id	sid	tid	token	lemma	pos
ct-9100	1	1	introduction	introduction	NOUN
ct-9100	1	2	sperm	sperm	NOUN
ct-9100	1	3	acrosome	acrosome	NOUN
ct-9100	1	4	associated	associate	VERB
ct-9100	1	5	3	3	NUM
ct-9100	1	6	(	(	PUNCT
ct-9100	1	7	spaca3	spaca3	PROPN
ct-9100	1	8	,	,	PUNCT
ct-9100	1	9	also	also	ADV
ct-9100	1	10	known	know	VERB
ct-9100	1	11	as	as	ADP
ct-9100	1	12	sperm	sperm	NOUN
ct-9100	1	13	protein	protein	NOUN
ct-9100	1	14	reactive	reactive	NOUN
ct-9100	1	15	with	with	ADP
ct-9100	1	16	antisperm	antisperm	NOUN
ct-9100	1	17	antibody	antibody	NOUN
ct-9100	1	18	(	(	PUNCT
ct-9100	1	19	sprasa	sprasa	NOUN
ct-9100	1	20	)	)	PUNCT
ct-9100	1	21	and	and	CCONJ
ct-9100	1	22	sperm	sperm	NOUN
ct-9100	1	23	lysosome	lysosome	NOUN
ct-9100	1	24	-	-	PUNCT
ct-9100	1	25	like	like	ADJ
ct-9100	1	26	protein	protein	NOUN
ct-9100	1	27	1	1	NUM
ct-9100	1	28	(	(	PUNCT
ct-9100	1	29	sllp1	sllp1	PROPN
ct-9100	1	30	)	)	PUNCT
ct-9100	1	31	,	,	PUNCT
ct-9100	1	32	is	be	AUX
ct-9100	1	33	a	a	DET
ct-9100	1	34	unique	unique	ADJ
ct-9100	1	35	,	,	PUNCT
ct-9100	1	36	intra	intra	ADJ
ct-9100	1	37	-	-	ADJ
ct-9100	1	38	acrosomal	acrosomal	ADJ
ct-9100	1	39	,	,	PUNCT
ct-9100	1	40	nonbacteriolytic	nonbacteriolytic	NOUN
ct-9100	1	41	,	,	PUNCT
ct-9100	1	42	conventional	conventional	ADJ
ct-9100	1	43	-	-	PUNCT
ct-9100	1	44	type	type	NOUN
ct-9100	1	45	lysozyme	lysozyme	NOUN
ct-9100	1	46	-	-	PUNCT
ct-9100	1	47	like	like	ADJ
ct-9100	1	48	protein	protein	NOUN
ct-9100	1	49	of	of	ADP
ct-9100	1	50	mammalian	mammalian	ADJ
ct-9100	1	51	sperm.1,2	sperm.1,2	PROPN
ct-9100	1	52	sperm	sperm	NOUN
ct-9100	1	53	acrosome	acrosome	NOUN
ct-9100	1	54	associated	associate	VERB
ct-9100	1	55	3	3	NUM
ct-9100	1	56	is	be	AUX
ct-9100	1	57	expressed	express	VERB
ct-9100	1	58	on	on	ADP
ct-9100	1	59	the	the	DET
ct-9100	1	60	inner	inner	ADJ
ct-9100	1	61	acrosomal	acrosomal	NOUN
ct-9100	1	62	membrane	membrane	NOUN
ct-9100	1	63	of	of	ADP
ct-9100	1	64	human	human	ADJ
ct-9100	1	65	,	,	PUNCT
ct-9100	1	66	cattle	cattle	NOUN
ct-9100	1	67	,	,	PUNCT
ct-9100	1	68	sheep	sheep	NOUN
ct-9100	1	69	,	,	PUNCT
ct-9100	1	70	and	and	CCONJ
ct-9100	1	71	deer	deer	NOUN
ct-9100	2	1	sperm.3	sperm.3	ADV
ct-9100	2	2	in	in	ADP
ct-9100	2	3	addition	addition	NOUN
ct-9100	2	4	to	to	ADP
ct-9100	2	5	other	other	ADJ
ct-9100	2	6	testis	testis	NOUN
ct-9100	2	7	specific	specific	ADJ
ct-9100	2	8	lysozyme	lysozyme	NOUN
ct-9100	2	9	-	-	PUNCT
ct-9100	2	10	like	like	ADJ
ct-9100	2	11	proteins	protein	NOUN
ct-9100	2	12	,	,	PUNCT
ct-9100	2	13	spaca3	spaca3	PROPN
ct-9100	2	14	has	have	AUX
ct-9100	2	15	been	be	AUX
ct-9100	2	16	identified	identify	VERB
ct-9100	2	17	as	as	ADP
ct-9100	2	18	a	a	DET
ct-9100	2	19	biomarker	biomarker	NOUN
ct-9100	2	20	for	for	ADP
ct-9100	2	21	male	male	ADJ
ct-9100	2	22	fertility.4	fertility.4	NOUN
ct-9100	2	23	-	-	SYM
ct-9100	2	24	7	7	NUM
ct-9100	2	25	sperm	sperm	NOUN
ct-9100	2	26	acrosome	acrosome	NOUN
ct-9100	2	27	associated	associate	VERB
ct-9100	2	28	3	3	NUM
ct-9100	2	29	is	be	AUX
ct-9100	2	30	also	also	ADV
ct-9100	2	31	reported	report	VERB
ct-9100	2	32	to	to	PART
ct-9100	2	33	have	have	VERB
ct-9100	2	34	a	a	DET
ct-9100	2	35	role	role	NOUN
ct-9100	2	36	in	in	ADP
ct-9100	2	37	sperm	sperm	NOUN
ct-9100	2	38	-	-	PUNCT
ct-9100	2	39	egg	egg	NOUN
ct-9100	2	40	plasma	plasma	NOUN
ct-9100	2	41	membrane	membrane	NOUN
ct-9100	2	42	adhesion	adhesion	NOUN
ct-9100	2	43	and	and	CCONJ
ct-9100	2	44	fusion	fusion	NOUN
ct-9100	2	45	during	during	ADP
ct-9100	2	46	fertilization	fertilization	NOUN
ct-9100	2	47	in	in	ADP
ct-9100	2	48	humans1	humans1	NOUN
ct-9100	2	49	and	and	CCONJ
ct-9100	2	50	mice.8	mice.8	PROPN
ct-9100	2	51	sperm	sperm	NOUN
ct-9100	2	52	acrosome	acrosome	NOUN
ct-9100	2	53	associated	associate	VERB
ct-9100	2	54	3	3	NUM
ct-9100	2	55	might	might	AUX
ct-9100	2	56	have	have	VERB
ct-9100	2	57	a	a	DET
ct-9100	2	58	role	role	NOUN
ct-9100	2	59	in	in	ADP
ct-9100	2	60	female	female	ADJ
ct-9100	2	61	reproduction	reproduction	NOUN
ct-9100	2	62	.	.	PUNCT
ct-9100	3	1	women	woman	NOUN
ct-9100	3	2	experiencing	experience	VERB
ct-9100	3	3	infertility	infertility	NOUN
ct-9100	3	4	have	have	VERB
ct-9100	3	5	higher	high	ADJ
ct-9100	3	6	concentrations	concentration	NOUN
ct-9100	3	7	of	of	ADP
ct-9100	3	8	spaca3	spaca3	NOUN
ct-9100	3	9	antibodies	antibodie	VERB
ct-9100	3	10	than	than	ADP
ct-9100	3	11	fertile	fertile	ADJ
ct-9100	3	12	women.9	women.9	NOUN
ct-9100	3	13	additionally	additionally	ADV
ct-9100	3	14	,	,	PUNCT
ct-9100	3	15	female	female	ADJ
ct-9100	3	16	mice	mouse	NOUN
ct-9100	3	17	immunized	immunize	VERB
ct-9100	3	18	against	against	ADP
ct-9100	3	19	spaca3	spaca3	PROPN
ct-9100	3	20	had	have	AUX
ct-9100	3	21	profound	profound	ADJ
ct-9100	3	22	infertility.9	infertility.9	NOUN
ct-9100	3	23	in	in	ADP
ct-9100	3	24	cattle	cattle	NOUN
ct-9100	3	25	,	,	PUNCT
ct-9100	3	26	dogs	dog	NOUN
ct-9100	3	27	,	,	PUNCT
ct-9100	3	28	and	and	CCONJ
ct-9100	3	29	cats	cat	NOUN
ct-9100	3	30	,	,	PUNCT
ct-9100	3	31	spaca3	spaca3	PROPN
ct-9100	3	32	is	be	AUX
ct-9100	3	33	expressed	express	VERB
ct-9100	3	34	in	in	ADP
ct-9100	3	35	ovarian	ovarian	ADJ
ct-9100	3	36	follicles	follicle	NOUN
ct-9100	3	37	at	at	ADP
ct-9100	3	38	all	all	DET
ct-9100	3	39	stages	stage	NOUN
ct-9100	3	40	of	of	ADP
ct-9100	3	41	development	development	NOUN
ct-9100	3	42	and	and	CCONJ
ct-9100	3	43	localized	localize	VERB
ct-9100	3	44	to	to	ADP
ct-9100	3	45	the	the	DET
ct-9100	3	46	ooplasm	ooplasm	NOUN
ct-9100	3	47	and	and	CCONJ
ct-9100	3	48	granulosa	granulosa	NOUN
ct-9100	3	49	cells	cell	NOUN
ct-9100	3	50	with	with	ADP
ct-9100	3	51	weak	weak	ADJ
ct-9100	3	52	staining	staining	NOUN
ct-9100	3	53	in	in	ADP
ct-9100	3	54	theca	theca	PROPN
ct-9100	3	55	cells.9	cells.9	PROPN
ct-9100	3	56	in	in	ADP
ct-9100	3	57	a	a	DET
ct-9100	3	58	preliminary	preliminary	ADJ
ct-9100	3	59	study	study	NOUN
ct-9100	3	60	,	,	PUNCT
ct-9100	3	61	spaca3	spaca3	X
ct-9100	4	1	expression	expression	NOUN
ct-9100	4	2	was	be	AUX
ct-9100	4	3	examined	examine	VERB
ct-9100	4	4	in	in	ADP
ct-9100	4	5	the	the	DET
ct-9100	4	6	equine	equine	NOUN
ct-9100	4	7	ovary	ovary	NOUN
ct-9100	4	8	of	of	ADP
ct-9100	4	9	3	3	NUM
ct-9100	4	10	horses.10	horses.10	VERB
ct-9100	4	11	the	the	DET
ct-9100	4	12	objective	objective	NOUN
ct-9100	4	13	of	of	ADP
ct-9100	4	14	the	the	DET
ct-9100	4	15	current	current	ADJ
ct-9100	4	16	study	study	NOUN
ct-9100	4	17	was	be	AUX
ct-9100	4	18	to	to	PART
ct-9100	4	19	confirm	confirm	VERB
ct-9100	4	20	spaca3	spaca3	NOUN
ct-9100	4	21	expression	expression	NOUN
ct-9100	4	22	in	in	ADP
ct-9100	4	23	the	the	DET
ct-9100	4	24	equine	equine	NOUN
ct-9100	4	25	ovary	ovary	NOUN
ct-9100	4	26	from	from	ADP
ct-9100	4	27	a	a	DET
ct-9100	4	28	larger	large	ADJ
ct-9100	4	29	sample	sample	NOUN
ct-9100	4	30	size	size	NOUN
ct-9100	4	31	consisting	consist	VERB
ct-9100	4	32	of	of	ADP
ct-9100	4	33	both	both	PRON
ct-9100	4	34	domesticated	domesticate	VERB
ct-9100	4	35	and	and	CCONJ
ct-9100	4	36	feral	feral	ADJ
ct-9100	4	37	mares	mare	NOUN
ct-9100	4	38	materials	material	NOUN
ct-9100	4	39	and	and	CCONJ
ct-9100	4	40	methods	method	NOUN
ct-9100	4	41	both	both	CCONJ
ct-9100	4	42	domesticated	domesticate	VERB
ct-9100	4	43	mares	mare	NOUN
ct-9100	4	44	(	(	PUNCT
ct-9100	4	45	n	n	NOUN
ct-9100	4	46	=	=	SYM
ct-9100	4	47	8)	8)	NUM
ct-9100	4	48	and	and	CCONJ
ct-9100	4	49	feral	feral	ADJ
ct-9100	4	50	mares	mare	NOUN
ct-9100	4	51	(	(	PUNCT
ct-9100	4	52	n	n	NOUN
ct-9100	4	53	=	=	SYM
ct-9100	4	54	8)	8)	NUM
ct-9100	4	55	were	be	AUX
ct-9100	4	56	used	use	VERB
ct-9100	4	57	in	in	ADP
ct-9100	4	58	this	this	DET
ct-9100	4	59	study	study	NOUN
ct-9100	4	60	.	.	PUNCT
ct-9100	5	1	domesticated	domesticate	VERB
ct-9100	5	2	mares	mare	NOUN
ct-9100	5	3	(	(	PUNCT
ct-9100	5	4	3	3	NUM
ct-9100	5	5	14	14	NUM
ct-9100	5	6	years	year	NOUN
ct-9100	5	7	old	old	ADJ
ct-9100	5	8	)	)	PUNCT
ct-9100	5	9	were	be	AUX
ct-9100	5	10	pastured	pasture	VERB
ct-9100	5	11	on	on	ADP
ct-9100	5	12	a	a	DET
ct-9100	5	13	ranch	ranch	NOUN
ct-9100	5	14	located	locate	VERB
ct-9100	5	15	in	in	ADP
ct-9100	5	16	stayton	stayton	PROPN
ct-9100	5	17	,	,	PUNCT
ct-9100	5	18	oregon	oregon	PROPN
ct-9100	5	19	.	.	PUNCT
ct-9100	6	1	each	each	DET
ct-9100	6	2	pasture	pasture	NOUN
ct-9100	6	3	contained	contain	VERB
ct-9100	6	4	a	a	DET
ct-9100	6	5	4.9	4.9	NUM
ct-9100	6	6	x	x	SYM
ct-9100	6	7	7.3	7.3	NUM
ct-9100	6	8	meter	meter	NOUN
ct-9100	6	9	,	,	PUNCT
ct-9100	6	10	3	3	NUM
ct-9100	6	11	-	-	PUNCT
ct-9100	6	12	sided	sided	ADJ
ct-9100	6	13	shelter	shelter	NOUN
ct-9100	6	14	.	.	PUNCT
ct-9100	7	1	feral	feral	ADJ
ct-9100	7	2	mares	mare	NOUN
ct-9100	7	3	(	(	PUNCT
ct-9100	7	4	3	3	NUM
ct-9100	7	5	years	year	NOUN
ct-9100	7	6	sperm	sperm	NOUN
ct-9100	7	7	acrosome	acrosome	NOUN
ct-9100	7	8	associated	associate	VERB
ct-9100	7	9	3	3	NUM
ct-9100	7	10	protein	protein	NOUN
ct-9100	7	11	expression	expression	NOUN
ct-9100	7	12	in	in	ADP
ct-9100	7	13	equine	equine	NOUN
ct-9100	7	14	primordial	primordial	ADJ
ct-9100	7	15	,	,	PUNCT
ct-9100	7	16	primary	primary	ADJ
ct-9100	7	17	,	,	PUNCT
ct-9100	7	18	secondary	secondary	ADJ
ct-9100	7	19	,	,	PUNCT
ct-9100	7	20	and	and	CCONJ
ct-9100	7	21	tertiary	tertiary	ADJ
ct-9100	7	22	follicles	follicle	NOUN
ct-9100	7	23	brynley	brynley	PROPN
ct-9100	7	24	cozzi	cozzi	PROPN
ct-9100	7	25	,	,	PUNCT
ct-9100	7	26	zahra	zahra	PROPN
ct-9100	7	27	kiesler	kiesler	PROPN
ct-9100	7	28	,	,	PUNCT
ct-9100	7	29	michelle	michelle	PROPN
ct-9100	7	30	kutzler	kutzler	PROPN
ct-9100	7	31	department	department	PROPN
ct-9100	7	32	of	of	ADP
ct-9100	7	33	animal	animal	NOUN
ct-9100	7	34	and	and	CCONJ
ct-9100	7	35	rangeland	rangeland	NOUN
ct-9100	7	36	sciences	science	NOUN
ct-9100	7	37	,	,	PUNCT
ct-9100	7	38	college	college	NOUN
ct-9100	7	39	of	of	ADP
ct-9100	7	40	agricultural	agricultural	ADJ
ct-9100	7	41	science	science	NOUN
ct-9100	7	42	oregon	oregon	PROPN
ct-9100	7	43	state	state	PROPN
ct-9100	7	44	university	university	PROPN
ct-9100	7	45	,	,	PUNCT
ct-9100	7	46	corvallis	corvallis	PROPN
ct-9100	7	47	,	,	PUNCT
ct-9100	7	48	or	or	CCONJ
ct-9100	7	49	abstract	abstract	ADV
ct-9100	7	50	the	the	DET
ct-9100	7	51	objective	objective	NOUN
ct-9100	7	52	of	of	ADP
ct-9100	7	53	this	this	DET
ct-9100	7	54	study	study	NOUN
ct-9100	7	55	was	be	AUX
ct-9100	7	56	to	to	PART
ct-9100	7	57	characterize	characterize	VERB
ct-9100	7	58	the	the	DET
ct-9100	7	59	protein	protein	NOUN
ct-9100	7	60	expression	expression	NOUN
ct-9100	7	61	of	of	ADP
ct-9100	7	62	sperm	sperm	NOUN
ct-9100	7	63	acrosome	acrosome	NOUN
ct-9100	7	64	associated	associate	VERB
ct-9100	7	65	3	3	NUM
ct-9100	7	66	(	(	PUNCT
ct-9100	7	67	spaca3	spaca3	X
ct-9100	7	68	)	)	PUNCT
ct-9100	7	69	in	in	ADP
ct-9100	7	70	the	the	DET
ct-9100	7	71	equine	equine	NOUN
ct-9100	7	72	ovary	ovary	NOUN
ct-9100	7	73	.	.	PUNCT
ct-9100	8	1	formalin	formalin	NOUN
ct-9100	8	2	-	-	PUNCT
ct-9100	8	3	fixed	fix	VERB
ct-9100	8	4	and	and	CCONJ
ct-9100	8	5	paraffin	paraffin	NOUN
ct-9100	8	6	-	-	PUNCT
ct-9100	8	7	embedded	embed	VERB
ct-9100	8	8	ovarian	ovarian	ADJ
ct-9100	8	9	sections	section	NOUN
ct-9100	8	10	from	from	ADP
ct-9100	8	11	16	16	NUM
ct-9100	8	12	horses	horse	NOUN
ct-9100	8	13	were	be	AUX
ct-9100	8	14	processed	process	VERB
ct-9100	8	15	for	for	ADP
ct-9100	8	16	routine	routine	ADJ
ct-9100	8	17	immunohistochemistry	immunohistochemistry	NOUN
ct-9100	8	18	for	for	ADP
ct-9100	8	19	spaca3	spaca3	PROPN
ct-9100	8	20	.	.	PUNCT
ct-9100	9	1	representative	representative	ADJ
ct-9100	9	2	images	image	NOUN
ct-9100	9	3	were	be	AUX
ct-9100	9	4	digitally	digitally	ADV
ct-9100	9	5	captured	capture	VERB
ct-9100	9	6	at	at	ADP
ct-9100	9	7	400	400	NUM
ct-9100	9	8	x	x	NOUN
ct-9100	9	9	magnification	magnification	NOUN
ct-9100	9	10	.	.	PUNCT
ct-9100	10	1	in	in	ADP
ct-9100	10	2	all	all	DET
ct-9100	10	3	mares	mare	NOUN
ct-9100	10	4	,	,	PUNCT
ct-9100	10	5	spaca3	spaca3	PROPN
ct-9100	10	6	was	be	AUX
ct-9100	10	7	expressed	express	VERB
ct-9100	10	8	in	in	ADP
ct-9100	10	9	granulosa	granulosa	NOUN
ct-9100	10	10	cells	cell	NOUN
ct-9100	10	11	of	of	ADP
ct-9100	10	12	all	all	DET
ct-9100	10	13	stages	stage	NOUN
ct-9100	10	14	of	of	ADP
ct-9100	10	15	follicles	follicle	NOUN
ct-9100	10	16	.	.	PUNCT
ct-9100	11	1	expression	expression	NOUN
ct-9100	11	2	of	of	ADP
ct-9100	11	3	spaca3	spaca3	NOUN
ct-9100	11	4	in	in	ADP
ct-9100	11	5	all	all	DET
ct-9100	11	6	equine	equine	ADJ
ct-9100	11	7	follicular	follicular	ADJ
ct-9100	11	8	stages	stage	NOUN
ct-9100	11	9	suggests	suggest	VERB
ct-9100	11	10	that	that	SCONJ
ct-9100	11	11	this	this	PRON
ct-9100	11	12	may	may	AUX
ct-9100	11	13	be	be	AUX
ct-9100	11	14	a	a	DET
ct-9100	11	15	permanent	permanent	ADJ
ct-9100	11	16	immunosterilant	immunosterilant	ADJ
ct-9100	11	17	target	target	NOUN
ct-9100	11	18	for	for	ADP
ct-9100	11	19	the	the	DET
ct-9100	11	20	management	management	NOUN
ct-9100	11	21	of	of	ADP
ct-9100	11	22	feral	feral	ADJ
ct-9100	11	23	horse	horse	NOUN
ct-9100	11	24	herds	herd	NOUN
ct-9100	11	25	.	.	PUNCT
ct-9100	12	1	additional	additional	ADJ
ct-9100	12	2	research	research	NOUN
ct-9100	12	3	is	be	AUX
ct-9100	12	4	needed	need	VERB
ct-9100	12	5	to	to	PART
ct-9100	12	6	determine	determine	VERB
ct-9100	12	7	if	if	SCONJ
ct-9100	12	8	horses	horse	NOUN
ct-9100	12	9	can	can	AUX
ct-9100	12	10	produce	produce	VERB
ct-9100	12	11	a	a	DET
ct-9100	12	12	robust	robust	ADJ
ct-9100	12	13	humoral	humoral	ADJ
ct-9100	12	14	response	response	NOUN
ct-9100	12	15	to	to	ADP
ct-9100	12	16	a	a	DET
ct-9100	12	17	spaca3	spaca3	NOUN
ct-9100	12	18	vaccine	vaccine	NOUN
ct-9100	12	19	to	to	PART
ct-9100	12	20	induce	induce	VERB
ct-9100	12	21	sustained	sustained	ADJ
ct-9100	12	22	infertility	infertility	NOUN
ct-9100	12	23	.	.	PUNCT
ct-9100	13	1	keywords	keyword	NOUN
ct-9100	13	2	:	:	PUNCT
ct-9100	13	3	granulosa	granulosa	NOUN
ct-9100	13	4	cell	cell	NOUN
ct-9100	13	5	,	,	PUNCT
ct-9100	13	6	horse	horse	NOUN
ct-9100	13	7	,	,	PUNCT
ct-9100	13	8	ovary	ovary	ADJ
ct-9100	13	9	,	,	PUNCT
ct-9100	13	10	sperm	sperm	NOUN
ct-9100	13	11	acrosome	acrosome	NOUN
ct-9100	13	12	associated	associate	VERB
ct-9100	13	13	3	3	NUM
ct-9100	13	14	protein	protein	NOUN
ct-9100	13	15	old	old	ADJ
ct-9100	13	16	)	)	PUNCT
ct-9100	13	17	were	be	AUX
ct-9100	13	18	maintained	maintain	VERB
ct-9100	13	19	at	at	ADP
ct-9100	13	20	the	the	DET
ct-9100	13	21	warm	warm	ADJ
ct-9100	13	22	springs	spring	NOUN
ct-9100	13	23	herd	herd	PROPN
ct-9100	13	24	management	management	NOUN
ct-9100	13	25	area	area	NOUN
ct-9100	13	26	located	locate	VERB
ct-9100	13	27	in	in	ADP
ct-9100	13	28	harney	harney	PROPN
ct-9100	13	29	county	county	PROPN
ct-9100	13	30	,	,	PUNCT
ct-9100	13	31	oregon	oregon	PROPN
ct-9100	13	32	.	.	PUNCT
ct-9100	14	1	the	the	DET
ct-9100	14	2	procedures	procedure	NOUN
ct-9100	14	3	were	be	AUX
ct-9100	14	4	conducted	conduct	VERB
ct-9100	14	5	under	under	ADP
ct-9100	14	6	a	a	DET
ct-9100	14	7	protocol	protocol	NOUN
ct-9100	14	8	approved	approve	VERB
ct-9100	14	9	by	by	ADP
ct-9100	14	10	the	the	DET
ct-9100	14	11	institutional	institutional	ADJ
ct-9100	14	12	animal	animal	NOUN
ct-9100	14	13	care	care	NOUN
ct-9100	14	14	and	and	CCONJ
ct-9100	14	15	use	use	VERB
ct-9100	14	16	committee	committee	NOUN
ct-9100	14	17	of	of	ADP
ct-9100	14	18	oregon	oregon	PROPN
ct-9100	14	19	state	state	PROPN
ct-9100	14	20	university	university	PROPN
ct-9100	14	21	(	(	PUNCT
ct-9100	14	22	protocol	protocol	NOUN
ct-9100	14	23	#	#	SYM
ct-9100	14	24	3924	3924	NUM
ct-9100	14	25	)	)	PUNCT
ct-9100	14	26	.	.	PUNCT
ct-9100	15	1	ovaries	ovary	NOUN
ct-9100	15	2	were	be	AUX
ct-9100	15	3	obtained	obtain	VERB
ct-9100	15	4	via	via	ADP
ct-9100	15	5	a	a	DET
ct-9100	15	6	standing	stand	VERB
ct-9100	15	7	colpotomy	colpotomy	NOUN
ct-9100	15	8	performed	perform	VERB
ct-9100	15	9	by	by	ADP
ct-9100	15	10	an	an	DET
ct-9100	15	11	experienced	experienced	ADJ
ct-9100	15	12	veterinarian	veterinarian	NOUN
ct-9100	15	13	.	.	PUNCT
ct-9100	16	1	briefly	briefly	ADV
ct-9100	16	2	,	,	PUNCT
ct-9100	16	3	feed	feed	NOUN
ct-9100	16	4	was	be	AUX
ct-9100	16	5	withheld	withhold	VERB
ct-9100	16	6	for	for	ADP
ct-9100	16	7	36	36	NUM
ct-9100	16	8	hours	hour	NOUN
ct-9100	16	9	prior	prior	ADV
ct-9100	16	10	to	to	ADP
ct-9100	16	11	surgery	surgery	NOUN
ct-9100	16	12	.	.	PUNCT
ct-9100	17	1	for	for	ADP
ct-9100	17	2	sedation	sedation	NOUN
ct-9100	17	3	and	and	CCONJ
ct-9100	17	4	analgesia	analgesia	NOUN
ct-9100	17	5	,	,	PUNCT
ct-9100	17	6	detomidine	detomidine	ADJ
ct-9100	17	7	hydrochloride	hydrochloride	NOUN
ct-9100	17	8	(	(	PUNCT
ct-9100	17	9	0.02	0.02	NUM
ct-9100	17	10	0.04	0.04	NUM
ct-9100	17	11	mg	mg	PROPN
ct-9100	17	12	/	/	SYM
ct-9100	17	13	kg	kg	PROPN
ct-9100	17	14	)	)	PUNCT
ct-9100	17	15	,	,	PUNCT
ct-9100	17	16	butorphanol	butorphanol	VERB
ct-9100	17	17	tartrate	tartrate	NOUN
ct-9100	17	18	(	(	PUNCT
ct-9100	17	19	0.01	0.01	NUM
ct-9100	17	20	0.04	0.04	NUM
ct-9100	17	21	mg	mg	PROPN
ct-9100	17	22	/	/	SYM
ct-9100	17	23	kg	kg	PROPN
ct-9100	17	24	)	)	PUNCT
ct-9100	17	25	,	,	PUNCT
ct-9100	17	26	and	and	CCONJ
ct-9100	17	27	xylazine	xylazine	PROPN
ct-9100	17	28	hydrochloride	hydrochloride	NOUN
ct-9100	17	29	(	(	PUNCT
ct-9100	17	30	0.9	0.9	NUM
ct-9100	17	31	1.2	1.2	NUM
ct-9100	17	32	mg/	mg/	NOUN
ct-9100	17	33	kg	kg	PROPN
ct-9100	17	34	)	)	PUNCT
ct-9100	17	35	were	be	AUX
ct-9100	17	36	given	give	VERB
ct-9100	17	37	intravenously	intravenously	ADV
ct-9100	17	38	.	.	PUNCT
ct-9100	18	1	surgical	surgical	ADJ
ct-9100	18	2	preparation	preparation	NOUN
ct-9100	18	3	included	include	VERB
ct-9100	18	4	wrapping	wrap	VERB
ct-9100	18	5	the	the	DET
ct-9100	18	6	tail	tail	NOUN
ct-9100	18	7	with	with	ADP
ct-9100	18	8	gauze	gauze	NOUN
ct-9100	18	9	and	and	CCONJ
ct-9100	18	10	tying	tie	VERB
ct-9100	18	11	it	it	PRON
ct-9100	18	12	up	up	ADP
ct-9100	18	13	to	to	PART
ct-9100	18	14	keep	keep	VERB
ct-9100	18	15	it	it	PRON
ct-9100	18	16	out	out	ADP
ct-9100	18	17	of	of	ADP
ct-9100	18	18	the	the	DET
ct-9100	18	19	surgical	surgical	ADJ
ct-9100	18	20	field	field	NOUN
ct-9100	18	21	,	,	PUNCT
ct-9100	18	22	transrectal	transrectal	ADJ
ct-9100	18	23	palpation	palpation	NOUN
ct-9100	18	24	to	to	PART
ct-9100	18	25	manually	manually	ADV
ct-9100	18	26	evacuate	evacuate	VERB
ct-9100	18	27	the	the	DET
ct-9100	18	28	feces	fece	NOUN
ct-9100	18	29	,	,	PUNCT
ct-9100	18	30	scrubbing	scrub	VERB
ct-9100	18	31	the	the	DET
ct-9100	18	32	perineal	perineal	ADJ
ct-9100	18	33	area	area	NOUN
ct-9100	18	34	with	with	ADP
ct-9100	18	35	chlorhexidine	chlorhexidine	NOUN
ct-9100	18	36	(	(	PUNCT
ct-9100	18	37	vet	vet	NOUN
ct-9100	18	38	solutions	solution	NOUN
ct-9100	18	39	,	,	PUNCT
ct-9100	18	40	inc	inc	PROPN
ct-9100	18	41	.	.	PROPN
ct-9100	18	42	,	,	PUNCT
ct-9100	18	43	bedford	bedford	PROPN
ct-9100	18	44	,	,	PUNCT
ct-9100	18	45	tx	tx	PROPN
ct-9100	18	46	)	)	PUNCT
ct-9100	18	47	,	,	PUNCT
ct-9100	18	48	and	and	CCONJ
ct-9100	18	49	flushing	flush	VERB
ct-9100	18	50	the	the	DET
ct-9100	18	51	vagina	vagina	NOUN
ct-9100	18	52	with	with	ADP
ct-9100	18	53	very	very	ADV
ct-9100	18	54	dilute	dilute	ADJ
ct-9100	18	55	povidone	povidone	NOUN
ct-9100	18	56	iodine	iodine	NOUN
ct-9100	18	57	.	.	PUNCT
ct-9100	19	1	an	an	DET
ct-9100	19	2	incision	incision	NOUN
ct-9100	19	3	in	in	ADP
ct-9100	19	4	the	the	DET
ct-9100	19	5	anterior	anterior	ADJ
ct-9100	19	6	dorsolateral	dorsolateral	ADJ
ct-9100	19	7	wall	wall	NOUN
ct-9100	19	8	of	of	ADP
ct-9100	19	9	the	the	DET
ct-9100	19	10	vagina	vagina	NOUN
ct-9100	19	11	was	be	AUX
ct-9100	19	12	made	make	VERB
ct-9100	19	13	,	,	PUNCT
ct-9100	19	14	2	2	NUM
ct-9100	19	15	%	%	NOUN
ct-9100	19	16	lidocaine	lidocaine	NOUN
ct-9100	19	17	was	be	AUX
ct-9100	19	18	injected	inject	VERB
ct-9100	19	19	into	into	ADP
ct-9100	19	20	each	each	DET
ct-9100	19	21	ovarian	ovarian	ADJ
ct-9100	19	22	pedicle	pedicle	NOUN
ct-9100	19	23	for	for	ADP
ct-9100	19	24	local	local	ADJ
ct-9100	19	25	analgesia	analgesia	NOUN
ct-9100	19	26	,	,	PUNCT
ct-9100	19	27	and	and	CCONJ
ct-9100	19	28	the	the	DET
ct-9100	19	29	ovaries	ovary	NOUN
ct-9100	19	30	were	be	AUX
ct-9100	19	31	removed	remove	VERB
ct-9100	19	32	using	use	VERB
ct-9100	19	33	a	a	DET
ct-9100	19	34	chain	chain	NOUN
ct-9100	19	35	ecrasure	ecrasure	NOUN
ct-9100	19	36	.	.	PUNCT
ct-9100	20	1	the	the	DET
ct-9100	20	2	vaginal	vaginal	ADJ
ct-9100	20	3	incision	incision	NOUN
ct-9100	20	4	was	be	AUX
ct-9100	20	5	left	leave	VERB
ct-9100	20	6	to	to	PART
ct-9100	20	7	heal	heal	VERB
ct-9100	20	8	by	by	ADP
ct-9100	20	9	second	second	ADJ
ct-9100	20	10	intention	intention	NOUN
ct-9100	20	11	.	.	PUNCT
ct-9100	21	1	for	for	ADP
ct-9100	21	2	postsurgical	postsurgical	ADJ
ct-9100	21	3	analgesia	analgesia	NOUN
ct-9100	21	4	,	,	PUNCT
ct-9100	21	5	flunixin	flunixin	NOUN
ct-9100	21	6	meglumine	meglumine	NOUN
ct-9100	21	7	was	be	AUX
ct-9100	21	8	given	give	VERB
ct-9100	21	9	intravenously	intravenously	ADV
ct-9100	21	10	(	(	PUNCT
ct-9100	21	11	1.2	1.2	NUM
ct-9100	21	12	-1.5	-1.5	NUM
ct-9100	21	13	mg	mg	PROPN
ct-9100	21	14	/	/	SYM
ct-9100	21	15	kg	kg	PROPN
ct-9100	21	16	)	)	PUNCT
ct-9100	21	17	and	and	CCONJ
ct-9100	21	18	buprenorphine	buprenorphine	ADJ
ct-9100	21	19	hydrochloride	hydrochloride	NOUN
ct-9100	21	20	(	(	PUNCT
ct-9100	21	21	10	10	NUM
ct-9100	21	22	mg	mg	NOUN
ct-9100	21	23	)	)	PUNCT
ct-9100	21	24	was	be	AUX
ct-9100	21	25	given	give	VERB
ct-9100	21	26	subcutaneously	subcutaneously	ADV
ct-9100	21	27	.	.	PUNCT
ct-9100	22	1	additionally	additionally	ADV
ct-9100	22	2	,	,	PUNCT
ct-9100	22	3	each	each	DET
ct-9100	22	4	mare	mare	NOUN
ct-9100	22	5	received	receive	VERB
ct-9100	22	6	intramuscularly	intramuscularly	ADV
ct-9100	22	7	the	the	DET
ct-9100	22	8	long	long	ADV
ct-9100	22	9	-	-	PUNCT
ct-9100	22	10	acting	act	VERB
ct-9100	22	11	antibiotic	antibiotic	ADJ
ct-9100	22	12	ceftiofur	ceftiofur	NOUN
ct-9100	22	13	crystalline	crystalline	NOUN
ct-9100	22	14	-	-	PUNCT
ct-9100	22	15	free	free	ADJ
ct-9100	22	16	acid	acid	NOUN
ct-9100	22	17	(	(	PUNCT
ct-9100	22	18	6.6	6.6	NUM
ct-9100	22	19	mg	mg	PROPN
ct-9100	22	20	/	/	SYM
ct-9100	22	21	kg	kg	PROPN
ct-9100	22	22	)	)	PUNCT
ct-9100	22	23	.	.	PUNCT
ct-9100	23	1	ovaries	ovary	NOUN
ct-9100	23	2	were	be	AUX
ct-9100	23	3	hemi	hemi	NOUN
ct-9100	23	4	-	-	PUNCT
ct-9100	23	5	sectioned	section	VERB
ct-9100	23	6	,	,	PUNCT
ct-9100	23	7	fixed	fix	VERB
ct-9100	23	8	in	in	ADP
ct-9100	23	9	10	10	NUM
ct-9100	23	10	%	%	NOUN
ct-9100	23	11	neutral	neutral	ADJ
ct-9100	23	12	buffered	buffer	VERB
ct-9100	23	13	formalin	formalin	NOUN
ct-9100	23	14	,	,	PUNCT
ct-9100	23	15	and	and	CCONJ
ct-9100	23	16	paraffin	paraffin	NOUN
ct-9100	23	17	embedded	embed	VERB
ct-9100	23	18	.	.	PUNCT
ct-9100	24	1	sections	section	NOUN
ct-9100	24	2	were	be	AUX
ct-9100	24	3	serially	serially	ADV
ct-9100	24	4	sectioned	section	VERB
ct-9100	24	5	(	(	PUNCT
ct-9100	24	6	4	4	NUM
ct-9100	24	7	µm	µm	NOUN
ct-9100	24	8	)	)	PUNCT
ct-9100	24	9	on	on	ADP
ct-9100	24	10	charged	charge	VERB
ct-9100	24	11	slides	slide	NOUN
ct-9100	24	12	for	for	ADP
ct-9100	24	13	routine	routine	ADJ
ct-9100	24	14	immunohistochemistry	immunohistochemistry	NOUN
ct-9100	24	15	for	for	ADP
ct-9100	24	16	spaca3	spaca3	PROPN
ct-9100	24	17	.	.	PUNCT
ct-9100	25	1	slides	slide	NOUN
ct-9100	25	2	from	from	ADP
ct-9100	25	3	all	all	DET
ct-9100	25	4	mares	mare	NOUN
ct-9100	25	5	were	be	AUX
ct-9100	25	6	processed	process	VERB
ct-9100	25	7	in	in	ADP
ct-9100	25	8	1	1	NUM
ct-9100	25	9	experiment	experiment	NOUN
ct-9100	25	10	clinical	clinical	ADJ
ct-9100	25	11	theriogenology	theriogenology	NOUN
ct-9100	25	12	2021	2021	NUM
ct-9100	25	13	;	;	PUNCT
ct-9100	25	14	13	13	NUM
ct-9100	25	15	:	:	SYM
ct-9100	25	16	85	85	NUM
ct-9100	25	17	to	to	PART
ct-9100	25	18	avoid	avoid	VERB
ct-9100	25	19	variations	variation	NOUN
ct-9100	25	20	.	.	PUNCT
ct-9100	26	1	briefly	briefly	ADV
ct-9100	26	2	,	,	PUNCT
ct-9100	26	3	slides	slide	NOUN
ct-9100	26	4	were	be	AUX
ct-9100	26	5	deparaffinized	deparaffinize	VERB
ct-9100	26	6	in	in	ADP
ct-9100	26	7	xylene	xylene	NOUN
ct-9100	26	8	and	and	CCONJ
ct-9100	26	9	rehydrated	rehydrate	VERB
ct-9100	26	10	in	in	ADP
ct-9100	26	11	a	a	DET
ct-9100	26	12	graded	grade	VERB
ct-9100	26	13	ethanol	ethanol	NOUN
ct-9100	26	14	series	series	NOUN
ct-9100	26	15	(	(	PUNCT
ct-9100	26	16	100	100	NUM
ct-9100	26	17	,	,	PUNCT
ct-9100	26	18	75	75	NUM
ct-9100	26	19	,	,	PUNCT
ct-9100	26	20	and	and	CCONJ
ct-9100	26	21	50	50	NUM
ct-9100	26	22	%	%	NOUN
ct-9100	26	23	)	)	PUNCT
ct-9100	26	24	.	.	PUNCT
ct-9100	27	1	antigen	antigen	PROPN
ct-9100	27	2	retrieval	retrieval	NOUN
ct-9100	27	3	was	be	AUX
ct-9100	27	4	conducted	conduct	VERB
ct-9100	27	5	by	by	ADP
ct-9100	27	6	incubating	incubate	VERB
ct-9100	27	7	sections	section	NOUN
ct-9100	27	8	in	in	ADP
ct-9100	27	9	a	a	DET
ct-9100	27	10	citrate	citrate	NOUN
ct-9100	27	11	buffer	buffer	NOUN
ct-9100	27	12	,	,	PUNCT
ct-9100	27	13	target	target	NOUN
ct-9100	27	14	retrieval	retrieval	NOUN
ct-9100	27	15	solution	solution	NOUN
ct-9100	27	16	#	#	SYM
ct-9100	27	17	s1699	s1699	NOUN
ct-9100	27	18	(	(	PUNCT
ct-9100	27	19	dako	dako	PROPN
ct-9100	27	20	north	north	PROPN
ct-9100	27	21	america	america	PROPN
ct-9100	27	22	inc	inc	PROPN
ct-9100	27	23	.	.	PROPN
ct-9100	27	24	,	,	PUNCT
ct-9100	27	25	carpinteria	carpinteria	PROPN
ct-9100	27	26	,	,	PUNCT
ct-9100	27	27	ca	ca	NOUN
ct-9100	27	28	)	)	PUNCT
ct-9100	27	29	in	in	ADP
ct-9100	27	30	a	a	DET
ct-9100	27	31	microwave	microwave	NOUN
ct-9100	27	32	for	for	ADP
ct-9100	27	33	10	10	NUM
ct-9100	27	34	minutes	minute	NOUN
ct-9100	27	35	and	and	CCONJ
ct-9100	27	36	cooled	cool	VERB
ct-9100	27	37	for	for	ADP
ct-9100	27	38	20	20	NUM
ct-9100	27	39	minutes	minute	NOUN
ct-9100	27	40	.	.	PUNCT
ct-9100	28	1	slides	slide	NOUN
ct-9100	28	2	were	be	AUX
ct-9100	28	3	then	then	ADV
ct-9100	28	4	washed	wash	VERB
ct-9100	28	5	in	in	ADP
ct-9100	28	6	buffer	buffer	NOUN
ct-9100	28	7	(	(	PUNCT
ct-9100	28	8	dako	dako	PROPN
ct-9100	28	9	north	north	PROPN
ct-9100	28	10	america	america	PROPN
ct-9100	28	11	inc	inc	PROPN
ct-9100	28	12	.	.	PROPN
ct-9100	28	13	,	,	PUNCT
ct-9100	28	14	wash	wash	VERB
ct-9100	28	15	buffer	buffer	NOUN
ct-9100	28	16	#	#	NOUN
ct-9100	28	17	s3006	s3006	NOUN
ct-9100	28	18	)	)	PUNCT
ct-9100	28	19	and	and	CCONJ
ct-9100	28	20	tissue	tissue	NOUN
ct-9100	28	21	-	-	PUNCT
ct-9100	28	22	specific	specific	ADJ
ct-9100	28	23	endogenous	endogenous	ADJ
ct-9100	28	24	peroxidases	peroxidase	NOUN
ct-9100	28	25	were	be	AUX
ct-9100	28	26	inhibited	inhibit	VERB
ct-9100	28	27	by	by	ADP
ct-9100	28	28	incubating	incubate	VERB
ct-9100	28	29	slides	slide	NOUN
ct-9100	28	30	in	in	ADP
ct-9100	28	31	3	3	NUM
ct-9100	28	32	%	%	NOUN
ct-9100	28	33	hydrogen	hydrogen	NOUN
ct-9100	28	34	peroxide	peroxide	NOUN
ct-9100	28	35	.	.	PUNCT
ct-9100	29	1	slides	slide	NOUN
ct-9100	29	2	were	be	AUX
ct-9100	29	3	washed	wash	VERB
ct-9100	29	4	again	again	ADV
ct-9100	29	5	and	and	CCONJ
ct-9100	29	6	nonspecific	nonspecific	ADJ
ct-9100	29	7	binding	binding	NOUN
ct-9100	29	8	was	be	AUX
ct-9100	29	9	blocked	block	VERB
ct-9100	29	10	with	with	ADP
ct-9100	29	11	serum	serum	NOUN
ct-9100	29	12	-	-	PUNCT
ct-9100	29	13	free	free	ADJ
ct-9100	29	14	protein	protein	NOUN
ct-9100	29	15	(	(	PUNCT
ct-9100	29	16	protein	protein	NOUN
ct-9100	29	17	block	block	NOUN
ct-9100	29	18	serum	serum	NOUN
ct-9100	29	19	-	-	PUNCT
ct-9100	29	20	free	free	ADJ
ct-9100	29	21	ready	ready	ADJ
ct-9100	29	22	to	to	PART
ct-9100	29	23	use	use	VERB
ct-9100	29	24	,	,	PUNCT
ct-9100	29	25	#	#	NOUN
ct-9100	29	26	x0909	x0909	PROPN
ct-9100	29	27	,	,	PUNCT
ct-9100	29	28	dako	dako	PROPN
ct-9100	29	29	north	north	PROPN
ct-9100	29	30	america	america	PROPN
ct-9100	29	31	inc	inc	PROPN
ct-9100	29	32	.	.	PROPN
ct-9100	29	33	)	)	PUNCT
ct-9100	29	34	for	for	ADP
ct-9100	29	35	20	20	NUM
ct-9100	29	36	minutes	minute	NOUN
ct-9100	29	37	at	at	ADP
ct-9100	29	38	room	room	NOUN
ct-9100	29	39	temperature	temperature	NOUN
ct-9100	29	40	.	.	PUNCT
ct-9100	30	1	subsequently	subsequently	ADV
ct-9100	30	2	,	,	PUNCT
ct-9100	30	3	slides	slide	NOUN
ct-9100	30	4	were	be	AUX
ct-9100	30	5	tapped	tap	VERB
ct-9100	30	6	off	off	ADP
ct-9100	30	7	and	and	CCONJ
ct-9100	30	8	the	the	DET
ct-9100	30	9	primary	primary	ADJ
ct-9100	30	10	antibody	antibody	NOUN
ct-9100	30	11	(	(	PUNCT
ct-9100	30	12	#	#	SYM
ct-9100	30	13	21137	21137	NUM
ct-9100	30	14	-	-	PUNCT
ct-9100	30	15	1ap	1ap	ADJ
ct-9100	30	16	,	,	PUNCT
ct-9100	30	17	proteintech	proteintech	NOUN
ct-9100	30	18	,	,	PUNCT
ct-9100	30	19	rosemont	rosemont	NOUN
ct-9100	30	20	,	,	PUNCT
ct-9100	30	21	ca	ca	NOUN
ct-9100	30	22	)	)	PUNCT
ct-9100	30	23	diluted	dilute	VERB
ct-9100	30	24	1:200	1:200	NUM
ct-9100	30	25	(	(	PUNCT
ct-9100	30	26	background	background	NOUN
ct-9100	30	27	reducing	reduce	VERB
ct-9100	30	28	components	component	NOUN
ct-9100	30	29	,	,	PUNCT
ct-9100	30	30	#	#	SYM
ct-9100	30	31	s3022	s3022	NOUN
ct-9100	30	32	,	,	PUNCT
ct-9100	30	33	dako	dako	PROPN
ct-9100	30	34	north	north	PROPN
ct-9100	30	35	america	america	PROPN
ct-9100	30	36	inc	inc	PROPN
ct-9100	30	37	.	.	PROPN
ct-9100	30	38	)	)	PUNCT
ct-9100	30	39	was	be	AUX
ct-9100	30	40	applied	apply	VERB
ct-9100	30	41	to	to	ADP
ct-9100	30	42	sections	section	NOUN
ct-9100	30	43	for	for	ADP
ct-9100	30	44	105	105	NUM
ct-9100	30	45	minutes	minute	NOUN
ct-9100	30	46	at	at	ADP
ct-9100	30	47	room	room	NOUN
ct-9100	30	48	temperature	temperature	NOUN
ct-9100	30	49	.	.	PUNCT
ct-9100	31	1	a	a	DET
ct-9100	31	2	fusion	fusion	NOUN
ct-9100	31	3	protein	protein	NOUN
ct-9100	31	4	with	with	ADP
ct-9100	31	5	the	the	DET
ct-9100	31	6	following	follow	VERB
ct-9100	31	7	sequence	sequence	NOUN
ct-9100	31	8	was	be	AUX
ct-9100	31	9	used	use	VERB
ct-9100	31	10	to	to	PART
ct-9100	31	11	produce	produce	VERB
ct-9100	31	12	primary	primary	ADJ
ct-9100	31	13	antibodypyagvclayftsgfnaaaldyeadgstnngifqinsrrwcsnltpnvpnvcrmycsdllnpnlkdtvicamkitqepqglgyweawrhhcqgkdltewvdgcdf	antibodypyagvclayftsgfnaaaldyeadgstnngifqinsrrwcsnltpnvpnvcrmycsdllnpnlkdtvicamkitqepqglgyweawrhhcqgkdltewvdgcdf	NOUN
ct-9100	31	14	.	.	PUNCT
ct-9100	32	1	primary	primary	ADJ
ct-9100	32	2	antibody	antibody	NOUN
ct-9100	32	3	reactivity	reactivity	NOUN
ct-9100	32	4	was	be	AUX
ct-9100	32	5	confirmed	confirm	VERB
ct-9100	32	6	by	by	ADP
ct-9100	32	7	the	the	DET
ct-9100	32	8	manufacturer	manufacturer	NOUN
ct-9100	32	9	in	in	ADP
ct-9100	32	10	the	the	DET
ct-9100	32	11	mouse	mouse	NOUN
ct-9100	32	12	testis	testis	NOUN
ct-9100	32	13	and	and	CCONJ
ct-9100	32	14	was	be	AUX
ct-9100	32	15	also	also	ADV
ct-9100	32	16	confirmed	confirm	VERB
ct-9100	32	17	in	in	ADP
ct-9100	32	18	a	a	DET
ct-9100	32	19	preliminary	preliminary	ADJ
ct-9100	32	20	experiment	experiment	NOUN
ct-9100	32	21	in	in	ADP
ct-9100	32	22	the	the	DET
ct-9100	32	23	equine	equine	NOUN
ct-9100	32	24	testis	testis	NOUN
ct-9100	32	25	.	.	PUNCT
ct-9100	33	1	specificity	specificity	NOUN
ct-9100	33	2	of	of	ADP
ct-9100	33	3	immunostaining	immunostaining	NOUN
ct-9100	33	4	was	be	AUX
ct-9100	33	5	verified	verify	VERB
ct-9100	33	6	by	by	ADP
ct-9100	33	7	replacing	replace	VERB
ct-9100	33	8	the	the	DET
ct-9100	33	9	primary	primary	ADJ
ct-9100	33	10	antibody	antibody	NOUN
ct-9100	33	11	with	with	ADP
ct-9100	33	12	negative	negative	ADJ
ct-9100	33	13	control	control	NOUN
ct-9100	33	14	rabbit	rabbit	NOUN
ct-9100	33	15	serum	serum	NOUN
ct-9100	33	16	(	(	PUNCT
ct-9100	33	17	negative	negative	ADJ
ct-9100	33	18	control	control	NOUN
ct-9100	33	19	rabbit	rabbit	PROPN
ct-9100	33	20	igg	igg	PROPN
ct-9100	33	21	,	,	PUNCT
ct-9100	33	22	#	#	SYM
ct-9100	33	23	nc495h	nc495h	NOUN
ct-9100	33	24	,	,	PUNCT
ct-9100	33	25	biocare	biocare	PROPN
ct-9100	33	26	medical	medical	PROPN
ct-9100	33	27	,	,	PUNCT
ct-9100	33	28	pacheco	pacheco	PROPN
ct-9100	33	29	,	,	PUNCT
ct-9100	33	30	ca	ca	NOUN
ct-9100	33	31	)	)	PUNCT
ct-9100	33	32	.	.	PUNCT
ct-9100	34	1	slides	slide	NOUN
ct-9100	34	2	were	be	AUX
ct-9100	34	3	washed	wash	VERB
ct-9100	34	4	in	in	ADP
ct-9100	34	5	buffer	buffer	NOUN
ct-9100	34	6	and	and	CCONJ
ct-9100	34	7	a	a	DET
ct-9100	34	8	secondary	secondary	ADJ
ct-9100	34	9	antibody	antibody	NOUN
ct-9100	34	10	(	(	PUNCT
ct-9100	34	11	one	one	NUM
ct-9100	34	12	step	step	NOUN
ct-9100	34	13	horseradish	horseradish	NOUN
ct-9100	34	14	peroxidase	peroxidase	NOUN
ct-9100	34	15	-	-	PUNCT
ct-9100	34	16	conjugated	conjugate	VERB
ct-9100	34	17	polymer	polymer	NOUN
ct-9100	34	18	antirabbit	antirabbit	NOUN
ct-9100	34	19	igg	igg	PROPN
ct-9100	34	20	,	,	PUNCT
ct-9100	34	21	#	#	SYM
ct-9100	34	22	ih-8064	ih-8064	NOUN
ct-9100	34	23	-	-	PUNCT
ct-9100	34	24	osu-15	osu-15	PROPN
ct-9100	34	25	,	,	PUNCT
ct-9100	34	26	immuno	immuno	ADJ
ct-9100	34	27	bioscience	bioscience	PROPN
ct-9100	34	28	,	,	PUNCT
ct-9100	34	29	mukilteo	mukilteo	PROPN
ct-9100	34	30	,	,	PUNCT
ct-9100	34	31	wa	wa	NOUN
ct-9100	34	32	)	)	PUNCT
ct-9100	34	33	was	be	AUX
ct-9100	34	34	applied	apply	VERB
ct-9100	34	35	to	to	ADP
ct-9100	34	36	sections	section	NOUN
ct-9100	34	37	for	for	ADP
ct-9100	34	38	30	30	NUM
ct-9100	34	39	minutes	minute	NOUN
ct-9100	34	40	at	at	ADP
ct-9100	34	41	room	room	NOUN
ct-9100	34	42	temperature	temperature	NOUN
ct-9100	34	43	.	.	PUNCT
ct-9100	35	1	the	the	DET
ct-9100	35	2	secondary	secondary	ADJ
ct-9100	35	3	antibody	antibody	NOUN
ct-9100	35	4	was	be	AUX
ct-9100	35	5	washed	wash	VERB
ct-9100	35	6	off	off	ADP
ct-9100	35	7	and	and	CCONJ
ct-9100	35	8	novared	novare	VERB
ct-9100	35	9	(	(	PUNCT
ct-9100	35	10	#	#	ADJ
ct-9100	35	11	sk4800	sk4800	NOUN
ct-9100	35	12	,	,	PUNCT
ct-9100	35	13	vector	vector	NOUN
ct-9100	35	14	laboratories	laboratories	PROPN
ct-9100	35	15	inc	inc	PROPN
ct-9100	35	16	.	.	PROPN
ct-9100	35	17	,	,	PUNCT
ct-9100	35	18	burlingame	burlingame	PROPN
ct-9100	35	19	,	,	PUNCT
ct-9100	35	20	ca	ca	PROPN
ct-9100	35	21	)	)	PUNCT
ct-9100	35	22	was	be	AUX
ct-9100	35	23	applied	apply	VERB
ct-9100	35	24	to	to	ADP
ct-9100	35	25	sections	section	NOUN
ct-9100	35	26	for	for	ADP
ct-9100	35	27	5	5	NUM
ct-9100	35	28	minutes	minute	NOUN
ct-9100	35	29	at	at	ADP
ct-9100	35	30	room	room	NOUN
ct-9100	35	31	temperature	temperature	NOUN
ct-9100	35	32	.	.	PUNCT
ct-9100	36	1	sections	section	NOUN
ct-9100	36	2	were	be	AUX
ct-9100	36	3	then	then	ADV
ct-9100	36	4	counter	counter	NOUN
ct-9100	36	5	stained	stain	VERB
ct-9100	36	6	in	in	ADP
ct-9100	36	7	hematoxylin	hematoxylin	PROPN
ct-9100	36	8	,	,	PUNCT
ct-9100	36	9	dehydrated	dehydrate	VERB
ct-9100	36	10	in	in	ADP
ct-9100	36	11	a	a	DET
ct-9100	36	12	graded	grade	VERB
ct-9100	36	13	series	series	NOUN
ct-9100	36	14	of	of	ADP
ct-9100	36	15	ethanol	ethanol	NOUN
ct-9100	36	16	(	(	PUNCT
ct-9100	36	17	50	50	NUM
ct-9100	36	18	,	,	PUNCT
ct-9100	36	19	75	75	NUM
ct-9100	36	20	,	,	PUNCT
ct-9100	36	21	and	and	CCONJ
ct-9100	36	22	100	100	NUM
ct-9100	36	23	%	%	NOUN
ct-9100	36	24	)	)	PUNCT
ct-9100	36	25	,	,	PUNCT
ct-9100	36	26	moved	move	VERB
ct-9100	36	27	through	through	ADP
ct-9100	36	28	a	a	DET
ct-9100	36	29	series	series	NOUN
ct-9100	36	30	of	of	ADP
ct-9100	36	31	3	3	NUM
ct-9100	36	32	xylene	xylene	NOUN
ct-9100	36	33	baths	bath	NOUN
ct-9100	36	34	and	and	CCONJ
ct-9100	36	35	cover	cover	NOUN
ct-9100	36	36	slipped	slip	VERB
ct-9100	36	37	.	.	PUNCT
ct-9100	37	1	slides	slide	NOUN
ct-9100	37	2	were	be	AUX
ct-9100	37	3	evaluated	evaluate	VERB
ct-9100	37	4	by	by	ADP
ct-9100	37	5	a	a	DET
ct-9100	37	6	single	single	ADJ
ct-9100	37	7	observer	observer	NOUN
ct-9100	37	8	at	at	ADP
ct-9100	37	9	400	400	NUM
ct-9100	37	10	x	x	NOUN
ct-9100	37	11	magnification	magnification	NOUN
ct-9100	37	12	with	with	ADP
ct-9100	37	13	a	a	DET
ct-9100	37	14	bright	bright	ADJ
ct-9100	37	15	-	-	PUNCT
ct-9100	37	16	field	field	NOUN
ct-9100	37	17	microscope	microscope	NOUN
ct-9100	37	18	(	(	PUNCT
ct-9100	37	19	leica	leica	PROPN
ct-9100	37	20	dm4000b	dm4000b	PROPN
ct-9100	37	21	,	,	PUNCT
ct-9100	37	22	leica	leica	PROPN
ct-9100	37	23	microsystems	microsystems	PROPN
ct-9100	37	24	inc	inc	PROPN
ct-9100	37	25	.	.	PROPN
ct-9100	37	26	buffalo	buffalo	PROPN
ct-9100	37	27	grove	grove	PROPN
ct-9100	37	28	,	,	PUNCT
ct-9100	37	29	il	il	PROPN
ct-9100	37	30	)	)	PUNCT
ct-9100	37	31	.	.	PUNCT
ct-9100	38	1	representative	representative	ADJ
ct-9100	38	2	images	image	NOUN
ct-9100	38	3	from	from	ADP
ct-9100	38	4	each	each	DET
ct-9100	38	5	ovary	ovary	NOUN
ct-9100	38	6	were	be	AUX
ct-9100	38	7	electronically	electronically	ADV
ct-9100	38	8	captured	capture	VERB
ct-9100	38	9	using	use	VERB
ct-9100	38	10	a	a	DET
ct-9100	38	11	digital	digital	ADJ
ct-9100	38	12	camera	camera	NOUN
ct-9100	38	13	(	(	PUNCT
ct-9100	38	14	qimaging	qimage	VERB
ct-9100	38	15	,	,	PUNCT
ct-9100	38	16	qicam	qicam	NOUN
ct-9100	38	17	12	12	NUM
ct-9100	38	18	-	-	PUNCT
ct-9100	38	19	bit	bit	NOUN
ct-9100	38	20	,	,	PUNCT
ct-9100	38	21	#	#	PUNCT
ct-9100	38	22	qic	qic	VERB
ct-9100	38	23	-	-	PUNCT
ct-9100	38	24	f	f	NOUN
ct-9100	38	25	-	-	PUNCT
ct-9100	38	26	m-12	m-12	NOUN
ct-9100	38	27	-	-	PUNCT
ct-9100	38	28	c	c	NOUN
ct-9100	38	29	,	,	PUNCT
ct-9100	38	30	surrey	surrey	PROPN
ct-9100	38	31	,	,	PUNCT
ct-9100	38	32	bc	bc	PROPN
ct-9100	38	33	,	,	PUNCT
ct-9100	38	34	canada	canada	PROPN
ct-9100	38	35	)	)	PUNCT
ct-9100	38	36	and	and	CCONJ
ct-9100	38	37	image	image	NOUN
ct-9100	38	38	capture	capture	NOUN
ct-9100	38	39	software	software	NOUN
ct-9100	38	40	(	(	PUNCT
ct-9100	38	41	qcapturepro	qcapturepro	ADJ
ct-9100	38	42	,	,	PUNCT
ct-9100	38	43	surrey	surrey	PROPN
ct-9100	38	44	)	)	PUNCT
ct-9100	38	45	.	.	PUNCT
ct-9100	39	1	the	the	DET
ct-9100	39	2	cellular	cellular	ADJ
ct-9100	39	3	expression	expression	NOUN
ct-9100	39	4	on	on	ADP
ct-9100	39	5	spaca3	spaca3	PROPN
ct-9100	39	6	was	be	AUX
ct-9100	39	7	recorded	record	VERB
ct-9100	39	8	for	for	ADP
ct-9100	39	9	primordial	primordial	ADJ
ct-9100	39	10	,	,	PUNCT
ct-9100	39	11	primary	primary	ADJ
ct-9100	39	12	,	,	PUNCT
ct-9100	39	13	secondary	secondary	ADJ
ct-9100	39	14	,	,	PUNCT
ct-9100	39	15	and	and	CCONJ
ct-9100	39	16	tertiary	tertiary	ADJ
ct-9100	39	17	follicles	follicle	NOUN
ct-9100	39	18	.	.	PUNCT
ct-9100	40	1	results	result	NOUN
ct-9100	40	2	spaca3	spaca3	PROPN
ct-9100	40	3	was	be	AUX
ct-9100	40	4	localized	localize	VERB
ct-9100	40	5	(	(	PUNCT
ct-9100	40	6	figure	figure	NOUN
ct-9100	40	7	1	1	NUM
ct-9100	40	8	)	)	PUNCT
ct-9100	40	9	to	to	ADP
ct-9100	40	10	the	the	DET
ct-9100	40	11	sperm	sperm	NOUN
ct-9100	40	12	acrosomes	acrosome	NOUN
ct-9100	40	13	in	in	ADP
ct-9100	40	14	the	the	DET
ct-9100	40	15	equine	equine	NOUN
ct-9100	40	16	testis	testis	NOUN
ct-9100	40	17	,	,	PUNCT
ct-9100	40	18	and	and	CCONJ
ct-9100	40	19	to	to	ADP
ct-9100	40	20	the	the	DET
ct-9100	40	21	pregranulosa	pregranulosa	NOUN
ct-9100	40	22	cells	cell	NOUN
ct-9100	40	23	of	of	ADP
ct-9100	40	24	primordial	primordial	ADJ
ct-9100	40	25	follicles	follicle	NOUN
ct-9100	40	26	(	(	PUNCT
ct-9100	40	27	figure	figure	NOUN
ct-9100	40	28	2	2	NUM
ct-9100	40	29	)	)	PUNCT
ct-9100	40	30	,	,	PUNCT
ct-9100	40	31	and	and	CCONJ
ct-9100	40	32	to	to	ADP
ct-9100	40	33	the	the	DET
ct-9100	40	34	granulosa	granulosa	NOUN
ct-9100	40	35	cells	cell	NOUN
ct-9100	40	36	of	of	ADP
ct-9100	40	37	primary	primary	ADJ
ct-9100	40	38	(	(	PUNCT
ct-9100	40	39	figure	figure	NOUN
ct-9100	40	40	2a	2a	NUM
ct-9100	40	41	)	)	PUNCT
ct-9100	40	42	,	,	PUNCT
ct-9100	40	43	secondary	secondary	ADJ
ct-9100	40	44	(	(	PUNCT
ct-9100	40	45	figure	figure	NOUN
ct-9100	40	46	2b	2b	NOUN
ct-9100	40	47	)	)	PUNCT
ct-9100	40	48	and	and	CCONJ
ct-9100	40	49	tertiary	tertiary	ADJ
ct-9100	40	50	follicles	follicle	NOUN
ct-9100	40	51	(	(	PUNCT
ct-9100	40	52	figure	figure	NOUN
ct-9100	40	53	2c	2c	NUM
ct-9100	40	54	)	)	PUNCT
ct-9100	40	55	of	of	ADP
ct-9100	40	56	all	all	DET
ct-9100	40	57	equine	equine	NOUN
ct-9100	40	58	ovaries	ovary	NOUN
ct-9100	40	59	examined	examine	VERB
ct-9100	40	60	.	.	PUNCT
ct-9100	41	1	there	there	PRON
ct-9100	41	2	was	be	VERB
ct-9100	41	3	no	no	DET
ct-9100	41	4	positive	positive	ADJ
ct-9100	41	5	staining	staining	NOUN
ct-9100	41	6	in	in	ADP
ct-9100	41	7	any	any	DET
ct-9100	41	8	other	other	ADJ
ct-9100	41	9	cell	cell	NOUN
ct-9100	41	10	type	type	NOUN
ct-9100	41	11	.	.	PUNCT
ct-9100	42	1	in	in	ADP
ct-9100	42	2	addition	addition	NOUN
ct-9100	42	3	,	,	PUNCT
ct-9100	42	4	slides	slide	NOUN
ct-9100	42	5	stained	stain	VERB
ct-9100	42	6	with	with	ADP
ct-9100	42	7	the	the	DET
ct-9100	42	8	universal	universal	ADJ
ct-9100	42	9	negative	negative	NOUN
ct-9100	42	10	did	do	AUX
ct-9100	42	11	not	not	PART
ct-9100	42	12	have	have	VERB
ct-9100	42	13	any	any	DET
ct-9100	42	14	positive	positive	ADJ
ct-9100	42	15	staining	stain	VERB
ct-9100	42	16	(	(	PUNCT
ct-9100	42	17	figures	figure	NOUN
ct-9100	42	18	1	1	NUM
ct-9100	42	19	and	and	CCONJ
ct-9100	42	20	2	2	NUM
ct-9100	42	21	)	)	PUNCT
ct-9100	42	22	.	.	PUNCT
ct-9100	43	1	figure	figure	NOUN
ct-9100	43	2	1	1	NUM
ct-9100	43	3	.	.	PUNCT
ct-9100	43	4	spaca3	spaca3	X
ct-9100	44	1	immunoexpression	immunoexpression	NOUN
ct-9100	44	2	(	(	PUNCT
ct-9100	44	3	arrow	arrow	NOUN
ct-9100	44	4	)	)	PUNCT
ct-9100	44	5	in	in	ADP
ct-9100	44	6	the	the	DET
ct-9100	44	7	equine	equine	NOUN
ct-9100	44	8	testis	testis	NOUN
ct-9100	44	9	is	be	AUX
ct-9100	44	10	localized	localize	VERB
ct-9100	44	11	to	to	ADP
ct-9100	44	12	the	the	DET
ct-9100	44	13	sperm	sperm	NOUN
ct-9100	44	14	acrosome	acrosome	NOUN
ct-9100	44	15	(	(	PUNCT
ct-9100	44	16	scale	scale	NOUN
ct-9100	44	17	bar	bar	NOUN
ct-9100	44	18	=	=	PUNCT
ct-9100	44	19	20	20	NUM
ct-9100	44	20	µm	µm	NOUN
ct-9100	44	21	)	)	PUNCT
ct-9100	44	22	.	.	PUNCT
ct-9100	45	1	negative	negative	ADJ
ct-9100	45	2	control	control	NOUN
ct-9100	45	3	in	in	ADP
ct-9100	45	4	upper	upper	ADJ
ct-9100	45	5	left	left	ADJ
ct-9100	45	6	inset	inset	NOUN
ct-9100	45	7	.	.	PUNCT
ct-9100	46	1	figure	figure	NOUN
ct-9100	46	2	2a	2a	NUM
ct-9100	46	3	.	.	PUNCT
ct-9100	47	1	spaca3	spaca3	X
ct-9100	47	2	immunoexpression	immunoexpression	NOUN
ct-9100	47	3	in	in	ADP
ct-9100	47	4	equine	equine	NOUN
ct-9100	47	5	ovarian	ovarian	ADJ
ct-9100	47	6	follicles	follicle	NOUN
ct-9100	47	7	.	.	PUNCT
ct-9100	48	1	a	a	DET
ct-9100	48	2	:	:	PUNCT
ct-9100	48	3	pregranulosa	pregranulosa	NOUN
ct-9100	48	4	cells	cell	NOUN
ct-9100	48	5	in	in	ADP
ct-9100	48	6	primordial	primordial	ADJ
ct-9100	48	7	follicles	follicle	NOUN
ct-9100	48	8	(	(	PUNCT
ct-9100	48	9	arrow	arrow	NOUN
ct-9100	48	10	)	)	PUNCT
ct-9100	48	11	and	and	CCONJ
ct-9100	48	12	granulosa	granulosa	NOUN
ct-9100	48	13	cells	cell	NOUN
ct-9100	48	14	in	in	ADP
ct-9100	48	15	primary	primary	ADJ
ct-9100	48	16	follicles	follicle	NOUN
ct-9100	48	17	(	(	PUNCT
ct-9100	48	18	arrowhead	arrowhead	NOUN
ct-9100	48	19	)	)	PUNCT
ct-9100	48	20	express	express	ADJ
ct-9100	48	21	spaca3	spaca3	NOUN
ct-9100	49	1	(	(	PUNCT
ct-9100	49	2	scale	scale	NOUN
ct-9100	49	3	bar	bar	NOUN
ct-9100	49	4	=	=	PUNCT
ct-9100	49	5	25	25	NUM
ct-9100	49	6	µm	µm	NOUN
ct-9100	49	7	)	)	PUNCT
ct-9100	49	8	.	.	PUNCT
ct-9100	50	1	figure	figure	NOUN
ct-9100	50	2	2b	2b	NUM
ct-9100	50	3	.	.	PUNCT
ct-9100	51	1	spaca3	spaca3	X
ct-9100	51	2	immunoexpression	immunoexpression	NOUN
ct-9100	51	3	in	in	ADP
ct-9100	51	4	equine	equine	NOUN
ct-9100	51	5	ovarian	ovarian	ADJ
ct-9100	51	6	follicles	follicle	NOUN
ct-9100	51	7	.	.	PUNCT
ct-9100	52	1	granulosa	granulosa	NOUN
ct-9100	52	2	cells	cell	NOUN
ct-9100	52	3	in	in	ADP
ct-9100	52	4	secondary	secondary	ADJ
ct-9100	52	5	follicles	follicle	NOUN
ct-9100	52	6	(	(	PUNCT
ct-9100	52	7	arrow	arrow	NOUN
ct-9100	52	8	)	)	PUNCT
ct-9100	52	9	express	express	VERB
ct-9100	52	10	spaca3	spaca3	NOUN
ct-9100	53	1	(	(	PUNCT
ct-9100	53	2	scale	scale	NOUN
ct-9100	53	3	bar	bar	NOUN
ct-9100	53	4	=	=	NOUN
ct-9100	53	5	100	100	NUM
ct-9100	53	6	µm	µm	NOUN
ct-9100	53	7	)	)	PUNCT
ct-9100	53	8	.	.	PUNCT
ct-9100	54	1	clinical	clinical	ADJ
ct-9100	54	2	theriogenology	theriogenology	NOUN
ct-9100	54	3	2021	2021	NUM
ct-9100	54	4	;	;	PUNCT
ct-9100	54	5	13	13	NUM
ct-9100	54	6	:	:	SYM
ct-9100	54	7	86	86	NUM
ct-9100	54	8	figure	figure	NOUN
ct-9100	54	9	2c	2c	NUM
ct-9100	54	10	.	.	PUNCT
ct-9100	54	11	spaca3	spaca3	X
ct-9100	55	1	immunoexpression	immunoexpression	NOUN
ct-9100	55	2	in	in	ADP
ct-9100	55	3	equine	equine	NOUN
ct-9100	55	4	ovarian	ovarian	ADJ
ct-9100	55	5	follicles	follicle	NOUN
ct-9100	55	6	.	.	PUNCT
ct-9100	56	1	granulosa	granulosa	NOUN
ct-9100	56	2	cells	cell	NOUN
ct-9100	56	3	in	in	ADP
ct-9100	56	4	tertiary	tertiary	ADJ
ct-9100	56	5	follicles	follicle	NOUN
ct-9100	56	6	(	(	PUNCT
ct-9100	56	7	arrow	arrow	NOUN
ct-9100	56	8	)	)	PUNCT
ct-9100	56	9	express	express	VERB
ct-9100	56	10	spaca3	spaca3	NOUN
ct-9100	57	1	(	(	PUNCT
ct-9100	57	2	scale	scale	NOUN
ct-9100	57	3	bar	bar	NOUN
ct-9100	57	4	=	=	PUNCT
ct-9100	57	5	350	350	NUM
ct-9100	57	6	µm	µm	NOUN
ct-9100	57	7	)	)	PUNCT
ct-9100	57	8	.	.	PUNCT
ct-9100	58	1	negative	negative	ADJ
ct-9100	58	2	controls	control	NOUN
ct-9100	58	3	in	in	ADP
ct-9100	58	4	upper	upper	ADJ
ct-9100	58	5	left	leave	VERB
ct-9100	58	6	insets	inset	NOUN
ct-9100	58	7	discussion	discussion	NOUN
ct-9100	58	8	as	as	ADP
ct-9100	58	9	in	in	ADP
ct-9100	58	10	cattle	cattle	NOUN
ct-9100	58	11	,	,	PUNCT
ct-9100	58	12	dogs	dog	NOUN
ct-9100	58	13	,	,	PUNCT
ct-9100	58	14	and	and	CCONJ
ct-9100	58	15	cats	cat	NOUN
ct-9100	58	16	,	,	PUNCT
ct-9100	58	17	spaca3	spaca3	PROPN
ct-9100	58	18	was	be	AUX
ct-9100	58	19	present	present	ADJ
ct-9100	58	20	in	in	ADP
ct-9100	58	21	equine	equine	NOUN
ct-9100	58	22	pregranulosa	pregranulosa	NOUN
ct-9100	58	23	cells	cell	NOUN
ct-9100	58	24	of	of	ADP
ct-9100	58	25	primordial	primordial	ADJ
ct-9100	58	26	follicles	follicle	NOUN
ct-9100	58	27	and	and	CCONJ
ct-9100	58	28	granulosa	granulosa	NOUN
ct-9100	58	29	cells	cell	NOUN
ct-9100	58	30	of	of	ADP
ct-9100	58	31	primary	primary	ADJ
ct-9100	58	32	,	,	PUNCT
ct-9100	58	33	secondary	secondary	ADJ
ct-9100	58	34	,	,	PUNCT
ct-9100	58	35	and	and	CCONJ
ct-9100	58	36	tertiary	tertiary	ADJ
ct-9100	58	37	follicles	follicle	NOUN
ct-9100	58	38	.	.	PUNCT
ct-9100	59	1	however	however	ADV
ct-9100	59	2	,	,	PUNCT
ct-9100	59	3	unlike	unlike	ADP
ct-9100	59	4	in	in	ADP
ct-9100	59	5	dogs	dog	NOUN
ct-9100	59	6	and	and	CCONJ
ct-9100	59	7	cats	cat	NOUN
ct-9100	59	8	,	,	PUNCT
ct-9100	59	9	the	the	DET
ct-9100	59	10	equine	equine	NOUN
ct-9100	59	11	oolemma	oolemma	NOUN
ct-9100	59	12	did	do	AUX
ct-9100	59	13	not	not	PART
ct-9100	59	14	appear	appear	VERB
ct-9100	59	15	to	to	PART
ct-9100	59	16	express	express	VERB
ct-9100	59	17	spaca3	spaca3	NOUN
ct-9100	59	18	.	.	PUNCT
ct-9100	60	1	the	the	DET
ct-9100	60	2	equine	equine	NOUN
ct-9100	60	3	oolemma	oolemma	PROPN
ct-9100	60	4	appears	appear	VERB
ct-9100	60	5	to	to	PART
ct-9100	60	6	have	have	VERB
ct-9100	60	7	a	a	DET
ct-9100	60	8	lower	low	ADJ
ct-9100	60	9	capacity	capacity	NOUN
ct-9100	60	10	for	for	ADP
ct-9100	60	11	spermatozoa	spermatozoa	NOUN
ct-9100	60	12	-	-	PUNCT
ct-9100	60	13	oolemma	oolemma	NOUN
ct-9100	60	14	fusion	fusion	NOUN
ct-9100	60	15	and	and	CCONJ
ct-9100	60	16	penetration	penetration	NOUN
ct-9100	60	17	rates	rate	NOUN
ct-9100	60	18	compared	compare	VERB
ct-9100	60	19	to	to	ADP
ct-9100	60	20	other	other	ADJ
ct-9100	60	21	species	specie	NOUN
ct-9100	60	22	that	that	PRON
ct-9100	60	23	could	could	AUX
ct-9100	60	24	explain	explain	VERB
ct-9100	60	25	the	the	DET
ct-9100	60	26	lack	lack	NOUN
ct-9100	60	27	of	of	ADP
ct-9100	60	28	spaca3	spaca3	NOUN
ct-9100	60	29	expression	expression	NOUN
ct-9100	60	30	in	in	ADP
ct-9100	60	31	horses.11	horses.11	ADJ
ct-9100	60	32	in	in	ADP
ct-9100	60	33	the	the	DET
ct-9100	60	34	us	us	PROPN
ct-9100	60	35	,	,	PUNCT
ct-9100	60	36	the	the	DET
ct-9100	60	37	feral	feral	ADJ
ct-9100	60	38	horse	horse	NOUN
ct-9100	60	39	population	population	NOUN
ct-9100	60	40	has	have	AUX
ct-9100	60	41	drastically	drastically	ADV
ct-9100	60	42	exceeded	exceed	VERB
ct-9100	60	43	the	the	DET
ct-9100	60	44	carrying	carrying	NOUN
ct-9100	60	45	capacity	capacity	NOUN
ct-9100	60	46	of	of	ADP
ct-9100	60	47	the	the	DET
ct-9100	60	48	public	public	ADJ
ct-9100	60	49	lands	land	NOUN
ct-9100	60	50	where	where	SCONJ
ct-9100	60	51	they	they	PRON
ct-9100	60	52	are	be	AUX
ct-9100	60	53	managed.12	managed.12	ADJ
ct-9100	60	54	immunization	immunization	NOUN
ct-9100	60	55	of	of	ADP
ct-9100	60	56	horses	horse	NOUN
ct-9100	60	57	against	against	ADP
ct-9100	60	58	porcine	porcine	NOUN
ct-9100	60	59	zona	zona	PROPN
ct-9100	60	60	pellucida	pellucida	PROPN
ct-9100	60	61	(	(	PUNCT
ct-9100	60	62	pzp	pzp	NOUN
ct-9100	60	63	)	)	PUNCT
ct-9100	60	64	results	result	NOUN
ct-9100	60	65	in	in	ADP
ct-9100	60	66	an	an	DET
ct-9100	60	67	antibody	antibody	NOUN
ct-9100	60	68	-	-	PUNCT
ct-9100	60	69	based	base	VERB
ct-9100	60	70	block	block	NOUN
ct-9100	60	71	to	to	ADP
ct-9100	60	72	sperm	sperm	NOUN
ct-9100	60	73	-	-	PUNCT
ct-9100	60	74	oocyte	oocyte	NOUN
ct-9100	60	75	binding	binding	ADJ
ct-9100	60	76	and	and	CCONJ
ct-9100	60	77	subsequent	subsequent	ADJ
ct-9100	60	78	fertilization	fertilization	NOUN
ct-9100	60	79	,	,	PUNCT
ct-9100	60	80	with	with	ADP
ct-9100	60	81	a	a	DET
ct-9100	60	82	variable	variable	ADJ
ct-9100	60	83	efficacy	efficacy	NOUN
ct-9100	60	84	of	of	ADP
ct-9100	60	85	immunocontraception.13	immunocontraception.13	PROPN
ct-9100	60	86	-	-	PUNCT
ct-9100	60	87	17	17	NUM
ct-9100	60	88	current	current	ADJ
ct-9100	60	89	pzp	pzp	NOUN
ct-9100	60	90	vaccines	vaccine	NOUN
ct-9100	60	91	have	have	VERB
ct-9100	60	92	a	a	DET
ct-9100	60	93	duration	duration	NOUN
ct-9100	60	94	of	of	ADP
ct-9100	60	95	efficacy	efficacy	NOUN
ct-9100	60	96	for	for	ADP
ct-9100	60	97	up	up	ADP
ct-9100	60	98	to	to	PART
ct-9100	60	99	2	2	NUM
ct-9100	60	100	years	year	NOUN
ct-9100	60	101	and	and	CCONJ
ct-9100	60	102	need	need	VERB
ct-9100	60	103	to	to	PART
ct-9100	60	104	be	be	AUX
ct-9100	60	105	given	give	VERB
ct-9100	60	106	again	again	ADV
ct-9100	60	107	to	to	PART
ct-9100	60	108	provide	provide	VERB
ct-9100	60	109	continued	continue	VERB
ct-9100	60	110	immunocontraception.14,17	immunocontraception.14,17	NOUN
ct-9100	60	111	-	-	PUNCT
ct-9100	60	112	18	18	NUM
ct-9100	60	113	because	because	SCONJ
ct-9100	60	114	oocytes	oocyte	NOUN
ct-9100	60	115	in	in	ADP
ct-9100	60	116	the	the	DET
ct-9100	60	117	primordial	primordial	ADJ
ct-9100	60	118	follicles	follicle	NOUN
ct-9100	60	119	lack	lack	VERB
ct-9100	60	120	a	a	DET
ct-9100	60	121	zona	zona	PROPN
ct-9100	60	122	pellucida	pellucida	PROPN
ct-9100	60	123	,	,	PUNCT
ct-9100	60	124	the	the	DET
ct-9100	60	125	ovarian	ovarian	ADJ
ct-9100	60	126	reserve	reserve	NOUN
ct-9100	60	127	follicles	follicle	NOUN
ct-9100	60	128	remains	remain	VERB
ct-9100	60	129	unaffected	unaffected	ADJ
ct-9100	60	130	by	by	ADP
ct-9100	60	131	pzp	pzp	NOUN
ct-9100	60	132	vaccines	vaccine	NOUN
ct-9100	60	133	.	.	PUNCT
ct-9100	61	1	gonadotropin	gonadotropin	NOUN
ct-9100	61	2	releasing	release	VERB
ct-9100	61	3	hormone	hormone	NOUN
ct-9100	61	4	(	(	PUNCT
ct-9100	61	5	gnrh	gnrh	NOUN
ct-9100	61	6	)	)	PUNCT
ct-9100	61	7	vaccines	vaccine	NOUN
ct-9100	61	8	have	have	AUX
ct-9100	61	9	been	be	AUX
ct-9100	61	10	used	use	VERB
ct-9100	61	11	in	in	ADP
ct-9100	61	12	horses	horse	NOUN
ct-9100	61	13	.	.	PUNCT
ct-9100	62	1	vaccines	vaccine	NOUN
ct-9100	62	2	against	against	ADP
ct-9100	62	3	gnrh	gnrh	NOUN
ct-9100	62	4	stimulate	stimulate	VERB
ct-9100	62	5	antignrh	antignrh	NOUN
ct-9100	62	6	antibody	antibody	NOUN
ct-9100	62	7	production	production	NOUN
ct-9100	62	8	that	that	PRON
ct-9100	62	9	inhibit	inhibit	VERB
ct-9100	62	10	the	the	DET
ct-9100	62	11	release	release	NOUN
ct-9100	62	12	of	of	ADP
ct-9100	62	13	fsh	fsh	NOUN
ct-9100	62	14	and	and	CCONJ
ct-9100	62	15	lh	lh	PROPN
ct-9100	62	16	and	and	CCONJ
ct-9100	62	17	therefore	therefore	ADV
ct-9100	62	18	prevent	prevent	VERB
ct-9100	62	19	estrous	estrous	ADJ
ct-9100	62	20	cyclicity.19	cyclicity.19	NOUN
ct-9100	62	21	similar	similar	ADJ
ct-9100	62	22	to	to	ADP
ct-9100	62	23	pzp	pzp	NOUN
ct-9100	62	24	,	,	PUNCT
ct-9100	62	25	as	as	SCONJ
ct-9100	62	26	the	the	DET
ct-9100	62	27	gnrh	gnrh	NOUN
ct-9100	62	28	antibody	antibody	NOUN
ct-9100	62	29	titers	titer	NOUN
ct-9100	62	30	decline	decline	VERB
ct-9100	62	31	over	over	ADP
ct-9100	62	32	time	time	NOUN
ct-9100	62	33	,	,	PUNCT
ct-9100	62	34	normal	normal	ADJ
ct-9100	62	35	estrous	estrous	ADJ
ct-9100	62	36	cyclicity	cyclicity	NOUN
ct-9100	62	37	returns	return	NOUN
ct-9100	62	38	in	in	ADP
ct-9100	62	39	mares	mare	NOUN
ct-9100	62	40	.	.	PUNCT
ct-9100	63	1	this	this	DET
ct-9100	63	2	work	work	NOUN
ct-9100	63	3	has	have	AUX
ct-9100	63	4	provided	provide	VERB
ct-9100	63	5	a	a	DET
ct-9100	63	6	foundation	foundation	NOUN
ct-9100	63	7	for	for	ADP
ct-9100	63	8	future	future	ADJ
ct-9100	63	9	research	research	NOUN
ct-9100	63	10	in	in	ADP
ct-9100	63	11	the	the	DET
ct-9100	63	12	development	development	NOUN
ct-9100	63	13	of	of	ADP
ct-9100	63	14	a	a	DET
ct-9100	63	15	permanent	permanent	ADJ
ct-9100	63	16	immunosterilant	immunosterilant	NOUN
ct-9100	63	17	for	for	ADP
ct-9100	63	18	the	the	DET
ct-9100	63	19	management	management	NOUN
ct-9100	63	20	of	of	ADP
ct-9100	63	21	feral	feral	ADJ
ct-9100	63	22	horse	horse	NOUN
ct-9100	63	23	herds	herd	NOUN
ct-9100	63	24	.	.	PUNCT
ct-9100	64	1	a	a	DET
ct-9100	64	2	permanent	permanent	ADJ
ct-9100	64	3	nonsurgical	nonsurgical	ADJ
ct-9100	64	4	sterilization	sterilization	NOUN
ct-9100	64	5	method	method	NOUN
ct-9100	64	6	for	for	ADP
ct-9100	64	7	feral	feral	ADJ
ct-9100	64	8	horses	horse	NOUN
ct-9100	64	9	is	be	AUX
ct-9100	64	10	highly	highly	ADV
ct-9100	64	11	desired	desire	VERB
ct-9100	64	12	by	by	ADP
ct-9100	64	13	public	public	ADJ
ct-9100	64	14	land	land	NOUN
ct-9100	64	15	managers	manager	NOUN
ct-9100	64	16	.	.	PUNCT
ct-9100	65	1	an	an	DET
ct-9100	65	2	ideal	ideal	ADJ
ct-9100	65	3	immunocontraceptive	immunocontraceptive	NOUN
ct-9100	65	4	for	for	ADP
ct-9100	65	5	feral	feral	ADJ
ct-9100	65	6	horses	horse	NOUN
ct-9100	65	7	would	would	AUX
ct-9100	65	8	target	target	VERB
ct-9100	65	9	primordial	primordial	ADJ
ct-9100	65	10	follicles	follicle	NOUN
ct-9100	65	11	and	and	CCONJ
ct-9100	65	12	developing	develop	VERB
ct-9100	65	13	follicles	follicle	NOUN
ct-9100	65	14	.	.	PUNCT
ct-9100	66	1	spaca3	spaca3	PROPN
ct-9100	66	2	is	be	AUX
ct-9100	66	3	strongly	strongly	ADV
ct-9100	66	4	expressed	express	VERB
ct-9100	66	5	in	in	ADP
ct-9100	66	6	the	the	DET
ct-9100	66	7	pregranulosa	pregranulosa	NOUN
ct-9100	66	8	cells	cell	NOUN
ct-9100	66	9	of	of	ADP
ct-9100	66	10	equine	equine	NOUN
ct-9100	66	11	primordial	primordial	ADJ
ct-9100	66	12	follicles	follicle	NOUN
ct-9100	66	13	;	;	PUNCT
ct-9100	66	14	therefore	therefore	ADV
ct-9100	66	15	,	,	PUNCT
ct-9100	66	16	development	development	NOUN
ct-9100	66	17	of	of	ADP
ct-9100	66	18	a	a	DET
ct-9100	66	19	spaca3	spaca3	NOUN
ct-9100	66	20	vaccine	vaccine	NOUN
ct-9100	66	21	for	for	ADP
ct-9100	66	22	horses	horse	NOUN
ct-9100	66	23	might	might	AUX
ct-9100	66	24	result	result	VERB
ct-9100	66	25	in	in	ADP
ct-9100	66	26	permanent	permanent	ADJ
ct-9100	66	27	sterilization	sterilization	NOUN
ct-9100	66	28	.	.	PUNCT
ct-9100	67	1	additional	additional	ADJ
ct-9100	67	2	research	research	NOUN
ct-9100	67	3	is	be	AUX
ct-9100	67	4	needed	need	VERB
ct-9100	67	5	to	to	PART
ct-9100	67	6	determine	determine	VERB
ct-9100	67	7	if	if	SCONJ
ct-9100	67	8	horses	horse	NOUN
ct-9100	67	9	can	can	AUX
ct-9100	67	10	produce	produce	VERB
ct-9100	67	11	a	a	DET
ct-9100	67	12	robust	robust	ADJ
ct-9100	67	13	humoral	humoral	ADJ
ct-9100	67	14	response	response	NOUN
ct-9100	67	15	to	to	ADP
ct-9100	67	16	a	a	DET
ct-9100	67	17	spaca3	spaca3	NOUN
ct-9100	67	18	vaccine	vaccine	NOUN
ct-9100	67	19	to	to	PART
ct-9100	67	20	in	in	ADP
ct-9100	67	21	order	order	NOUN
ct-9100	67	22	to	to	PART
ct-9100	67	23	induce	induce	VERB
ct-9100	67	24	sustained	sustained	ADJ
ct-9100	67	25	infertility	infertility	NOUN
ct-9100	67	26	.	.	PUNCT
ct-9100	68	1	acknowldgements	acknowldgement	NOUN
ct-9100	68	2	authors	author	NOUN
ct-9100	68	3	thank	thank	VERB
ct-9100	68	4	dr	dr	PROPN
ct-9100	68	5	.	.	PROPN
ct-9100	68	6	l.	l.	PROPN
ct-9100	68	7	pielstick	pielstick	PROPN
ct-9100	68	8	for	for	ADP
ct-9100	68	9	collection	collection	NOUN
ct-9100	68	10	of	of	ADP
ct-9100	68	11	the	the	DET
ct-9100	68	12	ovaries	ovary	NOUN
ct-9100	68	13	.	.	PUNCT
ct-9100	69	1	conflict	conflict	NOUN
ct-9100	69	2	of	of	ADP
ct-9100	69	3	interest	interest	NOUN
ct-9100	69	4	authors	author	NOUN
ct-9100	69	5	declared	declare	VERB
ct-9100	69	6	no	no	DET
ct-9100	69	7	potential	potential	ADJ
ct-9100	69	8	conflicts	conflict	NOUN
ct-9100	69	9	of	of	ADP
ct-9100	69	10	interest	interest	NOUN
ct-9100	69	11	with	with	ADP
ct-9100	69	12	respect	respect	NOUN
ct-9100	69	13	to	to	ADP
ct-9100	69	14	the	the	DET
ct-9100	69	15	research	research	NOUN
ct-9100	69	16	,	,	PUNCT
ct-9100	69	17	authorship	authorship	NOUN
ct-9100	69	18	,	,	PUNCT
ct-9100	69	19	and/or	and/or	CCONJ
ct-9100	69	20	publication	publication	NOUN
ct-9100	69	21	of	of	ADP
ct-9100	69	22	this	this	DET
ct-9100	69	23	article	article	NOUN
ct-9100	69	24	.	.	PUNCT
ct-9100	70	1	funding	funding	NOUN
ct-9100	70	2	funded	fund	VERB
ct-9100	70	3	by	by	ADP
ct-9100	70	4	the	the	DET
ct-9100	70	5	united	united	PROPN
ct-9100	70	6	states	states	PROPN
ct-9100	70	7	department	department	PROPN
ct-9100	70	8	of	of	ADP
ct-9100	70	9	agriculturenational	agriculturenational	PROPN
ct-9100	70	10	institute	institute	PROPN
ct-9100	70	11	of	of	ADP
ct-9100	70	12	food	food	NOUN
ct-9100	70	13	and	and	CCONJ
ct-9100	70	14	agriculture	agriculture	NOUN
ct-9100	70	15	(	(	PUNCT
ct-9100	70	16	#	#	SYM
ct-9100	70	17	1021276	1021276	NUM
ct-9100	70	18	)	)	PUNCT
ct-9100	70	19	,	,	PUNCT
ct-9100	70	20	oregon	oregon	PROPN
ct-9100	70	21	state	state	PROPN
ct-9100	70	22	university	university	PROPN
ct-9100	70	23	agricultural	agricultural	ADJ
ct-9100	70	24	research	research	PROPN
ct-9100	70	25	foundation	foundation	NOUN
ct-9100	70	26	(	(	PUNCT
ct-9100	70	27	#	#	SYM
ct-9100	70	28	9258a	9258a	NUM
ct-9100	70	29	)	)	PUNCT
ct-9100	70	30	,	,	PUNCT
ct-9100	70	31	undergraduate	undergraduate	ADJ
ct-9100	70	32	research	research	NOUN
ct-9100	70	33	scholarship	scholarship	NOUN
ct-9100	70	34	and	and	CCONJ
ct-9100	70	35	arts	art	NOUN
ct-9100	70	36	program	program	NOUN
ct-9100	70	37	,	,	PUNCT
ct-9100	70	38	and	and	CCONJ
ct-9100	70	39	college	college	NOUN
ct-9100	70	40	of	of	ADP
ct-9100	70	41	agricultural	agricultural	ADJ
ct-9100	70	42	sciences	science	NOUN
ct-9100	70	43	continuing	continue	VERB
ct-9100	70	44	researchers	researcher	NOUN
ct-9100	70	45	grant	grant	VERB
ct-9100	70	46	.	.	PUNCT
ct-9100	71	1	references	reference	NOUN
ct-9100	71	2	1	1	NUM
ct-9100	71	3	.	.	PUNCT
ct-9100	71	4	mandal	mandal	PROPN
ct-9100	71	5	a	a	PROPN
ct-9100	71	6	,	,	PUNCT
ct-9100	71	7	klotz	klotz	PROPN
ct-9100	71	8	kl	kl	PROPN
ct-9100	71	9	,	,	PUNCT
ct-9100	71	10	shetty	shetty	PROPN
ct-9100	71	11	j	j	PROPN
ct-9100	71	12	,	,	PUNCT
ct-9100	71	13	et	et	PROPN
ct-9100	71	14	al	al	PROPN
ct-9100	71	15	:	:	PUNCT
ct-9100	71	16	sllp1	sllp1	PROPN
ct-9100	71	17	,	,	PUNCT
ct-9100	71	18	a	a	DET
ct-9100	71	19	unique	unique	ADJ
ct-9100	71	20	,	,	PUNCT
ct-9100	71	21	intraacrosomal	intraacrosomal	PROPN
ct-9100	71	22	,	,	PUNCT
ct-9100	71	23	non	non	ADJ
ct-9100	71	24	-	-	ADJ
ct-9100	71	25	bacteriolytic	bacteriolytic	ADJ
ct-9100	71	26	,	,	PUNCT
ct-9100	71	27	c	c	NOUN
ct-9100	71	28	lysozyme	lysozyme	NOUN
ct-9100	71	29	-	-	PUNCT
ct-9100	71	30	like	like	ADJ
ct-9100	71	31	protein	protein	NOUN
ct-9100	71	32	of	of	ADP
ct-9100	71	33	human	human	ADJ
ct-9100	71	34	spermatozoa	spermatozoon	NOUN
ct-9100	71	35	.	.	PUNCT
ct-9100	72	1	biol	biol	PROPN
ct-9100	72	2	reprod	reprod	PROPN
ct-9100	72	3	2003;68:1525	2003;68:1525	PROPN
ct-9100	72	4	-	-	PUNCT
ct-9100	72	5	1537	1537	NUM
ct-9100	72	6	.	.	PUNCT
ct-9100	73	1	2	2	X
ct-9100	73	2	.	.	X
ct-9100	73	3	zheng	zheng	PROPN
ct-9100	73	4	h	h	PROPN
ct-9100	73	5	,	,	PUNCT
ct-9100	73	6	mandal	mandal	PROPN
ct-9100	73	7	a	a	PROPN
ct-9100	73	8	,	,	PUNCT
ct-9100	73	9	shumilin	shumilin	PROPN
ct-9100	73	10	ia	ia	PROPN
ct-9100	73	11	,	,	PUNCT
ct-9100	73	12	et	et	PROPN
ct-9100	73	13	al	al	PROPN
ct-9100	73	14	:	:	PUNCT
ct-9100	73	15	sperm	sperm	NOUN
ct-9100	73	16	lysozyme	lysozyme	NOUN
ct-9100	73	17	-	-	PUNCT
ct-9100	73	18	like	like	ADJ
ct-9100	73	19	protein	protein	NOUN
ct-9100	73	20	1	1	NUM
ct-9100	73	21	(	(	PUNCT
ct-9100	73	22	sllp1	sllp1	PROPN
ct-9100	73	23	)	)	PUNCT
ct-9100	73	24	,	,	PUNCT
ct-9100	73	25	an	an	DET
ct-9100	73	26	intra	intra	ADJ
ct-9100	73	27	-	-	ADJ
ct-9100	73	28	acrosomal	acrosomal	ADJ
ct-9100	73	29	oolemmal	oolemmal	ADV
ct-9100	73	30	-	-	PUNCT
ct-9100	73	31	binding	bind	VERB
ct-9100	73	32	sperm	sperm	NOUN
ct-9100	73	33	protein	protein	NOUN
ct-9100	73	34	,	,	PUNCT
ct-9100	73	35	reveals	reveal	VERB
ct-9100	73	36	filamentous	filamentous	ADJ
ct-9100	73	37	organization	organization	NOUN
ct-9100	73	38	in	in	ADP
ct-9100	73	39	protein	protein	NOUN
ct-9100	73	40	crystal	crystal	NOUN
ct-9100	73	41	form	form	NOUN
ct-9100	73	42	.	.	PUNCT
ct-9100	74	1	andrology	andrology	NOUN
ct-9100	75	1	2015;3:756	2015;3:756	NOUN
ct-9100	75	2	-	-	SYM
ct-9100	75	3	771	771	NUM
ct-9100	75	4	.	.	PUNCT
ct-9100	76	1	3	3	X
ct-9100	76	2	.	.	X
ct-9100	76	3	chiu	chiu	PROPN
ct-9100	76	4	wwc	wwc	PROPN
ct-9100	76	5	,	,	PUNCT
ct-9100	76	6	erikson	erikson	PROPN
ct-9100	76	7	ekl	ekl	PROPN
ct-9100	76	8	,	,	PUNCT
ct-9100	76	9	sole	sole	ADJ
ct-9100	76	10	ca	ca	NOUN
ct-9100	76	11	,	,	PUNCT
ct-9100	76	12	et	et	PROPN
ct-9100	76	13	al	al	PROPN
ct-9100	76	14	:	:	PUNCT
ct-9100	76	15	sprasa	sprasa	PROPN
ct-9100	76	16	,	,	PUNCT
ct-9100	76	17	a	a	DET
ct-9100	76	18	novel	novel	ADJ
ct-9100	76	19	sperm	sperm	NOUN
ct-9100	76	20	protein	protein	NOUN
ct-9100	76	21	involved	involve	VERB
ct-9100	76	22	in	in	ADP
ct-9100	76	23	immune	immune	NOUN
ct-9100	76	24	-	-	PUNCT
ct-9100	76	25	mediated	mediate	VERB
ct-9100	76	26	infertility	infertility	NOUN
ct-9100	76	27	.	.	PUNCT
ct-9100	77	1	eur	eur	PROPN
ct-9100	77	2	soc	soc	PROPN
ct-9100	77	3	human	human	PROPN
ct-9100	77	4	reprod	reprod	PROPN
ct-9100	77	5	embryol	embryol	NOUN
ct-9100	77	6	2004;19:243	2004;19:243	PROPN
ct-9100	77	7	-	-	SYM
ct-9100	77	8	249	249	NUM
ct-9100	77	9	.	.	PUNCT
ct-9100	77	10	4	4	NUM
ct-9100	77	11	.	.	PUNCT
ct-9100	78	1	kovac	kovac	PROPN
ct-9100	78	2	jr	jr	PROPN
ct-9100	78	3	,	,	PUNCT
ct-9100	78	4	pastuszak	pastuszak	PROPN
ct-9100	78	5	aw	aw	INTJ
ct-9100	78	6	,	,	PUNCT
ct-9100	78	7	lamb	lamb	PROPN
ct-9100	78	8	dj	dj	PROPN
ct-9100	78	9	:	:	PUNCT
ct-9100	78	10	the	the	DET
ct-9100	78	11	use	use	NOUN
ct-9100	78	12	of	of	ADP
ct-9100	78	13	genomics	genomics	NOUN
ct-9100	78	14	,	,	PUNCT
ct-9100	78	15	proteomics	proteomic	NOUN
ct-9100	78	16	,	,	PUNCT
ct-9100	78	17	and	and	CCONJ
ct-9100	78	18	metabolomics	metabolomic	NOUN
ct-9100	78	19	in	in	ADP
ct-9100	78	20	identifying	identify	VERB
ct-9100	78	21	biomarkers	biomarker	NOUN
ct-9100	78	22	of	of	ADP
ct-9100	78	23	male	male	ADJ
ct-9100	78	24	infertility	infertility	NOUN
ct-9100	78	25	.	.	PUNCT
ct-9100	79	1	fertil	fertil	AUX
ct-9100	79	2	steril	steril	VERB
ct-9100	79	3	2013;99:998	2013;99:998	NUM
ct-9100	79	4	-	-	SYM
ct-9100	79	5	1007	1007	NUM
ct-9100	79	6	.	.	PUNCT
ct-9100	80	1	5	5	NUM
ct-9100	80	2	.	.	X
ct-9100	80	3	mcreynolds	mcreynolds	PROPN
ct-9100	80	4	s	s	PROPN
ct-9100	80	5	,	,	PUNCT
ct-9100	80	6	dzieciatkowska	dzieciatkowska	PROPN
ct-9100	80	7	m	m	PROPN
ct-9100	80	8	,	,	PUNCT
ct-9100	80	9	stevens	stevens	PROPN
ct-9100	80	10	j	j	PROPN
ct-9100	80	11	,	,	PUNCT
ct-9100	80	12	et	et	PROPN
ct-9100	80	13	al	al	PROPN
ct-9100	80	14	:	:	PUNCT
ct-9100	80	15	toward	toward	ADP
ct-9100	80	16	the	the	DET
ct-9100	80	17	identification	identification	NOUN
ct-9100	80	18	of	of	ADP
ct-9100	80	19	a	a	DET
ct-9100	80	20	subset	subset	NOUN
ct-9100	80	21	of	of	ADP
ct-9100	80	22	unexplained	unexplained	ADJ
ct-9100	80	23	infertility	infertility	NOUN
ct-9100	80	24	:	:	PUNCT
ct-9100	80	25	a	a	DET
ct-9100	80	26	sperm	sperm	NOUN
ct-9100	80	27	proteomic	proteomic	ADJ
ct-9100	80	28	approach	approach	NOUN
ct-9100	80	29	.	.	PUNCT
ct-9100	81	1	fertil	fertil	AUX
ct-9100	81	2	steril	steril	VERB
ct-9100	81	3	2014;102:692	2014;102:692	NUM
ct-9100	81	4	-	-	SYM
ct-9100	81	5	699	699	NUM
ct-9100	81	6	.	.	NOUN
ct-9100	82	1	6	6	NUM
ct-9100	82	2	.	.	PUNCT
ct-9100	82	3	agarwal	agarwal	PROPN
ct-9100	82	4	a	a	PROPN
ct-9100	82	5	,	,	PUNCT
ct-9100	82	6	sharma	sharma	PROPN
ct-9100	82	7	r	r	PROPN
ct-9100	82	8	,	,	PUNCT
ct-9100	82	9	durairajanayagam	durairajanayagam	NOUN
ct-9100	82	10	d	d	NOUN
ct-9100	82	11	,	,	PUNCT
ct-9100	82	12	et	et	PROPN
ct-9100	82	13	al	al	PROPN
ct-9100	82	14	:	:	PUNCT
ct-9100	82	15	major	major	ADJ
ct-9100	82	16	protein	protein	NOUN
ct-9100	82	17	alterations	alteration	NOUN
ct-9100	82	18	in	in	ADP
ct-9100	82	19	spermatozoa	spermatozoon	NOUN
ct-9100	82	20	from	from	ADP
ct-9100	82	21	infertile	infertile	ADJ
ct-9100	82	22	men	man	NOUN
ct-9100	82	23	with	with	ADP
ct-9100	82	24	unilateral	unilateral	ADJ
ct-9100	82	25	varicocele	varicocele	NOUN
ct-9100	82	26	.	.	PUNCT
ct-9100	83	1	reprod	reprod	AUX
ct-9100	83	2	biol	biol	PROPN
ct-9100	83	3	endocrinol	endocrinol	VERB
ct-9100	83	4	2015;13:1	2015;13:1	NUM
ct-9100	83	5	-	-	SYM
ct-9100	83	6	22	22	NUM
ct-9100	83	7	.	.	PUNCT
ct-9100	84	1	7	7	X
ct-9100	84	2	.	.	NUM
ct-9100	84	3	kwon	kwon	PROPN
ct-9100	84	4	ws	ws	PROPN
ct-9100	84	5	,	,	PUNCT
ct-9100	84	6	rahman	rahman	PROPN
ct-9100	84	7	ms	ms	PROPN
ct-9100	84	8	,	,	PUNCT
ct-9100	84	9	lee	lee	PROPN
ct-9100	84	10	js	js	PROPN
ct-9100	84	11	,	,	PUNCT
ct-9100	84	12	et	et	PROPN
ct-9100	84	13	al	al	PROPN
ct-9100	84	14	:	:	PUNCT
ct-9100	84	15	discovery	discovery	NOUN
ct-9100	84	16	of	of	ADP
ct-9100	84	17	predictive	predictive	ADJ
ct-9100	84	18	biomarkers	biomarker	NOUN
ct-9100	84	19	for	for	ADP
ct-9100	84	20	litter	litter	NOUN
ct-9100	84	21	size	size	NOUN
ct-9100	84	22	in	in	ADP
ct-9100	84	23	boar	boar	NOUN
ct-9100	84	24	spermatozoa	spermatozoon	NOUN
ct-9100	84	25	.	.	PUNCT
ct-9100	85	1	mol	mol	ADP
ct-9100	85	2	cell	cell	NOUN
ct-9100	85	3	proteomics	proteomic	NOUN
ct-9100	85	4	2015;14:1230	2015;14:1230	NUM
ct-9100	85	5	-	-	SYM
ct-9100	85	6	1240	1240	NUM
ct-9100	85	7	.	.	PUNCT
ct-9100	86	1	8	8	NUM
ct-9100	86	2	.	.	X
ct-9100	86	3	herrero	herrero	PROPN
ct-9100	86	4	mb	mb	PROPN
ct-9100	86	5	,	,	PUNCT
ct-9100	86	6	mandal	mandal	PROPN
ct-9100	86	7	a	a	PRON
ct-9100	86	8	,	,	PUNCT
ct-9100	86	9	digilio	digilio	ADJ
ct-9100	86	10	lc	lc	PROPN
ct-9100	86	11	,	,	PUNCT
ct-9100	86	12	et	et	PROPN
ct-9100	86	13	al	al	PROPN
ct-9100	86	14	:	:	PUNCT
ct-9100	86	15	mouse	mouse	PROPN
ct-9100	86	16	sllp1	sllp1	PROPN
ct-9100	86	17	,	,	PUNCT
ct-9100	86	18	a	a	DET
ct-9100	86	19	sperm	sperm	NOUN
ct-9100	86	20	lysozyme	lysozyme	NOUN
ct-9100	86	21	-	-	PUNCT
ct-9100	86	22	like	like	ADJ
ct-9100	86	23	protein	protein	NOUN
ct-9100	86	24	involved	involve	VERB
ct-9100	86	25	in	in	ADP
ct-9100	86	26	sperm	sperm	NOUN
ct-9100	86	27	-	-	PUNCT
ct-9100	86	28	egg	egg	NOUN
ct-9100	86	29	binding	binding	NOUN
ct-9100	86	30	and	and	CCONJ
ct-9100	86	31	fertilization	fertilization	NOUN
ct-9100	86	32	.	.	PUNCT
ct-9100	87	1	dev	dev	PROPN
ct-9100	87	2	biol	biol	PROPN
ct-9100	87	3	2005;284:126	2005;284:126	NUM
ct-9100	87	4	-	-	SYM
ct-9100	87	5	142	142	NUM
ct-9100	87	6	.	.	PUNCT
ct-9100	88	1	9	9	NUM
ct-9100	88	2	.	.	X
ct-9100	88	3	wagner	wagner	PROPN
ct-9100	88	4	a	a	PROPN
ct-9100	88	5	,	,	PUNCT
ct-9100	88	6	holland	holland	PROPN
ct-9100	88	7	oj	oj	PROPN
ct-9100	88	8	,	,	PUNCT
ct-9100	88	9	tong	tong	PROPN
ct-9100	88	10	m	m	PROPN
ct-9100	88	11	,	,	PUNCT
ct-9100	88	12	et	et	PROPN
ct-9100	88	13	al	al	PROPN
ct-9100	88	14	:	:	PUNCT
ct-9100	88	15	the	the	DET
ct-9100	88	16	role	role	NOUN
ct-9100	88	17	of	of	ADP
ct-9100	88	18	sprasa	sprasa	NOUN
ct-9100	88	19	in	in	ADP
ct-9100	88	20	female	female	ADJ
ct-9100	88	21	fertility	fertility	NOUN
ct-9100	88	22	.	.	PUNCT
ct-9100	89	1	reprod	reprod	PROPN
ct-9100	89	2	sci	sci	PROPN
ct-9100	89	3	2015;22:452	2015;22:452	PROPN
ct-9100	89	4	-	-	SYM
ct-9100	89	5	461	461	NUM
ct-9100	89	6	.	.	PUNCT
ct-9100	90	1	10	10	NUM
ct-9100	90	2	.	.	PUNCT
ct-9100	91	1	cozzi	cozzi	PROPN
ct-9100	91	2	b	b	PROPN
ct-9100	91	3	,	,	PUNCT
ct-9100	91	4	habeeb	habeeb	PROPN
ct-9100	91	5	h	h	PROPN
ct-9100	91	6	,	,	PUNCT
ct-9100	91	7	kutzler	kutzler	NOUN
ct-9100	91	8	m	m	PROPN
ct-9100	91	9	:	:	PUNCT
ct-9100	91	10	sperm	sperm	NOUN
ct-9100	91	11	protein	protein	NOUN
ct-9100	91	12	reactive	reactive	NOUN
ct-9100	91	13	with	with	ADP
ct-9100	91	14	antisperm	antisperm	NOUN
ct-9100	91	15	antibody	antibody	NOUN
ct-9100	91	16	is	be	AUX
ct-9100	91	17	immunoexpressed	immunoexpresse	VERB
ct-9100	91	18	in	in	ADP
ct-9100	91	19	equine	equine	NOUN
ct-9100	91	20	primordial	primordial	ADJ
ct-9100	91	21	,	,	PUNCT
ct-9100	91	22	primary	primary	ADJ
ct-9100	91	23	,	,	PUNCT
ct-9100	91	24	secondary	secondary	ADJ
ct-9100	91	25	,	,	PUNCT
ct-9100	91	26	and	and	CCONJ
ct-9100	91	27	tertiary	tertiary	ADJ
ct-9100	91	28	follicles	follicle	NOUN
ct-9100	91	29	.	.	PUNCT
ct-9100	92	1	clinical	clinical	ADJ
ct-9100	92	2	theriogenology	theriogenology	NOUN
ct-9100	92	3	2020;12:362	2020;12:362	NUM
ct-9100	92	4	.	.	PUNCT
ct-9100	92	5	11	11	NUM
ct-9100	92	6	.	.	PUNCT
ct-9100	93	1	mugnier	mugnier	PROPN
ct-9100	93	2	s	s	PROPN
ct-9100	93	3	,	,	PUNCT
ct-9100	93	4	dell’aquila	dell’aquila	VERB
ct-9100	93	5	me	i	PRON
ct-9100	93	6	,	,	PUNCT
ct-9100	93	7	pelaez	pelaez	PROPN
ct-9100	93	8	j	j	PROPN
ct-9100	93	9	,	,	PUNCT
ct-9100	93	10	et	et	PROPN
ct-9100	93	11	al	al	PROPN
ct-9100	93	12	:	:	PUNCT
ct-9100	93	13	new	new	ADJ
ct-9100	93	14	insights	insight	NOUN
ct-9100	93	15	into	into	ADP
ct-9100	93	16	the	the	DET
ct-9100	93	17	clinical	clinical	ADJ
ct-9100	93	18	theriogenology	theriogenology	NOUN
ct-9100	93	19	2021	2021	NUM
ct-9100	93	20	;	;	PUNCT
ct-9100	93	21	13	13	NUM
ct-9100	93	22	:	:	SYM
ct-9100	93	23	87	87	NUM
ct-9100	93	24	mechanisms	mechanism	NOUN
ct-9100	93	25	of	of	ADP
ct-9100	93	26	fertilization	fertilization	NOUN
ct-9100	93	27	:	:	PUNCT
ct-9100	93	28	comparison	comparison	NOUN
ct-9100	93	29	of	of	ADP
ct-9100	93	30	the	the	DET
ct-9100	93	31	fertilization	fertilization	NOUN
ct-9100	93	32	steps	step	NOUN
ct-9100	93	33	,	,	PUNCT
ct-9100	93	34	composition	composition	NOUN
ct-9100	93	35	,	,	PUNCT
ct-9100	93	36	and	and	CCONJ
ct-9100	93	37	structure	structure	NOUN
ct-9100	93	38	of	of	ADP
ct-9100	93	39	the	the	DET
ct-9100	93	40	zona	zona	PROPN
ct-9100	93	41	pellucida	pellucida	PROPN
ct-9100	93	42	between	between	ADP
ct-9100	93	43	horses	horse	NOUN
ct-9100	93	44	and	and	CCONJ
ct-9100	93	45	pigs	pig	NOUN
ct-9100	93	46	.	.	PUNCT
ct-9100	94	1	biol	biol	PROPN
ct-9100	94	2	reprod	reprod	PROPN
ct-9100	94	3	2009;81:856	2009;81:856	PROPN
ct-9100	94	4	-	-	PUNCT
ct-9100	94	5	870	870	NUM
ct-9100	94	6	.	.	PUNCT
ct-9100	95	1	12	12	NUM
ct-9100	95	2	.	.	PUNCT
ct-9100	96	1	bureau	bureau	NOUN
ct-9100	96	2	of	of	ADP
ct-9100	96	3	land	land	NOUN
ct-9100	96	4	management	management	NOUN
ct-9100	96	5	.	.	PUNCT
ct-9100	97	1	wild	wild	ADJ
ct-9100	97	2	horse	horse	NOUN
ct-9100	97	3	and	and	CCONJ
ct-9100	97	4	burro	burro	ADJ
ct-9100	97	5	on	on	ADP
ct-9100	97	6	-	-	PUNCT
ct-9100	97	7	range	range	NOUN
ct-9100	97	8	population	population	NOUN
ct-9100	97	9	estimates	estimate	NOUN
ct-9100	97	10	.	.	PUNCT
ct-9100	98	1	bureau	bureau	PROPN
ct-9100	98	2	of	of	ADP
ct-9100	98	3	land	land	NOUN
ct-9100	98	4	management	management	NOUN
ct-9100	98	5	.	.	PUNCT
ct-9100	99	1	accessed	access	VERB
ct-9100	99	2	on	on	ADP
ct-9100	99	3	february	february	PROPN
ct-9100	99	4	5	5	NUM
ct-9100	99	5	,	,	PUNCT
ct-9100	99	6	2021	2021	NUM
ct-9100	99	7	from	from	ADP
ct-9100	99	8	https://www.blm.gov/programs/wild-horse-and-burro/	https://www.blm.gov/programs/wild-horse-and-burro/	PRON
ct-9100	99	9	about	about	ADP
ct-9100	99	10	-	-	PUNCT
ct-9100	99	11	the	the	DET
ct-9100	99	12	-	-	PUNCT
ct-9100	99	13	program	program	NOUN
ct-9100	99	14	/	/	SYM
ct-9100	99	15	program	program	NOUN
ct-9100	99	16	-	-	PUNCT
ct-9100	99	17	data	data	NOUN
ct-9100	99	18	.	.	PUNCT
ct-9100	100	1	13	13	NUM
ct-9100	100	2	.	.	PUNCT
ct-9100	101	1	kirkpatrick	kirkpatrick	PROPN
ct-9100	101	2	j	j	PROPN
ct-9100	101	3	,	,	PUNCT
ct-9100	101	4	liu	liu	PROPN
ct-9100	101	5	i	i	PROPN
ct-9100	101	6	,	,	PUNCT
ct-9100	101	7	turner	turner	PROPN
ct-9100	101	8	j	j	PROPN
ct-9100	101	9	,	,	PUNCT
ct-9100	101	10	et	et	PROPN
ct-9100	101	11	al	al	PROPN
ct-9100	101	12	:	:	PUNCT
ct-9100	101	13	long	long	ADJ
ct-9100	101	14	-	-	PUNCT
ct-9100	101	15	term	term	NOUN
ct-9100	101	16	effects	effect	NOUN
ct-9100	101	17	of	of	ADP
ct-9100	101	18	porcine	porcine	NOUN
ct-9100	101	19	zonae	zonae	PROPN
ct-9100	101	20	pellucidae	pellucidae	NOUN
ct-9100	101	21	immunocontraception	immunocontraception	NOUN
ct-9100	101	22	on	on	ADP
ct-9100	101	23	ovarian	ovarian	ADJ
ct-9100	101	24	function	function	NOUN
ct-9100	101	25	in	in	ADP
ct-9100	101	26	feral	feral	ADJ
ct-9100	101	27	horses	horse	NOUN
ct-9100	101	28	(	(	PUNCT
ct-9100	101	29	equus	equus	PROPN
ct-9100	101	30	caballus	caballus	PROPN
ct-9100	101	31	)	)	PUNCT
ct-9100	101	32	.	.	PUNCT
ct-9100	102	1	j	j	PROPN
ct-9100	102	2	reprod	reprod	PROPN
ct-9100	102	3	fert	fert	PROPN
ct-9100	102	4	1992;94:437	1992;94:437	NUM
ct-9100	102	5	-	-	SYM
ct-9100	102	6	444	444	NUM
ct-9100	102	7	.	.	PUNCT
ct-9100	102	8	14	14	NUM
ct-9100	102	9	.	.	PUNCT
ct-9100	103	1	kirkpatrick	kirkpatrick	PROPN
ct-9100	103	2	j	j	PROPN
ct-9100	103	3	,	,	PUNCT
ct-9100	103	4	naugle	naugle	NOUN
ct-9100	103	5	r	r	NOUN
ct-9100	103	6	,	,	PUNCT
ct-9100	103	7	liu	liu	PROPN
ct-9100	103	8	ikm	ikm	PROPN
ct-9100	103	9	,	,	PUNCT
ct-9100	103	10	et	et	PROPN
ct-9100	103	11	al	al	PROPN
ct-9100	103	12	:	:	PUNCT
ct-9100	103	13	effects	effect	NOUN
ct-9100	103	14	of	of	ADP
ct-9100	103	15	seven	seven	NUM
ct-9100	103	16	consecutive	consecutive	ADJ
ct-9100	103	17	years	year	NOUN
ct-9100	103	18	of	of	ADP
ct-9100	103	19	porcine	porcine	NOUN
ct-9100	103	20	zona	zona	PROPN
ct-9100	103	21	pellucida	pellucida	PROPN
ct-9100	103	22	contraception	contraception	NOUN
ct-9100	103	23	on	on	ADP
ct-9100	103	24	ovarian	ovarian	ADJ
ct-9100	103	25	function	function	NOUN
ct-9100	103	26	in	in	ADP
ct-9100	103	27	feral	feral	ADJ
ct-9100	103	28	mares	mare	NOUN
ct-9100	103	29	.	.	PUNCT
ct-9100	104	1	biol	biol	PROPN
ct-9100	104	2	reprod	reprod	PROPN
ct-9100	104	3	1995;52	1995;52	PROPN
ct-9100	104	4	(	(	PUNCT
ct-9100	104	5	monograph	monograph	NOUN
ct-9100	104	6	series1):411	series1):411	PROPN
ct-9100	104	7	-	-	PUNCT
ct-9100	104	8	418	418	NUM
ct-9100	104	9	.	.	PUNCT
ct-9100	105	1	15	15	NUM
ct-9100	105	2	.	.	PUNCT
ct-9100	106	1	powell	powell	PROPN
ct-9100	106	2	dm	dm	PROPN
ct-9100	106	3	,	,	PUNCT
ct-9100	106	4	monfort	monfort	NOUN
ct-9100	106	5	sl	sl	NOUN
ct-9100	106	6	:	:	PUNCT
ct-9100	106	7	assessment	assessment	NOUN
ct-9100	106	8	:	:	PUNCT
ct-9100	106	9	effects	effect	NOUN
ct-9100	106	10	of	of	ADP
ct-9100	106	11	porcine	porcine	NOUN
ct-9100	106	12	zona	zona	PROPN
ct-9100	106	13	pellucida	pellucida	PROPN
ct-9100	106	14	immunocontraception	immunocontraception	NOUN
ct-9100	106	15	on	on	ADP
ct-9100	106	16	estrous	estrous	ADJ
ct-9100	106	17	cyclicity	cyclicity	NOUN
ct-9100	106	18	in	in	ADP
ct-9100	106	19	feral	feral	ADJ
ct-9100	106	20	horses	horse	NOUN
ct-9100	106	21	.	.	PUNCT
ct-9100	107	1	j	j	PROPN
ct-9100	107	2	appl	appl	PROPN
ct-9100	107	3	anim	anim	PROPN
ct-9100	107	4	welf	welf	PROPN
ct-9100	107	5	sci	sci	PROPN
ct-9100	107	6	.	.	PUNCT
ct-9100	107	7	2001;4:271	2001;4:271	PROPN
ct-9100	107	8	-	-	PUNCT
ct-9100	107	9	284	284	NUM
ct-9100	107	10	.	.	PUNCT
ct-9100	108	1	16	16	NUM
ct-9100	108	2	.	.	PUNCT
ct-9100	109	1	barber	barber	PROPN
ct-9100	109	2	mr	mr	PROPN
ct-9100	109	3	,	,	PUNCT
ct-9100	109	4	fayrer	fayrer	AUX
ct-9100	109	5	-	-	PUNCT
ct-9100	109	6	hosken	hosken	VERB
ct-9100	109	7	ra	ra	NOUN
ct-9100	109	8	:	:	PUNCT
ct-9100	109	9	possible	possible	ADJ
ct-9100	109	10	mechanisms	mechanism	NOUN
ct-9100	109	11	of	of	ADP
ct-9100	109	12	mammalian	mammalian	ADJ
ct-9100	109	13	immunocontraception	immunocontraception	NOUN
ct-9100	109	14	.	.	PUNCT
ct-9100	110	1	j	j	PROPN
ct-9100	110	2	reprod	reprod	PROPN
ct-9100	110	3	immunol	immunol	PROPN
ct-9100	110	4	2000;46:103	2000;46:103	PROPN
ct-9100	110	5	-	-	SYM
ct-9100	110	6	124	124	NUM
ct-9100	110	7	.	.	PUNCT
ct-9100	110	8	17	17	NUM
ct-9100	110	9	.	.	PUNCT
ct-9100	111	1	ransom	ransom	PROPN
ct-9100	111	2	ji	ji	PROPN
ct-9100	111	3	,	,	PUNCT
ct-9100	111	4	cade	cade	PROPN
ct-9100	111	5	bs	bs	PROPN
ct-9100	111	6	,	,	PUNCT
ct-9100	111	7	hobbs	hobbs	PROPN
ct-9100	111	8	nt	not	PART
ct-9100	111	9	:	:	PUNCT
ct-9100	111	10	influences	influence	NOUN
ct-9100	111	11	of	of	ADP
ct-9100	111	12	immunocontraceptives	immunocontraceptive	NOUN
ct-9100	111	13	on	on	ADP
ct-9100	111	14	time	time	NOUN
ct-9100	111	15	budgets	budget	NOUN
ct-9100	111	16	,	,	PUNCT
ct-9100	111	17	social	social	ADJ
ct-9100	111	18	behavior	behavior	NOUN
ct-9100	111	19	,	,	PUNCT
ct-9100	111	20	and	and	CCONJ
ct-9100	111	21	body	body	NOUN
ct-9100	111	22	condition	condition	NOUN
ct-9100	111	23	in	in	ADP
ct-9100	111	24	feral	feral	ADJ
ct-9100	111	25	horses	horse	NOUN
ct-9100	111	26	.	.	PUNCT
ct-9100	112	1	appl	appl	PROPN
ct-9100	112	2	anim	anim	PROPN
ct-9100	112	3	behav	behav	PROPN
ct-9100	112	4	sci	sci	PROPN
ct-9100	112	5	2010;124:51	2010;124:51	NUM
ct-9100	112	6	-	-	SYM
ct-9100	112	7	60	60	NUM
ct-9100	112	8	.	.	PUNCT
ct-9100	113	1	18	18	NUM
ct-9100	113	2	.	.	PUNCT
ct-9100	113	3	turner	turner	PROPN
ct-9100	113	4	jw	jw	PROPN
ct-9100	113	5	jr	jr	PROPN
ct-9100	113	6	,	,	PUNCT
ct-9100	113	7	liu	liu	PROPN
ct-9100	113	8	ik	ik	PROPN
ct-9100	113	9	,	,	PUNCT
ct-9100	113	10	flanagan	flanagan	PROPN
ct-9100	113	11	dr	dr	PROPN
ct-9100	113	12	,	,	PUNCT
ct-9100	113	13	et	et	PROPN
ct-9100	113	14	al	al	PROPN
ct-9100	113	15	:	:	PUNCT
ct-9100	113	16	porcine	porcine	NOUN
ct-9100	113	17	zona	zona	PROPN
ct-9100	113	18	pellucida	pellucida	PROPN
ct-9100	113	19	(	(	PUNCT
ct-9100	113	20	pzp	pzp	NOUN
ct-9100	113	21	)	)	PUNCT
ct-9100	113	22	immunocontraception	immunocontraception	NOUN
ct-9100	113	23	of	of	ADP
ct-9100	113	24	wild	wild	ADJ
ct-9100	113	25	horses	horse	NOUN
ct-9100	113	26	(	(	PUNCT
ct-9100	113	27	equus	equus	PROPN
ct-9100	113	28	caballus	caballus	PROPN
ct-9100	113	29	)	)	PUNCT
ct-9100	113	30	in	in	ADP
ct-9100	113	31	nevada	nevada	PROPN
ct-9100	113	32	:	:	PUNCT
ct-9100	113	33	a	a	DET
ct-9100	113	34	10	10	NUM
ct-9100	113	35	-	-	PUNCT
ct-9100	113	36	year	year	NOUN
ct-9100	113	37	study	study	NOUN
ct-9100	113	38	.	.	PUNCT
ct-9100	114	1	reprod	reprod	PROPN
ct-9100	114	2	suppl	suppl	PROPN
ct-9100	114	3	2002;60:177	2002;60:177	PROPN
ct-9100	114	4	-	-	SYM
ct-9100	114	5	186	186	NUM
ct-9100	114	6	.	.	PUNCT
ct-9100	114	7	19	19	NUM
ct-9100	114	8	.	.	PUNCT
ct-9100	114	9	miller	miller	PROPN
ct-9100	114	10	la	la	PROPN
ct-9100	114	11	,	,	PUNCT
ct-9100	114	12	johns	johns	PROPN
ct-9100	114	13	be	be	PROPN
ct-9100	114	14	,	,	PUNCT
ct-9100	114	15	killian	killian	PROPN
ct-9100	114	16	gj	gj	PROPN
ct-9100	114	17	:	:	PUNCT
ct-9100	114	18	immunocontraception	immunocontraception	NOUN
ct-9100	114	19	of	of	ADP
ct-9100	114	20	white	white	ADJ
ct-9100	114	21	-	-	PUNCT
ct-9100	114	22	tailed	tail	VERB
ct-9100	114	23	deer	deer	NOUN
ct-9100	114	24	with	with	ADP
ct-9100	114	25	gnrh	gnrh	NOUN
ct-9100	114	26	vaccine	vaccine	NOUN
ct-9100	114	27	.	.	PUNCT
ct-9100	115	1	am	be	AUX
ct-9100	115	2	j	j	PROPN
ct-9100	115	3	reprod	reprod	PROPN
ct-9100	115	4	immunol	immunol	NOUN
ct-9100	115	5	2000;44:266	2000;44:266	NOUN
ct-9100	115	6	-	-	SYM
ct-9100	115	7	274	274	NUM
ct-9100	115	8	.	.	PUNCT
ct-9100	116	1	clinical	clinical	ADJ
ct-9100	116	2	theriogenology	theriogenology	NOUN
ct-9100	116	3	2021	2021	NUM
ct-9100	116	4	;	;	PUNCT
ct-9100	116	5	13	13	NUM
ct-9100	116	6	:	:	SYM
ct-9100	116	7	88	88	NUM