj-238	268	18	al	al	PROPN
arestyrurj-238	268	19	.	.	PROPN
arestyrurj-238	268	20	(	(	PUNCT
arestyrurj-238	268	21	2018	2018	NUM
arestyrurj-238	268	22	)	)	PUNCT
arestyrurj-238	268	23	.	.	PUNCT
arestyrurj-238	269	1	in	in	ADP
arestyrurj-238	269	2	silico	silico	NOUN
arestyrurj-238	269	3	optimization	optimization	NOUN
arestyrurj-238	269	4	of	of	ADP
arestyrurj-238	269	5	a	a	DET
arestyrurj-238	269	6	guava	guava	NOUN
arestyrurj-238	269	7	antimicrobial	antimicrobial	ADJ
arestyrurj-238	269	8	peptide	peptide	NOUN
arestyrurj-238	269	9	enables	enable	VERB
arestyrurj-238	269	10	combinatorial	combinatorial	ADJ
arestyrurj-238	269	11	exploration	exploration	NOUN
arestyrurj-238	269	12	for	for	ADP
arestyrurj-238	269	13	peptide	peptide	ADJ
arestyrurj-238	269	14	design	design	NOUN
arestyrurj-238	269	15	.	.	PUNCT
arestyrurj-238	270	1	nat	nat	PROPN
arestyrurj-238	270	2	commun	commun	PROPN
arestyrurj-238	270	3	9	9	NUM
arestyrurj-238	270	4	,	,	PUNCT
arestyrurj-238	270	5	1490	1490	NUM
arestyrurj-238	270	6	.	.	PUNCT
arestyrurj-238	271	1	doi	doi	NOUN
arestyrurj-238	271	2	:	:	PUNCT
arestyrurj-238	271	3	https://doi.org/10.1038/s41467-018-03746-3	https://doi.org/10.1038/s41467-018-03746-3	NUM
arestyrurj-238	272	1	[	[	X
arestyrurj-238	272	2	20	20	NUM
arestyrurj-238	272	3	]	]	X
arestyrurj-238	272	4	ramazi	ramazi	ADJ
arestyrurj-238	272	5	,	,	PUNCT
arestyrurj-238	272	6	s.	s.	PROPN
arestyrurj-238	272	7	,	,	PUNCT
arestyrurj-238	272	8	mohammadi	mohammadi	NOUN
arestyrurj-238	272	9	,	,	PUNCT
arestyrurj-238	272	10	n.	n.	NOUN
arestyrurj-238	272	11	,	,	PUNCT
arestyrurj-238	272	12	allahverdi	allahverdi	PROPN
arestyrurj-238	272	13	,	,	PUNCT
arestyrurj-238	272	14	a.	a.	PROPN
arestyrurj-238	272	15	,	,	PUNCT
arestyrurj-238	272	16	khalili	khalili	PROPN
arestyrurj-238	272	17	,	,	PUNCT
arestyrurj-238	272	18	e.	e.	PROPN
arestyrurj-238	272	19	,	,	PUNCT
arestyrurj-238	272	20	&	&	CCONJ
arestyrurj-238	272	21	abdolmaleki	abdolmaleki	PROPN
arestyrurj-238	272	22	,	,	PUNCT
arestyrurj-238	272	23	p.	p.	NOUN
arestyrurj-238	272	24	(	(	PUNCT
arestyrurj-238	272	25	2022	2022	NUM
arestyrurj-238	272	26	)	)	PUNCT
arestyrurj-238	272	27	.	.	PUNCT
arestyrurj-238	273	1	a	a	DET
arestyrurj-238	273	2	review	review	NOUN
arestyrurj-238	273	3	on	on	ADP
arestyrurj-238	273	4	antimicrobial	antimicrobial	ADJ
arestyrurj-238	273	5	peptides	peptide	NOUN
arestyrurj-238	273	6	databases	database	NOUN
arestyrurj-238	273	7	and	and	CCONJ
arestyrurj-238	273	8	the	the	DET
arestyrurj-238	273	9	computational	computational	ADJ
arestyrurj-238	273	10	tools	tool	NOUN
arestyrurj-238	273	11	.	.	PUNCT
arestyrurj-238	274	1	database	database	NOUN
arestyrurj-238	274	2	:	:	PUNCT
arestyrurj-238	274	3	the	the	DET
arestyrurj-238	274	4	journal	journal	NOUN
arestyrurj-238	274	5	of	of	ADP
arestyrurj-238	274	6	biological	biological	ADJ
arestyrurj-238	274	7	databases	database	NOUN
arestyrurj-238	274	8	and	and	CCONJ
arestyrurj-238	274	9	curation	curation	NOUN
arestyrurj-238	274	10	,	,	PUNCT
arestyrurj-238	274	11	baac011	baac011	PROPN
arestyrurj-238	274	12	.	.	PUNCT
arestyrurj-238	274	13	https://doi.org/10.1093/database/baac011	https://doi.org/10.1093/database/baac011	X
arestyrurj-238	275	1	[	[	X
arestyrurj-238	275	2	21	21	NUM
arestyrurj-238	275	3	]	]	X
arestyrurj-238	275	4	ratner	ratner	PROPN
arestyrurj-238	275	5	,	,	PUNCT
arestyrurj-238	275	6	b.	b.	PROPN
arestyrurj-238	275	7	(	(	PUNCT
arestyrurj-238	275	8	2009	2009	NUM
arestyrurj-238	275	9	)	)	PUNCT
arestyrurj-238	275	10	.	.	PUNCT
arestyrurj-238	276	1	the	the	DET
arestyrurj-238	276	2	correlation	correlation	NOUN
arestyrurj-238	276	3	coefficient	coefficient	NOUN
arestyrurj-238	276	4	:	:	PUNCT
arestyrurj-238	276	5	its	its	PRON
arestyrurj-238	276	6	values	value	NOUN
arestyrurj-238	276	7	range	range	VERB
arestyrurj-238	276	8	between	between	ADP
arestyrurj-238	276	9	+1/−1	+1/−1	PROPN
arestyrurj-238	276	10	,	,	PUNCT
arestyrurj-238	276	11	or	or	CCONJ
arestyrurj-238	276	12	do	do	VERB
arestyrurj-238	276	13	they	they	PRON
arestyrurj-238	276	14	?	?	PUNCT
arestyrurj-238	276	15	.	.	PUNCT
arestyrurj-238	277	1	j	j	PROPN
arestyrurj-238	277	2	target	target	NOUN
arestyrurj-238	277	3	meas	meas	PROPN
arestyrurj-238	277	4	anal	anal	PROPN
arestyrurj-238	277	5	mark	mark	PROPN
arestyrurj-238	277	6	17	17	NUM
arestyrurj-238	277	7	,	,	PUNCT
arestyrurj-238	277	8	139–142	139–142	NUM
arestyrurj-238	277	9	.	.	PUNCT
arestyrurj-238	278	1	https://doi.org/10.1057/jt.2009.5	https://doi.org/10.1057/jt.2009.5	NOUN
arestyrurj-238	278	2	[	[	X
arestyrurj-238	278	3	22	22	NUM
arestyrurj-238	278	4	]	]	X
arestyrurj-238	278	5	shi	shi	PROPN
arestyrurj-238	278	6	,	,	PUNCT
arestyrurj-238	278	7	z.	z.	PROPN
arestyrurj-238	278	8	,	,	PUNCT
arestyrurj-238	278	9	olson	olson	PROPN
arestyrurj-238	278	10	,	,	PUNCT
arestyrurj-238	278	11	c.	c.	PROPN
arestyrurj-238	278	12	a.	a.	PROPN
arestyrurj-238	278	13	,	,	PUNCT
arestyrurj-238	278	14	&	&	CCONJ
arestyrurj-238	278	15	kallenbach	kallenbach	PROPN
arestyrurj-238	278	16	,	,	PUNCT
arestyrurj-238	278	17	n.	n.	PROPN
arestyrurj-238	278	18	r.	r.	PROPN
arestyrurj-238	278	19	(	(	PUNCT
arestyrurj-238	278	20	2002	2002	NUM
arestyrurj-238	278	21	)	)	PUNCT
arestyrurj-238	278	22	.	.	PUNCT
arestyrurj-238	279	1	cation	cation	NOUN
arestyrurj-238	279	2	-	-	PUNCT
arestyrurj-238	279	3	pi	pi	NOUN
arestyrurj-238	279	4	interaction	interaction	NOUN
arestyrurj-238	279	5	in	in	ADP
arestyrurj-238	279	6	model	model	NOUN
arestyrurj-238	279	7	alpha	alpha	NOUN
arestyrurj-238	279	8	-	-	PUNCT
arestyrurj-238	279	9	helical	helical	ADJ
arestyrurj-238	279	10	peptides	peptide	NOUN
arestyrurj-238	279	11	.	.	PUNCT
arestyrurj-238	280	1	journal	journal	NOUN
arestyrurj-238	280	2	of	of	ADP
arestyrurj-238	280	3	the	the	DET
arestyrurj-238	280	4	american	american	PROPN
arestyrurj-238	280	5	chemical	chemical	PROPN
arestyrurj-238	280	6	society	society	PROPN
arestyrurj-238	280	7	,	,	PUNCT
arestyrurj-238	280	8	124(13	124(13	NUM
arestyrurj-238	280	9	)	)	PUNCT
arestyrurj-238	280	10	,	,	PUNCT
arestyrurj-238	280	11	3284–3291	3284–3291	NUM
arestyrurj-238	280	12	.	.	PUNCT
arestyrurj-238	280	13	https://doi.org/10.1021/ja0174938	https://doi.org/10.1021/ja0174938	PROPN
arestyrurj-238	281	1	[	[	X
arestyrurj-238	281	2	23	23	NUM
arestyrurj-238	281	3	]	]	X
arestyrurj-238	281	4	thomas	thomas	PROPN
arestyrurj-238	281	5	,	,	PUNCT
arestyrurj-238	281	6	s.	s.	PROPN
arestyrurj-238	281	7	,	,	PUNCT
arestyrurj-238	281	8	karnik	karnik	PROPN
arestyrurj-238	281	9	,	,	PUNCT
arestyrurj-238	281	10	s.	s.	PROPN
arestyrurj-238	281	11	,	,	PUNCT
arestyrurj-238	281	12	barai	barai	PROPN
arestyrurj-238	281	13	,	,	PUNCT
arestyrurj-238	281	14	r.	r.	PROPN
arestyrurj-238	281	15	s.	s.	PROPN
arestyrurj-238	281	16	,	,	PUNCT
arestyrurj-238	281	17	jayaraman	jayaraman	NOUN
arestyrurj-238	281	18	,	,	PUNCT
arestyrurj-238	281	19	v.	v.	PROPN
arestyrurj-238	281	20	k.	k.	PROPN
arestyrurj-238	281	21	,	,	PUNCT
arestyrurj-238	281	22	&	&	CCONJ
arestyrurj-238	281	23	idicula	idicula	PROPN
arestyrurj-238	281	24	-	-	PUNCT
arestyrurj-238	281	25	thomas	thomas	PROPN
arestyrurj-238	281	26	,	,	PUNCT
arestyrurj-238	281	27	s.	s.	PROPN
arestyrurj-238	281	28	(	(	PUNCT
arestyrurj-238	281	29	2010	2010	NUM
arestyrurj-238	281	30	)	)	PUNCT
arestyrurj-238	281	31	.	.	PUNCT
arestyrurj-238	282	1	camp	camp	NOUN
arestyrurj-238	282	2	:	:	PUNCT
arestyrurj-238	282	3	a	a	DET
arestyrurj-238	282	4	useful	useful	ADJ
arestyrurj-238	282	5	resource	resource	NOUN
arestyrurj-238	282	6	for	for	ADP
arestyrurj-238	282	7	research	research	NOUN
arestyrurj-238	282	8	on	on	ADP
arestyrurj-238	282	9	antimicrobial	antimicrobial	ADJ
arestyrurj-238	282	10	peptides	peptide	NOUN
arestyrurj-238	282	11	.	.	PUNCT
arestyrurj-238	283	1	nucleic	nucleic	ADJ
arestyrurj-238	283	2	acids	acid	NOUN
arestyrurj-238	283	3	research	research	NOUN
arestyrurj-238	283	4	,	,	PUNCT
arestyrurj-238	283	5	38(database	38(database	NUM
arestyrurj-238	283	6	issue	issue	NOUN
arestyrurj-238	283	7	)	)	PUNCT
arestyrurj-238	283	8	,	,	PUNCT
arestyrurj-238	283	9	d774	d774	PROPN
arestyrurj-238	283	10	–	–	PUNCT
arestyrurj-238	283	11	d780	d780	PROPN
arestyrurj-238	283	12	.	.	PUNCT
arestyrurj-238	283	13	https://doi.org/10.1093/nar/gkp1021	https://doi.org/10.1093/nar/gkp1021	NOUN
arestyrurj-238	284	1	[	[	X
arestyrurj-238	284	2	24	24	NUM
arestyrurj-238	284	3	]	]	PUNCT
arestyrurj-238	284	4	timmons	timmon	NOUN
arestyrurj-238	284	5	,	,	PUNCT
arestyrurj-238	284	6	p.	p.	PROPN
arestyrurj-238	284	7	b.	b.	PROPN
arestyrurj-238	284	8	,	,	PUNCT
arestyrurj-238	284	9	&	&	CCONJ
arestyrurj-238	284	10	hewage	hewage	NOUN
arestyrurj-238	284	11	,	,	PUNCT
arestyrurj-238	284	12	c.	c.	NOUN
arestyrurj-238	284	13	m.	m.	NOUN
arestyrurj-238	284	14	(	(	PUNCT
arestyrurj-238	284	15	2020	2020	NUM
arestyrurj-238	284	16	)	)	PUNCT
arestyrurj-238	284	17	.	.	PUNCT
arestyrurj-238	285	1	happenn	happenn	PROPN
arestyrurj-238	285	2	is	be	AUX
arestyrurj-238	285	3	a	a	DET
arestyrurj-238	285	4	novel	novel	ADJ
arestyrurj-238	285	5	tool	tool	NOUN
arestyrurj-238	285	6	for	for	ADP
arestyrurj-238	285	7	hemolytic	hemolytic	ADJ
arestyrurj-238	285	8	activity	activity	NOUN
arestyrurj-238	285	9	prediction	prediction	NOUN
arestyrurj-238	285	10	for	for	ADP
arestyrurj-238	285	11	therapeutic	therapeutic	ADJ
arestyrurj-238	285	12	peptides	peptide	NOUN
arestyrurj-238	285	13	which	which	PRON
arestyrurj-238	285	14	employs	employ	VERB
arestyrurj-238	285	15	neural	neural	ADJ
arestyrurj-238	285	16	networks	network	NOUN
arestyrurj-238	285	17	.	.	PUNCT
arestyrurj-238	286	1	scientific	scientific	ADJ
arestyrurj-238	286	2	reports	report	NOUN
arestyrurj-238	286	3	,	,	PUNCT
arestyrurj-238	286	4	10(1	10(1	NUM
arestyrurj-238	286	5	)	)	PUNCT
arestyrurj-238	286	6	,	,	PUNCT
arestyrurj-238	286	7	10869	10869	NUM
arestyrurj-238	286	8	.	.	PUNCT
arestyrurj-238	287	1	https://doi.org/10.1038/s41598-020-67701-3	https://doi.org/10.1038/s41598-020-67701-3	NUM
arestyrurj-238	288	1	[	[	X
arestyrurj-238	288	2	25	25	NUM
arestyrurj-238	288	3	]	]	SYM
arestyrurj-238	288	4	ye	ye	PROPN
arestyrurj-238	288	5	,	,	PUNCT
arestyrurj-238	288	6	z.	z.	PROPN
arestyrurj-238	288	7	,	,	PUNCT
arestyrurj-238	288	8	&	&	CCONJ
arestyrurj-238	288	9	aparicio	aparicio	PROPN
arestyrurj-238	288	10	,	,	PUNCT
arestyrurj-238	288	11	c.	c.	PROPN
arestyrurj-238	288	12	(	(	PUNCT
arestyrurj-238	288	13	2019	2019	NUM
arestyrurj-238	288	14	)	)	PUNCT
arestyrurj-238	288	15	.	.	PUNCT
arestyrurj-238	289	1	modulation	modulation	NOUN
arestyrurj-238	289	2	of	of	ADP
arestyrurj-238	289	3	supramolecular	supramolecular	ADJ
arestyrurj-238	289	4	self	self	NOUN
arestyrurj-238	289	5	-	-	PUNCT
arestyrurj-238	289	6	assembly	assembly	NOUN
arestyrurj-238	289	7	of	of	ADP
arestyrurj-238	289	8	an	an	DET
arestyrurj-238	289	9	antimicrobial	antimicrobial	ADJ
arestyrurj-238	289	10	designer	designer	NOUN
arestyrurj-238	289	11	peptide	peptide	NOUN
arestyrurj-238	289	12	by	by	ADP
arestyrurj-238	289	13	single	single	ADJ
arestyrurj-238	289	14	amino	amino	NOUN
arestyrurj-238	289	15	acid	acid	NOUN
arestyrurj-238	289	16	substitution	substitution	NOUN
arestyrurj-238	289	17	:	:	PUNCT
arestyrurj-238	289	18	implications	implication	NOUN
arestyrurj-238	289	19	on	on	ADP
arestyrurj-238	289	20	peptide	peptide	ADJ
arestyrurj-238	289	21	activity	activity	NOUN
arestyrurj-238	289	22	.	.	PUNCT
arestyrurj-238	290	1	nanoscale	nanoscale	NOUN
arestyrurj-238	290	2	advances	advance	NOUN
arestyrurj-238	290	3	,	,	PUNCT
arestyrurj-238	290	4	1(12	1(12	NUM
arestyrurj-238	290	5	)	)	PUNCT
arestyrurj-238	290	6	,	,	PUNCT
arestyrurj-238	290	7	4679–4682	4679–4682	NOUN
arestyrurj-238	290	8	.	.	PUNCT
arestyrurj-238	291	1	https://doi.org/10.1039/c9na00498j	https://doi.org/10.1039/c9na00498j	PROPN
arestyrurj-238	291	2	https://doi.org/10.1021/acsinfecdis.6b00045	https://doi.org/10.1021/acsinfecdis.6b00045	PROPN
arestyrurj-238	291	3	https://doi.org/10.1073/pnas.81.1.140	https://doi.org/10.1073/pnas.81.1.140	PROPN
arestyrurj-238	291	4	https://doi.org/10.1007/s10482-018-1080-2	https://doi.org/10.1007/s10482-018-1080-2	PROPN
arestyrurj-238	291	5	https://doi.org/10.1002/bip.20911	https://doi.org/10.1002/bip.20911	PROPN
arestyrurj-238	291	6	https://doi.org/10.1098/rsta.2015.0202	https://doi.org/10.1098/rsta.2015.0202	PROPN
arestyrurj-238	291	7	https://doi.org/10.1038/nmeth.4370	https://doi.org/10.1038/nmeth.4370	NOUN
arestyrurj-238	291	8	https://doi.org/10.1016/j.pupt.2007.12.001	https://doi.org/10.1016/j.pupt.2007.12.001	VERB
arestyrurj-238	291	9	https://doi.org/10.1016/s0006-3495(98)77529-0	https://doi.org/10.1016/s0006-3495(98)77529-0	PROPN
arestyrurj-238	291	10	https://doi.org/10.1093/nar/gkaa991	https://doi.org/10.1093/nar/gkaa991	PROPN
arestyrurj-238	291	11	https://doi.org/10.1038/s41467-018-03746-3	https://doi.org/10.1038/s41467-018-03746-3	VERB
arestyrurj-238	291	12	https://doi.org/10.1093/database/baac011	https://doi.org/10.1093/database/baac011	NUM
arestyrurj-238	291	13	https://doi.org/10.1057/jt.2009.5	https://doi.org/10.1057/jt.2009.5	NOUN
arestyrurj-238	291	14	https://doi.org/10.1021/ja0174938	https://doi.org/10.1021/ja0174938	PROPN
arestyrurj-238	291	15	https://doi.org/10.1093/nar/gkp1021	https://doi.org/10.1093/nar/gkp1021	NOUN
arestyrurj-238	291	16	https://doi.org/10.1038/s41598-020-67701-3	https://doi.org/10.1038/s41598-020-67701-3	NUM
arestyrurj-238	291	17	https://doi.org/10.1039/c9na00498j	https://doi.org/10.1039/c9na00498j	PROPN
arestyrurj-238	291	18	aresty	aresty	ADJ
arestyrurj-238	291	19	rutgers	rutgers	PROPN
arestyrurj-238	291	20	undergraduate	undergraduate	PROPN
arestyrurj-238	291	21	research	research	PROPN
arestyrurj-238	291	22	journal	journal	PROPN
arestyrurj-238	291	23	,	,	PUNCT
arestyrurj-238	291	24	volume	volume	NOUN
arestyrurj-238	291	25	i	i	PRON
arestyrurj-238	291	26	,	,	PUNCT
arestyrurj-238	291	27	issue	issue	NOUN
arestyrurj-238	291	28	v	v	ADP
arestyrurj-238	291	29	alisha	alisha	PROPN
arestyrurj-238	291	30	zhu	zhu	PROPN
arestyrurj-238	291	31	is	be	AUX
arestyrurj-238	291	32	a	a	DET
arestyrurj-238	291	33	student	student	NOUN
arestyrurj-238	291	34	in	in	ADP
arestyrurj-238	291	35	the	the	DET
arestyrurj-238	291	36	honors	honor	NOUN
arestyrurj-238	291	37	college	college	PROPN
arestyrurj-238	291	38	at	at	ADP
arestyrurj-238	291	39	rutgers	rutgers	PROPN
arestyrurj-238	291	40	university	university	PROPN
arestyrurj-238	291	41	–	–	PUNCT
arestyrurj-238	291	42	new	new	PROPN
arestyrurj-238	291	43	brunswick	brunswick	PROPN
arestyrurj-238	291	44	.	.	PUNCT
arestyrurj-238	292	1	she	she	PRON
arestyrurj-238	292	2	is	be	AUX
arestyrurj-238	292	3	majoring	major	VERB
arestyrurj-238	292	4	in	in	ADP
arestyrurj-238	292	5	biomedical	biomedical	ADJ
arestyrurj-238	292	6	engineering	engineering	NOUN
arestyrurj-238	292	7	and	and	CCONJ
arestyrurj-238	292	8	minoring	minoring	PROPN
arestyrurj-238	292	9	in	in	ADP
arestyrurj-238	292	10	statistics	statistic	NOUN
arestyrurj-238	292	11	.	.	PUNCT
arestyrurj-238	293	1	over	over	ADP
arestyrurj-238	293	2	the	the	DET
arestyrurj-238	293	3	past	past	ADJ
arestyrurj-238	293	4	three	three	NUM
arestyrurj-238	293	5	years	year	NOUN
arestyrurj-238	293	6	,	,	PUNCT
arestyrurj-238	293	7	she	she	PRON
arestyrurj-238	293	8	has	have	AUX
arestyrurj-238	293	9	been	be	AUX
arestyrurj-238	293	10	working	work	VERB
arestyrurj-238	293	11	as	as	ADP
arestyrurj-238	293	12	an	an	DET
arestyrurj-238	293	13	undergraduate	undergraduate	NOUN
arestyrurj-238	293	14	researcher	researcher	NOUN
arestyrurj-238	293	15	in	in	ADP
arestyrurj-238	293	16	dr	dr	PROPN
arestyrurj-238	293	17	.	.	PROPN
arestyrurj-238	293	18	charles	charles	PROPN
arestyrurj-238	293	19	roth	roth	PROPN
arestyrurj-238	293	20	’s	’s	PART
arestyrurj-238	293	21	lab	lab	NOUN
arestyrurj-238	293	22	,	,	PUNCT
arestyrurj-238	293	23	which	which	PRON
arestyrurj-238	293	24	she	she	PRON
arestyrurj-238	293	25	first	first	ADV
arestyrurj-238	293	26	joined	join	VERB
arestyrurj-238	293	27	through	through	ADP
arestyrurj-238	293	28	the	the	DET
arestyrurj-238	293	29	aresty	aresty	ADJ
arestyrurj-238	293	30	research	research	NOUN
arestyrurj-238	293	31	assistant	assistant	NOUN
arestyrurj-238	293	32	program	program	NOUN
arestyrurj-238	293	33	.	.	PUNCT
arestyrurj-238	294	1	her	her	PRON
arestyrurj-238	294	2	research	research	NOUN
arestyrurj-238	294	3	focuses	focus	VERB
arestyrurj-238	294	4	on	on	ADP
arestyrurj-238	294	5	using	use	VERB
arestyrurj-238	294	6	computational	computational	ADJ
arestyrurj-238	294	7	statistics	statistic	NOUN
arestyrurj-238	294	8	and	and	CCONJ
arestyrurj-238	294	9	machine	machine	NOUN
arestyrurj-238	294	10	learning	learn	VERB
arestyrurj-238	294	11	techniques	technique	NOUN
arestyrurj-238	294	12	to	to	PART
arestyrurj-238	294	13	study	study	VERB
arestyrurj-238	294	14	the	the	DET
arestyrurj-238	294	15	relationship	relationship	NOUN
arestyrurj-238	294	16	between	between	ADP
arestyrurj-238	294	17	the	the	DET
arestyrurj-238	294	18	biophysical	biophysical	ADJ
arestyrurj-238	294	19	properties	property	NOUN
arestyrurj-238	294	20	of	of	ADP
arestyrurj-238	294	21	antimicrobial	antimicrobial	ADJ
arestyrurj-238	294	22	peptides	peptide	NOUN
arestyrurj-238	294	23	and	and	CCONJ
arestyrurj-238	294	24	their	their	PRON
arestyrurj-238	294	25	drug	drug	NOUN
arestyrurj-238	294	26	efficacies	efficacy	NOUN
arestyrurj-238	294	27	.	.	PUNCT
arestyrurj-238	295	1	outside	outside	ADP
arestyrurj-238	295	2	of	of	ADP
arestyrurj-238	295	3	research	research	NOUN
arestyrurj-238	295	4	,	,	PUNCT
arestyrurj-238	295	5	she	she	PRON
arestyrurj-238	295	6	is	be	AUX
arestyrurj-238	295	7	the	the	DET
arestyrurj-238	295	8	president	president	NOUN
arestyrurj-238	295	9	of	of	ADP
arestyrurj-238	295	10	the	the	DET
arestyrurj-238	295	11	society	society	NOUN
arestyrurj-238	295	12	of	of	ADP
arestyrurj-238	295	13	women	woman	NOUN
arestyrurj-238	295	14	engineers	engineer	NOUN
arestyrurj-238	295	15	(	(	PUNCT
arestyrurj-238	295	16	swe	swe	NOUN
arestyrurj-238	295	17	)	)	PUNCT
arestyrurj-238	295	18	and	and	CCONJ
arestyrurj-238	295	19	is	be	AUX
arestyrurj-238	295	20	the	the	DET
arestyrurj-238	295	21	external	external	ADJ
arestyrurj-238	295	22	vice	vice	NOUN
arestyrurj-238	295	23	president	president	NOUN
arestyrurj-238	295	24	of	of	ADP
arestyrurj-238	295	25	the	the	DET
arestyrurj-238	295	26	chinese	chinese	PROPN
arestyrurj-238	295	27	student	student	NOUN
arestyrurj-238	295	28	organization	organization	NOUN
arestyrurj-238	295	29	(	(	PUNCT
arestyrurj-238	295	30	cso	cso	PROPN
arestyrurj-238	295	31	)	)	PUNCT
arestyrurj-238	295	32	.	.	PUNCT
arestyrurj-238	296	1	contact	contact	NOUN
arestyrurj-238	296	2	:	:	PUNCT
arestyrurj-238	296	3	alisha.zhu@rutgers.edu	alisha.zhu@rutgers.edu	PUNCT