id	sid	tid	token	lemma	pos
finefocus-3634	1	1	fine	fine	ADJ
finefocus-3634	1	2	focus	focus	VERB
finefocus-3634	1	3	86	86	NUM
finefocus-3634	1	4	i	i	PRON
finefocus-3634	1	5	fine	fine	ADJ
finefocus-3634	1	6	focus	focus	VERB
finefocus-3634	1	7	the	the	DET
finefocus-3634	1	8	impact	impact	NOUN
finefocus-3634	1	9	of	of	ADP
finefocus-3634	1	10	petase	petase	NOUN
finefocus-3634	1	11	’s	’s	PART
finefocus-3634	1	12	active	active	ADJ
finefocus-3634	1	13	site	site	NOUN
finefocus-3634	1	14	disulfide	disulfide	NOUN
finefocus-3634	1	15	bond	bond	NOUN
finefocus-3634	1	16	on	on	ADP
finefocus-3634	1	17	pet	pet	ADJ
finefocus-3634	1	18	biodegradation	biodegradation	NOUN
finefocus-3634	1	19	kreesha	kreesha	PROPN
finefocus-3634	1	20	saha	saha	PROPN
finefocus-3634	1	21	and	and	CCONJ
finefocus-3634	1	22	clark	clark	PROPN
finefocus-3634	1	23	gedney	gedney	NOUN
finefocus-3634	1	24	915	915	NUM
finefocus-3634	1	25	w.	w.	PROPN
finefocus-3634	1	26	state	state	PROPN
finefocus-3634	1	27	street	street	PROPN
finefocus-3634	1	28	,	,	PUNCT
finefocus-3634	1	29	lilly	lilly	PROPN
finefocus-3634	1	30	hall	hall	NOUN
finefocus-3634	1	31	of	of	ADP
finefocus-3634	1	32	life	life	NOUN
finefocus-3634	1	33	sciences	sciences	PROPN
finefocus-3634	1	34	,	,	PUNCT
finefocus-3634	1	35	purdue	purdue	PROPN
finefocus-3634	1	36	university	university	NOUN
finefocus-3634	1	37	,	,	PUNCT
finefocus-3634	1	38	west	west	PROPN
finefocus-3634	1	39	lafayette	lafayette	PROPN
finefocus-3634	1	40	,	,	PUNCT
finefocus-3634	1	41	in	in	ADP
finefocus-3634	1	42	47907	47907	NUM
finefocus-3634	1	43	manuscript	manuscript	NOUN
finefocus-3634	1	44	received	receive	VERB
finefocus-3634	1	45	4	4	NUM
finefocus-3634	1	46	july	july	NOUN
finefocus-3634	1	47	2021	2021	NUM
finefocus-3634	1	48	;	;	PUNCT
finefocus-3634	1	49	accepted	accept	VERB
finefocus-3634	1	50	24	24	NUM
finefocus-3634	1	51	august	august	PROPN
finefocus-3634	1	52	2021	2021	NUM
finefocus-3634	1	53	vol	vol	NOUN
finefocus-3634	1	54	8	8	NUM
finefocus-3634	2	1	i	i	PRON
finefocus-3634	2	2	87	87	NUM
finefocus-3634	2	3	abstract	abstract	ADJ
finefocus-3634	2	4	plastic	plastic	NOUN
finefocus-3634	2	5	pollution	pollution	NOUN
finefocus-3634	2	6	is	be	AUX
finefocus-3634	2	7	one	one	NUM
finefocus-3634	2	8	of	of	ADP
finefocus-3634	2	9	the	the	DET
finefocus-3634	2	10	largest	large	ADJ
finefocus-3634	2	11	problems	problem	NOUN
finefocus-3634	2	12	globally	globally	ADV
finefocus-3634	2	13	,	,	PUNCT
finefocus-3634	2	14	with	with	ADP
finefocus-3634	2	15	polyethylene	polyethylene	NOUN
finefocus-3634	2	16	terephthalate	terephthalate	NOUN
finefocus-3634	2	17	(	(	PUNCT
finefocus-3634	2	18	pet	pet	NOUN
finefocus-3634	2	19	)	)	PUNCT
finefocus-3634	2	20	plastic	plastic	NOUN
finefocus-3634	2	21	as	as	ADP
finefocus-3634	2	22	one	one	NUM
finefocus-3634	2	23	of	of	ADP
finefocus-3634	2	24	the	the	DET
finefocus-3634	2	25	main	main	ADJ
finefocus-3634	2	26	sources	source	NOUN
finefocus-3634	2	27	.	.	PUNCT
finefocus-3634	3	1	effective	effective	ADJ
finefocus-3634	3	2	depolymerization	depolymerization	NOUN
finefocus-3634	3	3	of	of	ADP
finefocus-3634	3	4	pet	pet	NOUN
finefocus-3634	3	5	to	to	ADP
finefocus-3634	3	6	its	its	PRON
finefocus-3634	3	7	monomers	monomer	NOUN
finefocus-3634	3	8	for	for	ADP
finefocus-3634	3	9	upcycling	upcycle	VERB
finefocus-3634	3	10	is	be	AUX
finefocus-3634	3	11	a	a	DET
finefocus-3634	3	12	challenge	challenge	NOUN
finefocus-3634	3	13	.	.	PUNCT
finefocus-3634	4	1	petase	petase	NOUN
finefocus-3634	4	2	is	be	AUX
finefocus-3634	4	3	reported	report	VERB
finefocus-3634	4	4	to	to	PART
finefocus-3634	4	5	be	be	AUX
finefocus-3634	4	6	an	an	DET
finefocus-3634	4	7	effective	effective	ADJ
finefocus-3634	4	8	enzyme	enzyme	NOUN
finefocus-3634	4	9	for	for	ADP
finefocus-3634	4	10	biodegradation	biodegradation	NOUN
finefocus-3634	4	11	of	of	ADP
finefocus-3634	4	12	pet	pet	NOUN
finefocus-3634	4	13	via	via	ADP
finefocus-3634	4	14	c	c	NOUN
finefocus-3634	4	15	-	-	PUNCT
finefocus-3634	4	16	o	o	NOUN
finefocus-3634	4	17	bond	bond	NOUN
finefocus-3634	4	18	cleavage	cleavage	NOUN
finefocus-3634	4	19	of	of	ADP
finefocus-3634	4	20	ester	ester	NOUN
finefocus-3634	4	21	linkage	linkage	NOUN
finefocus-3634	4	22	.	.	PUNCT
finefocus-3634	5	1	the	the	DET
finefocus-3634	5	2	role	role	NOUN
finefocus-3634	5	3	of	of	ADP
finefocus-3634	5	4	the	the	DET
finefocus-3634	5	5	disulfide	disulfide	NOUN
finefocus-3634	5	6	bond	bond	NOUN
finefocus-3634	5	7	,	,	PUNCT
finefocus-3634	5	8	present	present	ADJ
finefocus-3634	5	9	in	in	ADP
finefocus-3634	5	10	petase	petase	NOUN
finefocus-3634	5	11	’s	’s	PART
finefocus-3634	5	12	active	active	ADJ
finefocus-3634	5	13	site	site	NOUN
finefocus-3634	5	14	sequence	sequence	NOUN
finefocus-3634	5	15	,	,	PUNCT
finefocus-3634	5	16	is	be	AUX
finefocus-3634	5	17	unknown	unknown	ADJ
finefocus-3634	5	18	in	in	ADP
finefocus-3634	5	19	the	the	DET
finefocus-3634	5	20	cleavage	cleavage	NOUN
finefocus-3634	5	21	of	of	ADP
finefocus-3634	5	22	pet	pet	NOUN
finefocus-3634	5	23	’s	’s	PART
finefocus-3634	5	24	ester	ester	NOUN
finefocus-3634	5	25	linkage	linkage	NOUN
finefocus-3634	5	26	.	.	PUNCT
finefocus-3634	6	1	to	to	PART
finefocus-3634	6	2	understand	understand	VERB
finefocus-3634	6	3	the	the	DET
finefocus-3634	6	4	role	role	NOUN
finefocus-3634	6	5	of	of	ADP
finefocus-3634	6	6	this	this	DET
finefocus-3634	6	7	bond	bond	NOUN
finefocus-3634	6	8	,	,	PUNCT
finefocus-3634	6	9	two	two	NUM
finefocus-3634	6	10	separate	separate	ADJ
finefocus-3634	6	11	versions	version	NOUN
finefocus-3634	6	12	of	of	ADP
finefocus-3634	6	13	petase	petase	NOUN
finefocus-3634	6	14	–	–	PUNCT
finefocus-3634	6	15	one	one	NUM
finefocus-3634	6	16	containing	contain	VERB
finefocus-3634	6	17	the	the	DET
finefocus-3634	6	18	disulfide	disulfide	NOUN
finefocus-3634	6	19	bond	bond	NOUN
finefocus-3634	6	20	,	,	PUNCT
finefocus-3634	6	21	and	and	CCONJ
finefocus-3634	6	22	the	the	DET
finefocus-3634	6	23	other	other	ADJ
finefocus-3634	6	24	without	without	ADP
finefocus-3634	6	25	the	the	DET
finefocus-3634	6	26	disulfide	disulfide	NOUN
finefocus-3634	6	27	bond	bond	NOUN
finefocus-3634	6	28	were	be	AUX
finefocus-3634	6	29	modeled	model	VERB
finefocus-3634	6	30	using	use	VERB
finefocus-3634	6	31	pymol	pymol	NOUN
finefocus-3634	6	32	™	™	NOUN
finefocus-3634	6	33	,	,	PUNCT
finefocus-3634	6	34	synthesized	synthesize	VERB
finefocus-3634	6	35	,	,	PUNCT
finefocus-3634	6	36	and	and	CCONJ
finefocus-3634	6	37	tested	test	VERB
finefocus-3634	6	38	for	for	ADP
finefocus-3634	6	39	degradation	degradation	NOUN
finefocus-3634	6	40	of	of	ADP
finefocus-3634	6	41	pet	pet	ADJ
finefocus-3634	6	42	surrogate	surrogate	ADJ
finefocus-3634	6	43	compound	compound	NOUN
finefocus-3634	6	44	,	,	PUNCT
finefocus-3634	6	45	bis	bis	X
finefocus-3634	6	46	(	(	PUNCT
finefocus-3634	6	47	2	2	NUM
finefocus-3634	6	48	-	-	PUNCT
finefocus-3634	6	49	hydroxyethyl	hydroxyethyl	NOUN
finefocus-3634	6	50	)	)	PUNCT
finefocus-3634	6	51	terephthalate	terephthalate	NOUN
finefocus-3634	6	52	(	(	PUNCT
finefocus-3634	6	53	bhet	bhet	NOUN
finefocus-3634	6	54	)	)	PUNCT
finefocus-3634	6	55	.	.	PUNCT
finefocus-3634	7	1	several	several	ADJ
finefocus-3634	7	2	experiments	experiment	NOUN
finefocus-3634	7	3	were	be	AUX
finefocus-3634	7	4	performed	perform	VERB
finefocus-3634	7	5	in	in	ADP
finefocus-3634	7	6	the	the	DET
finefocus-3634	7	7	presence	presence	NOUN
finefocus-3634	7	8	and	and	CCONJ
finefocus-3634	7	9	absence	absence	NOUN
finefocus-3634	7	10	of	of	ADP
finefocus-3634	7	11	phenylmethylsulfonyl	phenylmethylsulfonyl	NOUN
finefocus-3634	7	12	fluoride	fluoride	NOUN
finefocus-3634	7	13	(	(	PUNCT
finefocus-3634	7	14	pmsf	pmsf	NOUN
finefocus-3634	7	15	)	)	PUNCT
finefocus-3634	7	16	,	,	PUNCT
finefocus-3634	7	17	a	a	DET
finefocus-3634	7	18	serine	serine	NOUN
finefocus-3634	7	19	protease	protease	NOUN
finefocus-3634	7	20	.	.	PUNCT
finefocus-3634	8	1	the	the	DET
finefocus-3634	8	2	results	result	NOUN
finefocus-3634	8	3	reveal	reveal	VERB
finefocus-3634	8	4	that	that	SCONJ
finefocus-3634	8	5	the	the	DET
finefocus-3634	8	6	role	role	NOUN
finefocus-3634	8	7	of	of	ADP
finefocus-3634	8	8	the	the	DET
finefocus-3634	8	9	disulfide	disulfide	NOUN
finefocus-3634	8	10	bond	bond	NOUN
finefocus-3634	8	11	in	in	ADP
finefocus-3634	8	12	the	the	DET
finefocus-3634	8	13	degradation	degradation	NOUN
finefocus-3634	8	14	of	of	ADP
finefocus-3634	8	15	bhet	bhet	NOUN
finefocus-3634	8	16	’s	’s	PART
finefocus-3634	8	17	ester	ester	NOUN
finefocus-3634	8	18	linkage	linkage	NOUN
finefocus-3634	8	19	is	be	AUX
finefocus-3634	8	20	insignificant	insignificant	ADJ
finefocus-3634	8	21	and	and	CCONJ
finefocus-3634	8	22	the	the	DET
finefocus-3634	8	23	variation	variation	NOUN
finefocus-3634	8	24	in	in	ADP
finefocus-3634	8	25	the	the	DET
finefocus-3634	8	26	results	result	NOUN
finefocus-3634	8	27	(	(	PUNCT
finefocus-3634	8	28	ethylene	ethylene	NOUN
finefocus-3634	8	29	glycol	glycol	NOUN
finefocus-3634	8	30	yields	yield	NOUN
finefocus-3634	8	31	,	,	PUNCT
finefocus-3634	8	32	bhet	bhet	ADJ
finefocus-3634	8	33	degradation	degradation	NOUN
finefocus-3634	8	34	per	per	ADP
finefocus-3634	8	35	microgram	microgram	NOUN
finefocus-3634	8	36	of	of	ADP
finefocus-3634	8	37	enzyme	enzyme	NOUN
finefocus-3634	8	38	)	)	PUNCT
finefocus-3634	8	39	are	be	AUX
finefocus-3634	8	40	within	within	ADP
finefocus-3634	8	41	the	the	DET
finefocus-3634	8	42	experimental	experimental	ADJ
finefocus-3634	8	43	uncertainty	uncertainty	NOUN
finefocus-3634	8	44	.	.	PUNCT
finefocus-3634	9	1	this	this	DET
finefocus-3634	9	2	finding	finding	NOUN
finefocus-3634	9	3	is	be	AUX
finefocus-3634	9	4	a	a	DET
finefocus-3634	9	5	stepping	stepping	ADJ
finefocus-3634	9	6	-	-	PUNCT
finefocus-3634	9	7	stone	stone	NOUN
finefocus-3634	9	8	to	to	AUX
finefocus-3634	9	9	further	far	ADV
finefocus-3634	9	10	modifying	modify	VERB
finefocus-3634	9	11	petase	petase	ADV
finefocus-3634	9	12	and	and	CCONJ
finefocus-3634	9	13	improving	improve	VERB
finefocus-3634	9	14	its	its	PRON
finefocus-3634	9	15	activity	activity	NOUN
finefocus-3634	9	16	towards	towards	ADP
finefocus-3634	9	17	commercial	commercial	ADJ
finefocus-3634	9	18	adaption	adaption	NOUN
finefocus-3634	9	19	of	of	ADP
finefocus-3634	9	20	this	this	DET
finefocus-3634	9	21	technology	technology	NOUN
finefocus-3634	9	22	for	for	ADP
finefocus-3634	9	23	pet	pet	NOUN
finefocus-3634	9	24	upcycling	upcycling	NOUN
finefocus-3634	9	25	and	and	CCONJ
finefocus-3634	9	26	creating	create	VERB
finefocus-3634	9	27	a	a	DET
finefocus-3634	9	28	circular	circular	ADJ
finefocus-3634	9	29	carbon	carbon	NOUN
finefocus-3634	9	30	economy	economy	NOUN
finefocus-3634	9	31	,	,	PUNCT
finefocus-3634	9	32	improving	improve	VERB
finefocus-3634	9	33	the	the	DET
finefocus-3634	9	34	world	world	NOUN
finefocus-3634	9	35	’s	’s	PART
finefocus-3634	9	36	carbon	carbon	NOUN
finefocus-3634	9	37	footprint	footprint	NOUN
finefocus-3634	9	38	,	,	PUNCT
finefocus-3634	9	39	and	and	CCONJ
finefocus-3634	9	40	mitigating	mitigate	VERB
finefocus-3634	9	41	ocean	ocean	NOUN
finefocus-3634	9	42	and	and	CCONJ
finefocus-3634	9	43	environmental	environmental	ADJ
finefocus-3634	9	44	plastic	plastic	NOUN
finefocus-3634	9	45	pollution	pollution	NOUN
finefocus-3634	9	46	.	.	PUNCT
finefocus-3634	10	1	88	88	NUM
finefocus-3634	11	1	i	i	PRON
finefocus-3634	11	2	fine	fine	ADJ
finefocus-3634	11	3	focus	focus	NOUN
finefocus-3634	11	4	introduction	introduction	NOUN
finefocus-3634	11	5	polyethylene	polyethylene	NOUN
finefocus-3634	11	6	terephthalate	terephthalate	NOUN
finefocus-3634	11	7	(	(	PUNCT
finefocus-3634	11	8	pet	pet	NOUN
finefocus-3634	11	9	)	)	PUNCT
finefocus-3634	11	10	is	be	AUX
finefocus-3634	11	11	one	one	NUM
finefocus-3634	11	12	of	of	ADP
finefocus-3634	11	13	the	the	DET
finefocus-3634	11	14	most	most	ADV
finefocus-3634	11	15	common	common	ADJ
finefocus-3634	11	16	consumer	consumer	NOUN
finefocus-3634	11	17	plastics	plastic	NOUN
finefocus-3634	11	18	,	,	PUNCT
finefocus-3634	11	19	which	which	PRON
finefocus-3634	11	20	has	have	VERB
finefocus-3634	11	21	a	a	DET
finefocus-3634	11	22	variety	variety	NOUN
finefocus-3634	11	23	of	of	ADP
finefocus-3634	11	24	uses	use	NOUN
finefocus-3634	11	25	ranging	range	VERB
finefocus-3634	11	26	from	from	ADP
finefocus-3634	11	27	plastic	plastic	ADJ
finefocus-3634	11	28	water	water	NOUN
finefocus-3634	11	29	bottles	bottle	NOUN
finefocus-3634	11	30	to	to	ADP
finefocus-3634	11	31	polyester	polyester	NOUN
finefocus-3634	11	32	clothing	clothing	NOUN
finefocus-3634	11	33	items.(paydar	items.(paydar	PROPN
finefocus-3634	11	34	&	&	CCONJ
finefocus-3634	11	35	olfati	olfati	PROPN
finefocus-3634	11	36	,	,	PUNCT
finefocus-3634	11	37	2018	2018	NUM
finefocus-3634	11	38	)	)	PUNCT
finefocus-3634	11	39	in	in	ADP
finefocus-3634	11	40	2013	2013	NUM
finefocus-3634	11	41	,	,	PUNCT
finefocus-3634	11	42	the	the	DET
finefocus-3634	11	43	worldwide	worldwide	ADJ
finefocus-3634	11	44	production	production	NOUN
finefocus-3634	11	45	of	of	ADP
finefocus-3634	11	46	plastic	plastic	NOUN
finefocus-3634	11	47	was	be	AUX
finefocus-3634	11	48	299	299	NUM
finefocus-3634	11	49	million	million	NUM
finefocus-3634	11	50	metric	metric	NOUN
finefocus-3634	11	51	tons.(chen	tons.(chen	ADP
finefocus-3634	11	52	et	et	NOUN
finefocus-3634	11	53	al	al	PROPN
finefocus-3634	11	54	.	.	PROPN
finefocus-3634	11	55	,	,	PUNCT
finefocus-3634	11	56	2018	2018	NUM
finefocus-3634	11	57	)	)	PUNCT
finefocus-3634	11	58	by	by	ADP
finefocus-3634	11	59	2015	2015	NUM
finefocus-3634	11	60	,	,	PUNCT
finefocus-3634	11	61	the	the	DET
finefocus-3634	11	62	worldwide	worldwide	ADJ
finefocus-3634	11	63	production	production	NOUN
finefocus-3634	11	64	had	have	AUX
finefocus-3634	11	65	reached	reach	VERB
finefocus-3634	11	66	322	322	NUM
finefocus-3634	11	67	million	million	NUM
finefocus-3634	11	68	metric	metric	ADJ
finefocus-3634	11	69	tons	ton	NOUN
finefocus-3634	11	70	per	per	ADP
finefocus-3634	11	71	year	year	NOUN
finefocus-3634	11	72	,	,	PUNCT
finefocus-3634	11	73	and	and	CCONJ
finefocus-3634	11	74	this	this	DET
finefocus-3634	11	75	amount	amount	NOUN
finefocus-3634	11	76	will	will	AUX
finefocus-3634	11	77	continue	continue	VERB
finefocus-3634	11	78	to	to	PART
finefocus-3634	11	79	increase	increase	VERB
finefocus-3634	11	80	.	.	PUNCT
finefocus-3634	12	1	despite	despite	SCONJ
finefocus-3634	12	2	plastic	plastic	NOUN
finefocus-3634	12	3	’s	’s	PART
finefocus-3634	12	4	versatile	versatile	ADJ
finefocus-3634	12	5	uses	use	NOUN
finefocus-3634	12	6	,	,	PUNCT
finefocus-3634	12	7	it	it	PRON
finefocus-3634	12	8	is	be	AUX
finefocus-3634	12	9	also	also	ADV
finefocus-3634	12	10	an	an	DET
finefocus-3634	12	11	environmentally	environmentally	ADV
finefocus-3634	12	12	hazardous	hazardous	ADJ
finefocus-3634	12	13	substance	substance	NOUN
finefocus-3634	12	14	because	because	SCONJ
finefocus-3634	12	15	it	it	PRON
finefocus-3634	12	16	does	do	AUX
finefocus-3634	12	17	not	not	PART
finefocus-3634	12	18	biodegrade	biodegrade	VERB
finefocus-3634	12	19	in	in	ADP
finefocus-3634	12	20	natural	natural	ADJ
finefocus-3634	12	21	ecosystems.(chen	ecosystems.(chen	PRON
finefocus-3634	12	22	et	et	PROPN
finefocus-3634	12	23	al	al	PROPN
finefocus-3634	12	24	.	.	PROPN
finefocus-3634	12	25	,	,	PUNCT
finefocus-3634	12	26	2018	2018	NUM
finefocus-3634	12	27	)	)	PUNCT
finefocus-3634	12	28	a	a	DET
finefocus-3634	12	29	small	small	ADJ
finefocus-3634	12	30	fraction	fraction	NOUN
finefocus-3634	12	31	of	of	ADP
finefocus-3634	12	32	post	post	ADJ
finefocus-3634	12	33	-	-	ADJ
finefocus-3634	12	34	consumed	consume	VERB
finefocus-3634	12	35	plastics	plastic	NOUN
finefocus-3634	12	36	is	be	AUX
finefocus-3634	12	37	currently	currently	ADV
finefocus-3634	12	38	recycled	recycle	VERB
finefocus-3634	12	39	,	,	PUNCT
finefocus-3634	12	40	mostly	mostly	ADV
finefocus-3634	12	41	by	by	ADP
finefocus-3634	12	42	physical	physical	ADJ
finefocus-3634	12	43	recycling	recycling	NOUN
finefocus-3634	12	44	.	.	PUNCT
finefocus-3634	13	1	physical	physical	ADJ
finefocus-3634	13	2	recycling	recycling	NOUN
finefocus-3634	13	3	refers	refer	VERB
finefocus-3634	13	4	to	to	ADP
finefocus-3634	13	5	the	the	DET
finefocus-3634	13	6	process	process	NOUN
finefocus-3634	13	7	of	of	ADP
finefocus-3634	13	8	melting	melting	NOUN
finefocus-3634	13	9	and	and	CCONJ
finefocus-3634	13	10	then	then	ADV
finefocus-3634	13	11	re	re	VERB
finefocus-3634	13	12	-	-	VERB
finefocus-3634	13	13	shaping	shape	VERB
finefocus-3634	13	14	the	the	DET
finefocus-3634	13	15	plastic	plastic	NOUN
finefocus-3634	13	16	into	into	ADP
finefocus-3634	13	17	new	new	ADJ
finefocus-3634	13	18	consumer	consumer	NOUN
finefocus-3634	13	19	products	product	NOUN
finefocus-3634	13	20	.	.	PUNCT
finefocus-3634	14	1	for	for	ADP
finefocus-3634	14	2	example	example	NOUN
finefocus-3634	14	3	,	,	PUNCT
finefocus-3634	14	4	waste	waste	VERB
finefocus-3634	14	5	pet	pet	ADJ
finefocus-3634	14	6	plastic	plastic	NOUN
finefocus-3634	14	7	bottles	bottle	NOUN
finefocus-3634	14	8	can	can	AUX
finefocus-3634	14	9	be	be	AUX
finefocus-3634	14	10	melted	melt	VERB
finefocus-3634	14	11	to	to	PART
finefocus-3634	14	12	make	make	VERB
finefocus-3634	14	13	polyester	polyester	NOUN
finefocus-3634	14	14	carpeting.(tullo	carpeting.(tullo	NOUN
finefocus-3634	14	15	,	,	PUNCT
finefocus-3634	14	16	2019	2019	NUM
finefocus-3634	14	17	)	)	PUNCT
finefocus-3634	14	18	this	this	DET
finefocus-3634	14	19	method	method	NOUN
finefocus-3634	14	20	of	of	ADP
finefocus-3634	14	21	recycling	recycling	NOUN
finefocus-3634	14	22	introduces	introduce	NOUN
finefocus-3634	14	23	impurities	impurity	NOUN
finefocus-3634	14	24	,	,	PUNCT
finefocus-3634	14	25	ultimately	ultimately	ADV
finefocus-3634	14	26	reducing	reduce	VERB
finefocus-3634	14	27	its	its	PRON
finefocus-3634	14	28	quality	quality	NOUN
finefocus-3634	14	29	and	and	CCONJ
finefocus-3634	14	30	value	value	NOUN
finefocus-3634	14	31	.	.	PUNCT
finefocus-3634	15	1	as	as	ADP
finefocus-3634	15	2	a	a	DET
finefocus-3634	15	3	result	result	NOUN
finefocus-3634	15	4	of	of	ADP
finefocus-3634	15	5	these	these	DET
finefocus-3634	15	6	challenges	challenge	NOUN
finefocus-3634	15	7	,	,	PUNCT
finefocus-3634	15	8	only	only	ADV
finefocus-3634	15	9	18.4	18.4	NUM
finefocus-3634	15	10	%	%	NOUN
finefocus-3634	15	11	of	of	ADP
finefocus-3634	15	12	pet	pet	NOUN
finefocus-3634	15	13	is	be	AUX
finefocus-3634	15	14	recycled	recycle	VERB
finefocus-3634	15	15	annually	annually	ADV
finefocus-3634	15	16	.	.	PUNCT
finefocus-3634	16	1	(	(	PUNCT
finefocus-3634	16	2	tullo	tullo	NOUN
finefocus-3634	16	3	,	,	PUNCT
finefocus-3634	16	4	2019	2019	NUM
finefocus-3634	16	5	)	)	PUNCT
finefocus-3634	16	6	all	all	DET
finefocus-3634	16	7	large	large	ADJ
finefocus-3634	16	8	-	-	PUNCT
finefocus-3634	16	9	scale	scale	NOUN
finefocus-3634	16	10	pet	pet	ADJ
finefocus-3634	16	11	recycling	recycling	NOUN
finefocus-3634	16	12	today	today	NOUN
finefocus-3634	16	13	is	be	AUX
finefocus-3634	16	14	physical	physical	ADJ
finefocus-3634	16	15	recycling	recycling	NOUN
finefocus-3634	16	16	,	,	PUNCT
finefocus-3634	16	17	and	and	CCONJ
finefocus-3634	16	18	due	due	ADP
finefocus-3634	16	19	to	to	ADP
finefocus-3634	16	20	the	the	DET
finefocus-3634	16	21	lower	low	ADJ
finefocus-3634	16	22	quality	quality	NOUN
finefocus-3634	16	23	end	end	NOUN
finefocus-3634	16	24	product	product	NOUN
finefocus-3634	16	25	,	,	PUNCT
finefocus-3634	16	26	most	most	ADJ
finefocus-3634	16	27	manufacturers	manufacturer	NOUN
finefocus-3634	16	28	produce	produce	VERB
finefocus-3634	16	29	new	new	ADJ
finefocus-3634	16	30	pet	pet	NOUN
finefocus-3634	16	31	from	from	ADP
finefocus-3634	16	32	monomers	monomer	NOUN
finefocus-3634	16	33	,	,	PUNCT
finefocus-3634	16	34	derived	derive	VERB
finefocus-3634	16	35	from	from	ADP
finefocus-3634	16	36	crude	crude	ADJ
finefocus-3634	16	37	oil	oil	NOUN
finefocus-3634	16	38	,	,	PUNCT
finefocus-3634	16	39	to	to	PART
finefocus-3634	16	40	meet	meet	VERB
finefocus-3634	16	41	the	the	DET
finefocus-3634	16	42	market	market	NOUN
finefocus-3634	16	43	demand	demand	NOUN
finefocus-3634	16	44	.	.	PUNCT
finefocus-3634	17	1	chemical	chemical	ADJ
finefocus-3634	17	2	recycling	recycling	NOUN
finefocus-3634	17	3	of	of	ADP
finefocus-3634	17	4	pet	pet	ADJ
finefocus-3634	17	5	plastic	plastic	NOUN
finefocus-3634	17	6	is	be	AUX
finefocus-3634	17	7	now	now	ADV
finefocus-3634	17	8	being	be	AUX
finefocus-3634	17	9	explored	explore	VERB
finefocus-3634	17	10	as	as	ADP
finefocus-3634	17	11	an	an	DET
finefocus-3634	17	12	alternative	alternative	NOUN
finefocus-3634	17	13	.	.	PUNCT
finefocus-3634	18	1	it	it	PRON
finefocus-3634	18	2	involves	involve	VERB
finefocus-3634	18	3	degradation	degradation	NOUN
finefocus-3634	18	4	of	of	ADP
finefocus-3634	18	5	pet	pet	NOUN
finefocus-3634	18	6	into	into	ADP
finefocus-3634	18	7	its	its	PRON
finefocus-3634	18	8	constituent	constituent	NOUN
finefocus-3634	18	9	monomers	monomer	NOUN
finefocus-3634	18	10	,	,	PUNCT
finefocus-3634	18	11	ethylene	ethylene	NOUN
finefocus-3634	18	12	glycol	glycol	NOUN
finefocus-3634	18	13	(	(	PUNCT
finefocus-3634	18	14	eg	eg	NOUN
finefocus-3634	18	15	)	)	PUNCT
finefocus-3634	18	16	and	and	CCONJ
finefocus-3634	18	17	terephthalic	terephthalic	ADJ
finefocus-3634	18	18	acid	acid	NOUN
finefocus-3634	18	19	(	(	PUNCT
finefocus-3634	18	20	tpa	tpa	PROPN
finefocus-3634	18	21	)	)	PUNCT
finefocus-3634	18	22	(	(	PUNCT
finefocus-3634	18	23	scheme	scheme	NOUN
finefocus-3634	18	24	1	1	NUM
finefocus-3634	18	25	)	)	PUNCT
finefocus-3634	18	26	.	.	PUNCT
finefocus-3634	19	1	the	the	DET
finefocus-3634	19	2	produced	produce	VERB
finefocus-3634	19	3	monomers	monomer	NOUN
finefocus-3634	19	4	can	can	AUX
finefocus-3634	19	5	be	be	AUX
finefocus-3634	19	6	chemically	chemically	ADV
finefocus-3634	19	7	re	re	VERB
finefocus-3634	19	8	-	-	VERB
finefocus-3634	19	9	bonded	bond	VERB
finefocus-3634	19	10	to	to	PART
finefocus-3634	19	11	form	form	VERB
finefocus-3634	19	12	pet	pet	ADJ
finefocus-3634	19	13	plastic	plastic	NOUN
finefocus-3634	19	14	of	of	ADP
finefocus-3634	19	15	the	the	DET
finefocus-3634	19	16	same	same	ADJ
finefocus-3634	19	17	caliber	caliber	NOUN
finefocus-3634	19	18	as	as	ADP
finefocus-3634	19	19	new	new	ADJ
finefocus-3634	19	20	pet	pet	NOUN
finefocus-3634	19	21	.	.	PUNCT
finefocus-3634	20	1	this	this	DET
finefocus-3634	20	2	advantage	advantage	NOUN
finefocus-3634	20	3	makes	make	VERB
finefocus-3634	20	4	chemical	chemical	ADJ
finefocus-3634	20	5	recycling	recycling	NOUN
finefocus-3634	20	6	preferable	preferable	ADJ
finefocus-3634	20	7	to	to	ADP
finefocus-3634	20	8	physical	physical	ADJ
finefocus-3634	20	9	recycling	recycling	NOUN
finefocus-3634	20	10	.	.	PUNCT
finefocus-3634	21	1	chemical	chemical	ADJ
finefocus-3634	21	2	recycling	recycling	NOUN
finefocus-3634	21	3	is	be	AUX
finefocus-3634	21	4	not	not	PART
finefocus-3634	21	5	used	use	VERB
finefocus-3634	21	6	in	in	ADP
finefocus-3634	21	7	large	large	ADJ
finefocus-3634	21	8	-	-	PUNCT
finefocus-3634	21	9	scale	scale	NOUN
finefocus-3634	21	10	facilities	facility	NOUN
finefocus-3634	21	11	due	due	ADP
finefocus-3634	21	12	to	to	ADP
finefocus-3634	21	13	the	the	DET
finefocus-3634	21	14	lack	lack	NOUN
finefocus-3634	21	15	of	of	ADP
finefocus-3634	21	16	an	an	DET
finefocus-3634	21	17	effective	effective	ADJ
finefocus-3634	21	18	technology	technology	NOUN
finefocus-3634	21	19	as	as	ADV
finefocus-3634	21	20	well	well	ADV
finefocus-3634	21	21	as	as	ADP
finefocus-3634	21	22	use	use	NOUN
finefocus-3634	21	23	of	of	ADP
finefocus-3634	21	24	corrosive	corrosive	ADJ
finefocus-3634	21	25	chemicals	chemical	NOUN
finefocus-3634	21	26	such	such	ADJ
finefocus-3634	21	27	as	as	ADP
finefocus-3634	21	28	sodium	sodium	NOUN
finefocus-3634	21	29	hydroxide	hydroxide	NOUN
finefocus-3634	21	30	,	,	PUNCT
finefocus-3634	21	31	and	and	CCONJ
finefocus-3634	21	32	harsh	harsh	ADJ
finefocus-3634	21	33	reaction	reaction	NOUN
finefocus-3634	21	34	conditions	condition	NOUN
finefocus-3634	21	35	(	(	PUNCT
finefocus-3634	21	36	e.g.	e.g.	ADV
finefocus-3634	21	37	,	,	PUNCT
finefocus-3634	21	38	high	high	ADJ
finefocus-3634	21	39	pressure	pressure	NOUN
finefocus-3634	21	40	requiring	require	VERB
finefocus-3634	21	41	expensive	expensive	ADJ
finefocus-3634	21	42	reactors).(khoonkari	reactors).(khoonkari	X
finefocus-3634	21	43	et	et	X
finefocus-3634	21	44	al	al	PROPN
finefocus-3634	21	45	.	.	PROPN
finefocus-3634	21	46	,	,	PUNCT
finefocus-3634	21	47	2015	2015	NUM
finefocus-3634	21	48	)	)	PUNCT
finefocus-3634	21	49	glycolysis	glycolysis	NOUN
finefocus-3634	21	50	is	be	AUX
finefocus-3634	21	51	the	the	DET
finefocus-3634	21	52	most	most	ADV
finefocus-3634	21	53	efficient	efficient	ADJ
finefocus-3634	21	54	method	method	NOUN
finefocus-3634	21	55	of	of	ADP
finefocus-3634	21	56	depolymerizing	depolymerize	VERB
finefocus-3634	21	57	pet,(khoonkari	pet,(khoonkari	PROPN
finefocus-3634	21	58	et	et	PROPN
finefocus-3634	21	59	al	al	PROPN
finefocus-3634	21	60	.	.	PROPN
finefocus-3634	21	61	,	,	PUNCT
finefocus-3634	21	62	2015	2015	NUM
finefocus-3634	21	63	)	)	PUNCT
finefocus-3634	21	64	which	which	PRON
finefocus-3634	21	65	is	be	AUX
finefocus-3634	21	66	done	do	VERB
finefocus-3634	21	67	at	at	ADP
finefocus-3634	21	68	high	high	ADJ
finefocus-3634	21	69	temperature	temperature	NOUN
finefocus-3634	21	70	(	(	PUNCT
finefocus-3634	21	71	180	180	NUM
finefocus-3634	22	1	°	°	NOUN
finefocus-3634	22	2	c	c	NOUN
finefocus-3634	22	3	to	to	ADP
finefocus-3634	22	4	240	240	NUM
finefocus-3634	22	5	°	°	NUM
finefocus-3634	22	6	c).(khoonkari	c).(khoonkari	X
finefocus-3634	22	7	et	et	PROPN
finefocus-3634	22	8	al	al	PROPN
finefocus-3634	22	9	.	.	PROPN
finefocus-3634	22	10	,	,	PUNCT
finefocus-3634	22	11	2015	2015	NUM
finefocus-3634	22	12	)	)	PUNCT
finefocus-3634	22	13	ionic	ionic	ADJ
finefocus-3634	22	14	liquids	liquid	NOUN
finefocus-3634	22	15	such	such	ADJ
finefocus-3634	22	16	as	as	ADP
finefocus-3634	22	17	1	1	NUM
finefocus-3634	22	18	-	-	PUNCT
finefocus-3634	22	19	butyl-3	butyl-3	NUM
finefocus-3634	22	20	-	-	PUNCT
finefocus-3634	22	21	methylimidazolium	methylimidazolium	NOUN
finefocus-3634	22	22	bromide	bromide	NOUN
finefocus-3634	22	23	(	(	PUNCT
finefocus-3634	22	24	[	[	X
finefocus-3634	22	25	bmim	bmim	NOUN
finefocus-3634	22	26	]	]	X
finefocus-3634	22	27	br	br	X
finefocus-3634	22	28	)	)	PUNCT
finefocus-3634	22	29	have	have	AUX
finefocus-3634	22	30	been	be	AUX
finefocus-3634	22	31	used	use	VERB
finefocus-3634	22	32	as	as	ADP
finefocus-3634	22	33	catalysts	catalyst	NOUN
finefocus-3634	22	34	for	for	ADP
finefocus-3634	22	35	pet	pet	ADJ
finefocus-3634	22	36	glycolysis	glycolysis	NOUN
finefocus-3634	22	37	.	.	PUNCT
finefocus-3634	23	1	wang	wang	PROPN
finefocus-3634	23	2	et	et	PROPN
finefocus-3634	23	3	al	al	PROPN
finefocus-3634	23	4	.	.	PROPN
finefocus-3634	23	5	used	use	VERB
finefocus-3634	23	6	[	[	X
finefocus-3634	23	7	bmim	bmim	NOUN
finefocus-3634	23	8	]	]	PUNCT
finefocus-3634	23	9	br	br	NOUN
finefocus-3634	23	10	to	to	PART
finefocus-3634	23	11	degrade	degrade	VERB
finefocus-3634	23	12	100	100	NUM
finefocus-3634	23	13	%	%	NOUN
finefocus-3634	23	14	of	of	ADP
finefocus-3634	23	15	pet	pet	NOUN
finefocus-3634	23	16	in	in	ADP
finefocus-3634	23	17	8	8	NUM
finefocus-3634	23	18	hours	hour	NOUN
finefocus-3634	23	19	at	at	ADP
finefocus-3634	23	20	180	180	NUM
finefocus-3634	23	21	°	°	NOUN
finefocus-3634	23	22	c.(khoonkari	c.(khoonkari	ADJ
finefocus-3634	23	23	et	et	PROPN
finefocus-3634	23	24	al	al	PROPN
finefocus-3634	23	25	.	.	PROPN
finefocus-3634	23	26	,	,	PUNCT
finefocus-3634	23	27	2015	2015	NUM
finefocus-3634	23	28	)	)	PUNCT
finefocus-3634	23	29	this	this	DET
finefocus-3634	23	30	reaction	reaction	NOUN
finefocus-3634	23	31	depolymerized	depolymerize	VERB
finefocus-3634	23	32	long	long	ADJ
finefocus-3634	23	33	ester	ester	NOUN
finefocus-3634	23	34	chain	chain	NOUN
finefocus-3634	23	35	of	of	ADP
finefocus-3634	23	36	pet	pet	NOUN
finefocus-3634	23	37	into	into	ADP
finefocus-3634	23	38	short	short	ADJ
finefocus-3634	23	39	chain	chain	NOUN
finefocus-3634	23	40	ester	ester	NOUN
finefocus-3634	23	41	intermediates	intermediate	NOUN
finefocus-3634	23	42	and	and	CCONJ
finefocus-3634	23	43	did	do	AUX
finefocus-3634	23	44	not	not	PART
finefocus-3634	23	45	fully	fully	ADV
finefocus-3634	23	46	degrade	degrade	VERB
finefocus-3634	23	47	to	to	PART
finefocus-3634	23	48	produce	produce	VERB
finefocus-3634	23	49	desired	desire	VERB
finefocus-3634	23	50	eg	eg	NOUN
finefocus-3634	23	51	and	and	CCONJ
finefocus-3634	23	52	tpa	tpa	PROPN
finefocus-3634	23	53	.	.	PUNCT
finefocus-3634	24	1	despite	despite	SCONJ
finefocus-3634	24	2	glycolysis	glycolysis	NOUN
finefocus-3634	24	3	showing	show	VERB
finefocus-3634	24	4	high	high	ADJ
finefocus-3634	24	5	depolymerization	depolymerization	NOUN
finefocus-3634	24	6	yields	yield	NOUN
finefocus-3634	24	7	,	,	PUNCT
finefocus-3634	24	8	because	because	SCONJ
finefocus-3634	24	9	it	it	PRON
finefocus-3634	24	10	does	do	AUX
finefocus-3634	24	11	not	not	PART
finefocus-3634	24	12	totally	totally	ADV
finefocus-3634	24	13	degrade	degrade	VERB
finefocus-3634	24	14	pet	pet	NOUN
finefocus-3634	24	15	,	,	PUNCT
finefocus-3634	24	16	and	and	CCONJ
finefocus-3634	24	17	necessitates	necessitate	VERB
finefocus-3634	24	18	high	high	ADJ
finefocus-3634	24	19	energy	energy	NOUN
finefocus-3634	24	20	(	(	PUNCT
finefocus-3634	24	21	up	up	ADP
finefocus-3634	24	22	to	to	PART
finefocus-3634	24	23	240	240	NUM
finefocus-3634	24	24	°	°	NOUN
finefocus-3634	24	25	c	c	NOUN
finefocus-3634	24	26	)	)	PUNCT
finefocus-3634	24	27	,	,	PUNCT
finefocus-3634	24	28	more	more	ADJ
finefocus-3634	24	29	energy	energy	NOUN
finefocus-3634	24	30	efficient	efficient	ADJ
finefocus-3634	24	31	and	and	CCONJ
finefocus-3634	24	32	effective	effective	ADJ
finefocus-3634	24	33	alternative	alternative	ADJ
finefocus-3634	24	34	methods	method	NOUN
finefocus-3634	24	35	have	have	AUX
finefocus-3634	24	36	been	be	AUX
finefocus-3634	24	37	explored	explore	VERB
finefocus-3634	24	38	for	for	ADP
finefocus-3634	24	39	chemical	chemical	NOUN
finefocus-3634	24	40	recycling	recycling	NOUN
finefocus-3634	24	41	of	of	ADP
finefocus-3634	24	42	pet	pet	NOUN
finefocus-3634	24	43	.	.	PUNCT
finefocus-3634	25	1	one	one	NUM
finefocus-3634	25	2	such	such	ADJ
finefocus-3634	25	3	method	method	NOUN
finefocus-3634	25	4	is	be	AUX
finefocus-3634	25	5	enzymatic	enzymatic	ADJ
finefocus-3634	25	6	degradation	degradation	NOUN
finefocus-3634	25	7	of	of	ADP
finefocus-3634	25	8	pet.(kawai	pet.(kawai	X
finefocus-3634	25	9	et	et	PROPN
finefocus-3634	25	10	al	al	PROPN
finefocus-3634	25	11	.	.	PROPN
finefocus-3634	25	12	,	,	PUNCT
finefocus-3634	25	13	2020	2020	NUM
finefocus-3634	25	14	;	;	PUNCT
finefocus-3634	25	15	taniguchi	taniguchi	PROPN
finefocus-3634	25	16	et	et	PROPN
finefocus-3634	25	17	al	al	PROPN
finefocus-3634	25	18	.	.	PROPN
finefocus-3634	25	19	,	,	PUNCT
finefocus-3634	25	20	2019	2019	NUM
finefocus-3634	25	21	)	)	PUNCT
finefocus-3634	25	22	this	this	DET
finefocus-3634	25	23	method	method	NOUN
finefocus-3634	25	24	reduces	reduce	VERB
finefocus-3634	25	25	the	the	DET
finefocus-3634	25	26	activation	activation	NOUN
finefocus-3634	25	27	energy	energy	NOUN
finefocus-3634	25	28	of	of	ADP
finefocus-3634	25	29	the	the	DET
finefocus-3634	25	30	reaction	reaction	NOUN
finefocus-3634	25	31	,	,	PUNCT
finefocus-3634	25	32	requires	require	VERB
finefocus-3634	25	33	no	no	DET
finefocus-3634	25	34	pressure	pressure	NOUN
finefocus-3634	25	35	,	,	PUNCT
finefocus-3634	25	36	and	and	CCONJ
finefocus-3634	25	37	involves	involve	VERB
finefocus-3634	25	38	equipment	equipment	NOUN
finefocus-3634	25	39	which	which	PRON
finefocus-3634	25	40	is	be	AUX
finefocus-3634	25	41	inexpensive	inexpensive	ADJ
finefocus-3634	25	42	and	and	CCONJ
finefocus-3634	25	43	commonly	commonly	ADV
finefocus-3634	25	44	available	available	ADJ
finefocus-3634	25	45	.	.	PUNCT
finefocus-3634	26	1	enzymatic	enzymatic	ADJ
finefocus-3634	26	2	degradation	degradation	NOUN
finefocus-3634	26	3	of	of	ADP
finefocus-3634	26	4	pet	pet	ADJ
finefocus-3634	26	5	film	film	NOUN
finefocus-3634	26	6	was	be	AUX
finefocus-3634	26	7	first	first	ADV
finefocus-3634	26	8	accomplished	accomplish	VERB
finefocus-3634	26	9	by	by	ADP
finefocus-3634	26	10	muller	muller	NOUN
finefocus-3634	26	11	in	in	ADP
finefocus-3634	26	12	2005.(kawai	2005.(kawai	PROPN
finefocus-3634	26	13	et	et	PROPN
finefocus-3634	26	14	al	al	PROPN
finefocus-3634	26	15	.	.	PROPN
finefocus-3634	26	16	,	,	PUNCT
finefocus-3634	26	17	2019	2019	NUM
finefocus-3634	26	18	;	;	PUNCT
finefocus-3634	26	19	müller	müller	PROPN
finefocus-3634	26	20	et	et	PROPN
finefocus-3634	26	21	al	al	PROPN
finefocus-3634	26	22	.	.	PROPN
finefocus-3634	26	23	,	,	PUNCT
finefocus-3634	26	24	2005	2005	NUM
finefocus-3634	26	25	)	)	PUNCT
finefocus-3634	26	26	their	their	PRON
finefocus-3634	26	27	method	method	NOUN
finefocus-3634	26	28	depolymerized	depolymerize	VERB
finefocus-3634	26	29	two	two	NUM
finefocus-3634	26	30	kinds	kind	NOUN
finefocus-3634	26	31	of	of	ADP
finefocus-3634	26	32	pet	pet	ADJ
finefocus-3634	26	33	films	film	NOUN
finefocus-3634	26	34	by	by	ADP
finefocus-3634	26	35	approximately	approximately	ADV
finefocus-3634	26	36	40–50	40–50	NUM
finefocus-3634	26	37	%	%	NOUN
finefocus-3634	26	38	at	at	ADP
finefocus-3634	26	39	55	55	NUM
finefocus-3634	26	40	°	°	NOUN
finefocus-3634	26	41	c	c	NOUN
finefocus-3634	26	42	in	in	ADP
finefocus-3634	26	43	3	3	NUM
finefocus-3634	26	44	weeks	week	NOUN
finefocus-3634	26	45	using	use	VERB
finefocus-3634	26	46	cutinase	cutinase	NOUN
finefocus-3634	26	47	obtained	obtain	VERB
finefocus-3634	26	48	from	from	ADP
finefocus-3634	26	49	the	the	DET
finefocus-3634	26	50	bacterium	bacterium	NOUN
finefocus-3634	26	51	thermobifida	thermobifida	NOUN
finefocus-3634	26	52	fusca	fusca	NOUN
finefocus-3634	26	53	.	.	PUNCT
finefocus-3634	27	1	(	(	PUNCT
finefocus-3634	27	2	kawai	kawai	PROPN
finefocus-3634	27	3	et	et	PROPN
finefocus-3634	27	4	al	al	PROPN
finefocus-3634	27	5	.	.	PROPN
finefocus-3634	27	6	,	,	PUNCT
finefocus-3634	27	7	2019	2019	NUM
finefocus-3634	27	8	;	;	PUNCT
finefocus-3634	27	9	müller	müller	PROPN
finefocus-3634	27	10	et	et	PROPN
finefocus-3634	27	11	al	al	PROPN
finefocus-3634	27	12	.	.	PROPN
finefocus-3634	27	13	,	,	PUNCT
finefocus-3634	27	14	2005	2005	NUM
finefocus-3634	27	15	)	)	PUNCT
finefocus-3634	27	16	since	since	SCONJ
finefocus-3634	27	17	then	then	ADV
finefocus-3634	27	18	,	,	PUNCT
finefocus-3634	27	19	several	several	ADJ
finefocus-3634	27	20	thermostable	thermostable	NOUN
finefocus-3634	27	21	cutinases	cutinase	NOUN
finefocus-3634	27	22	have	have	AUX
finefocus-3634	27	23	been	be	AUX
finefocus-3634	27	24	discovered	discover	VERB
finefocus-3634	27	25	with	with	ADP
finefocus-3634	27	26	an	an	DET
finefocus-3634	27	27	ability	ability	NOUN
finefocus-3634	27	28	scheme	scheme	NOUN
finefocus-3634	27	29	1	1	NUM
finefocus-3634	27	30	.	.	X
finefocus-3634	27	31	pet	pet	ADJ
finefocus-3634	27	32	breakdown	breakdown	NOUN
finefocus-3634	27	33	to	to	ADP
finefocus-3634	27	34	terephthalic	terephthalic	ADJ
finefocus-3634	27	35	acid	acid	NOUN
finefocus-3634	27	36	(	(	PUNCT
finefocus-3634	27	37	tpa	tpa	PROPN
finefocus-3634	27	38	)	)	PUNCT
finefocus-3634	27	39	and	and	CCONJ
finefocus-3634	27	40	ethylene	ethylene	NOUN
finefocus-3634	27	41	glycol	glycol	NOUN
finefocus-3634	27	42	(	(	PUNCT
finefocus-3634	27	43	eg	eg	NOUN
finefocus-3634	27	44	)	)	PUNCT
finefocus-3634	27	45	.	.	PUNCT
finefocus-3634	28	1	vol	vol	NOUN
finefocus-3634	28	2	8	8	NUM
finefocus-3634	29	1	i	i	PRON
finefocus-3634	29	2	89	89	NUM
finefocus-3634	29	3	to	to	PART
finefocus-3634	29	4	break	break	VERB
finefocus-3634	29	5	down	down	ADP
finefocus-3634	29	6	pet	pet	ADJ
finefocus-3634	29	7	film,(furukawa	film,(furukawa	PROPN
finefocus-3634	29	8	et	et	NOUN
finefocus-3634	29	9	al	al	PROPN
finefocus-3634	29	10	.	.	PROPN
finefocus-3634	29	11	,	,	PUNCT
finefocus-3634	29	12	2019	2019	NUM
finefocus-3634	29	13	;	;	PUNCT
finefocus-3634	29	14	ribitsch	ribitsch	PROPN
finefocus-3634	29	15	et	et	PROPN
finefocus-3634	29	16	al	al	PROPN
finefocus-3634	29	17	.	.	PROPN
finefocus-3634	29	18	,	,	PUNCT
finefocus-3634	29	19	2012	2012	NUM
finefocus-3634	29	20	)	)	PUNCT
finefocus-3634	29	21	but	but	CCONJ
finefocus-3634	29	22	their	their	PRON
finefocus-3634	29	23	degradation	degradation	NOUN
finefocus-3634	29	24	rates	rate	NOUN
finefocus-3634	29	25	for	for	ADP
finefocus-3634	29	26	pet	pet	NOUN
finefocus-3634	29	27	are	be	AUX
finefocus-3634	29	28	lower	low	ADJ
finefocus-3634	29	29	than	than	ADP
finefocus-3634	29	30	that	that	PRON
finefocus-3634	29	31	with	with	ADP
finefocus-3634	29	32	cutin	cutin	NOUN
finefocus-3634	29	33	.	.	PUNCT
finefocus-3634	30	1	recently	recently	ADV
finefocus-3634	30	2	,	,	PUNCT
finefocus-3634	30	3	a	a	DET
finefocus-3634	30	4	gram	gram	NOUN
finefocus-3634	30	5	-	-	PUNCT
finefocus-3634	30	6	negative	negative	ADJ
finefocus-3634	30	7	bacterium	bacterium	NOUN
finefocus-3634	30	8	,	,	PUNCT
finefocus-3634	30	9	ideonella	ideonella	NOUN
finefocus-3634	30	10	sakaiensis	sakaiensis	VERB
finefocus-3634	30	11	201	201	NUM
finefocus-3634	30	12	-	-	PUNCT
finefocus-3634	30	13	f6	f6	PROPN
finefocus-3634	30	14	was	be	AUX
finefocus-3634	30	15	isolated	isolate	VERB
finefocus-3634	30	16	that	that	SCONJ
finefocus-3634	30	17	can	can	AUX
finefocus-3634	30	18	consume	consume	VERB
finefocus-3634	30	19	pet	pet	NOUN
finefocus-3634	30	20	as	as	ADP
finefocus-3634	30	21	an	an	DET
finefocus-3634	30	22	energy	energy	NOUN
finefocus-3634	30	23	and	and	CCONJ
finefocus-3634	30	24	carbon	carbon	NOUN
finefocus-3634	30	25	source	source	NOUN
finefocus-3634	30	26	to	to	PART
finefocus-3634	30	27	survive.(yoshida	survive.(yoshida	PROPN
finefocus-3634	30	28	et	et	PROPN
finefocus-3634	30	29	al	al	PROPN
finefocus-3634	30	30	.	.	PROPN
finefocus-3634	30	31	,	,	PUNCT
finefocus-3634	30	32	2016	2016	NUM
finefocus-3634	30	33	)	)	PUNCT
finefocus-3634	30	34	research	research	NOUN
finefocus-3634	30	35	revealed	reveal	VERB
finefocus-3634	30	36	that	that	SCONJ
finefocus-3634	30	37	this	this	DET
finefocus-3634	30	38	bacterium	bacterium	NOUN
finefocus-3634	30	39	contains	contain	VERB
finefocus-3634	30	40	the	the	DET
finefocus-3634	30	41	enzyme	enzyme	NOUN
finefocus-3634	30	42	,	,	PUNCT
finefocus-3634	30	43	petase	petase	NOUN
finefocus-3634	30	44	,	,	PUNCT
finefocus-3634	30	45	which	which	PRON
finefocus-3634	30	46	can	can	AUX
finefocus-3634	30	47	biodegrade	biodegrade	VERB
finefocus-3634	30	48	pet	pet	NOUN
finefocus-3634	30	49	into	into	ADP
finefocus-3634	30	50	mono(ethylene	mono(ethylene	PROPN
finefocus-3634	30	51	terephthalate	terephthalate	NOUN
finefocus-3634	30	52	(	(	PUNCT
finefocus-3634	30	53	mhet	mhet	NOUN
finefocus-3634	30	54	)	)	PUNCT
finefocus-3634	30	55	and	and	CCONJ
finefocus-3634	30	56	(	(	PUNCT
finefocus-3634	30	57	bis(2	bis(2	NOUN
finefocus-3634	30	58	-	-	PUNCT
finefocus-3634	30	59	hydroxyethyl	hydroxyethyl	NOUN
finefocus-3634	30	60	)	)	PUNCT
finefocus-3634	30	61	terephthalate	terephthalate	NOUN
finefocus-3634	30	62	)	)	PUNCT
finefocus-3634	30	63	(	(	PUNCT
finefocus-3634	30	64	bhet	bhet	NOUN
finefocus-3634	30	65	)	)	PUNCT
finefocus-3634	30	66	.	.	PUNCT
finefocus-3634	31	1	mhet	mhet	NOUN
finefocus-3634	31	2	and	and	CCONJ
finefocus-3634	31	3	bhet	bhet	NOUN
finefocus-3634	31	4	are	be	AUX
finefocus-3634	31	5	then	then	ADV
finefocus-3634	31	6	hydrolyzed	hydrolyze	VERB
finefocus-3634	31	7	into	into	ADP
finefocus-3634	31	8	eg	eg	NOUN
finefocus-3634	31	9	and	and	CCONJ
finefocus-3634	31	10	tpa	tpa	PROPN
finefocus-3634	31	11	.	.	PUNCT
finefocus-3634	32	1	(	(	PUNCT
finefocus-3634	32	2	yoshida	yoshida	PROPN
finefocus-3634	32	3	et	et	PROPN
finefocus-3634	32	4	al	al	PROPN
finefocus-3634	32	5	.	.	PROPN
finefocus-3634	32	6	,	,	PUNCT
finefocus-3634	32	7	2016	2016	NUM
finefocus-3634	32	8	)	)	PUNCT
finefocus-3634	32	9	200	200	NUM
finefocus-3634	32	10	nm	nm	NOUN
finefocus-3634	32	11	of	of	ADP
finefocus-3634	32	12	wild	wild	ADJ
finefocus-3634	32	13	type	type	NOUN
finefocus-3634	32	14	petase	petase	NOUN
finefocus-3634	32	15	enzyme	enzyme	NOUN
finefocus-3634	32	16	was	be	AUX
finefocus-3634	32	17	found	find	VERB
finefocus-3634	32	18	to	to	PART
finefocus-3634	32	19	degrade	degrade	VERB
finefocus-3634	32	20	3.7	3.7	NUM
finefocus-3634	32	21	mg	mg	PROPN
finefocus-3634	32	22	/	/	SYM
finefocus-3634	32	23	l	l	NOUN
finefocus-3634	32	24	of	of	ADP
finefocus-3634	32	25	pet	pet	NOUN
finefocus-3634	32	26	at	at	ADP
finefocus-3634	32	27	30	30	NUM
finefocus-3634	32	28	°	°	NOUN
finefocus-3634	32	29	c	c	NOUN
finefocus-3634	32	30	over	over	ADP
finefocus-3634	32	31	the	the	DET
finefocus-3634	32	32	course	course	NOUN
finefocus-3634	32	33	of	of	ADP
finefocus-3634	32	34	72	72	NUM
finefocus-3634	32	35	hours.(seo	hours.(seo	NOUN
finefocus-3634	32	36	et	et	PROPN
finefocus-3634	32	37	al	al	PROPN
finefocus-3634	32	38	.	.	PROPN
finefocus-3634	32	39	,	,	PUNCT
finefocus-3634	32	40	2019	2019	NUM
finefocus-3634	32	41	)	)	PUNCT
finefocus-3634	32	42	when	when	SCONJ
finefocus-3634	32	43	compared	compare	VERB
finefocus-3634	32	44	with	with	ADP
finefocus-3634	32	45	pet	pet	ADJ
finefocus-3634	32	46	degradation	degradation	NOUN
finefocus-3634	32	47	activity	activity	NOUN
finefocus-3634	32	48	of	of	ADP
finefocus-3634	32	49	all	all	DET
finefocus-3634	32	50	reported	report	VERB
finefocus-3634	32	51	enzymes	enzyme	NOUN
finefocus-3634	32	52	,	,	PUNCT
finefocus-3634	32	53	petase	petase	NOUN
finefocus-3634	32	54	demonstrated	demonstrate	VERB
finefocus-3634	32	55	the	the	DET
finefocus-3634	32	56	best	good	ADJ
finefocus-3634	32	57	performance	performance	NOUN
finefocus-3634	32	58	(	(	PUNCT
finefocus-3634	32	59	table	table	NOUN
finefocus-3634	32	60	1	1	NUM
finefocus-3634	32	61	)	)	PUNCT
finefocus-3634	32	62	.	.	PUNCT
finefocus-3634	33	1	petase	petase	NOUN
finefocus-3634	33	2	’s	’s	PART
finefocus-3634	33	3	active	active	ADJ
finefocus-3634	33	4	site	site	NOUN
finefocus-3634	33	5	is	be	AUX
finefocus-3634	33	6	composed	compose	VERB
finefocus-3634	33	7	of	of	ADP
finefocus-3634	33	8	a	a	DET
finefocus-3634	33	9	serine	serine	NOUN
finefocus-3634	33	10	-	-	PUNCT
finefocus-3634	33	11	histidineasparagine	histidineasparagine	NOUN
finefocus-3634	33	12	(	(	PUNCT
finefocus-3634	33	13	ser	ser	VERB
finefocus-3634	33	14	-	-	PUNCT
finefocus-3634	33	15	his	his	PRON
finefocus-3634	33	16	-	-	PUNCT
finefocus-3634	33	17	asp	asp	NOUN
finefocus-3634	33	18	)	)	PUNCT
finefocus-3634	33	19	triad	triad	PROPN
finefocus-3634	33	20	,	,	PUNCT
finefocus-3634	33	21	which	which	PRON
finefocus-3634	33	22	is	be	AUX
finefocus-3634	33	23	one	one	NUM
finefocus-3634	33	24	of	of	ADP
finefocus-3634	33	25	the	the	DET
finefocus-3634	33	26	most	most	ADV
finefocus-3634	33	27	commonly	commonly	ADV
finefocus-3634	33	28	studied	study	VERB
finefocus-3634	33	29	catalytic	catalytic	ADJ
finefocus-3634	33	30	triads	triad	NOUN
finefocus-3634	33	31	,	,	PUNCT
finefocus-3634	33	32	and	and	CCONJ
finefocus-3634	33	33	is	be	AUX
finefocus-3634	33	34	often	often	ADV
finefocus-3634	33	35	found	find	VERB
finefocus-3634	33	36	in	in	ADP
finefocus-3634	33	37	ɑ	ɑ	PROPN
finefocus-3634	33	38	/	/	SYM
finefocus-3634	33	39	β	β	PROPN
finefocus-3634	33	40	hydrolases.(jones	hydrolases.(jone	NOUN
finefocus-3634	33	41	&	&	CCONJ
finefocus-3634	33	42	solomon	solomon	PROPN
finefocus-3634	33	43	,	,	PUNCT
finefocus-3634	33	44	2015	2015	NUM
finefocus-3634	33	45	;	;	PUNCT
finefocus-3634	33	46	rauwerdink	rauwerdink	PROPN
finefocus-3634	33	47	&	&	CCONJ
finefocus-3634	33	48	kazlauskas	kazlauskas	PROPN
finefocus-3634	33	49	,	,	PUNCT
finefocus-3634	33	50	2015	2015	NUM
finefocus-3634	33	51	)	)	PUNCT
finefocus-3634	33	52	it	it	PRON
finefocus-3634	33	53	catalyzes	catalyze	VERB
finefocus-3634	33	54	a	a	DET
finefocus-3634	33	55	redox	redox	ADJ
finefocus-3634	33	56	reaction	reaction	NOUN
finefocus-3634	33	57	to	to	PART
finefocus-3634	33	58	break	break	VERB
finefocus-3634	33	59	the	the	DET
finefocus-3634	33	60	ester	ester	NOUN
finefocus-3634	33	61	bond	bond	NOUN
finefocus-3634	33	62	in	in	ADP
finefocus-3634	33	63	pet.(yoshida	pet.(yoshida	NUM
finefocus-3634	33	64	et	et	PROPN
finefocus-3634	33	65	al	al	PROPN
finefocus-3634	33	66	.	.	PROPN
finefocus-3634	33	67	,	,	PUNCT
finefocus-3634	33	68	2016	2016	NUM
finefocus-3634	33	69	)	)	PUNCT
finefocus-3634	33	70	the	the	DET
finefocus-3634	33	71	redox	redox	ADJ
finefocus-3634	33	72	process	process	NOUN
finefocus-3634	33	73	is	be	AUX
finefocus-3634	33	74	initiated	initiate	VERB
finefocus-3634	33	75	when	when	SCONJ
finefocus-3634	33	76	asparagine	asparagine	NOUN
finefocus-3634	33	77	removes	remove	VERB
finefocus-3634	33	78	a	a	DET
finefocus-3634	33	79	hydrogen	hydrogen	NOUN
finefocus-3634	33	80	atom	atom	NOUN
finefocus-3634	33	81	from	from	ADP
finefocus-3634	33	82	histidine	histidine	NOUN
finefocus-3634	33	83	;	;	PUNCT
finefocus-3634	33	84	thus	thus	ADV
finefocus-3634	33	85	,	,	PUNCT
finefocus-3634	33	86	effectively	effectively	ADV
finefocus-3634	33	87	removing	remove	VERB
finefocus-3634	33	88	a	a	DET
finefocus-3634	33	89	proton	proton	NOUN
finefocus-3634	33	90	and	and	CCONJ
finefocus-3634	33	91	an	an	DET
finefocus-3634	33	92	electron	electron	NOUN
finefocus-3634	33	93	.	.	PUNCT
finefocus-3634	34	1	the	the	DET
finefocus-3634	34	2	histidine	histidine	NOUN
finefocus-3634	34	3	then	then	ADV
finefocus-3634	34	4	replaces	replace	VERB
finefocus-3634	34	5	its	its	PRON
finefocus-3634	34	6	hydrogen	hydrogen	NOUN
finefocus-3634	34	7	by	by	ADP
finefocus-3634	34	8	taking	take	VERB
finefocus-3634	34	9	a	a	DET
finefocus-3634	34	10	proton	proton	NOUN
finefocus-3634	34	11	and	and	CCONJ
finefocus-3634	34	12	an	an	DET
finefocus-3634	34	13	electron	electron	NOUN
finefocus-3634	34	14	from	from	ADP
finefocus-3634	34	15	serine	serine	NOUN
finefocus-3634	34	16	,	,	PUNCT
finefocus-3634	34	17	creating	create	VERB
finefocus-3634	34	18	a	a	DET
finefocus-3634	34	19	nucleophile.(yoshida	nucleophile.(yoshida	ADV
finefocus-3634	34	20	et	et	NOUN
finefocus-3634	34	21	al	al	PROPN
finefocus-3634	34	22	.	.	PROPN
finefocus-3634	34	23	,	,	PUNCT
finefocus-3634	34	24	2016	2016	NUM
finefocus-3634	34	25	)	)	PUNCT
finefocus-3634	34	26	the	the	DET
finefocus-3634	34	27	ser	ser	NOUN
finefocus-3634	34	28	-	-	PUNCT
finefocus-3634	34	29	his	his	PRON
finefocus-3634	34	30	-	-	PUNCT
finefocus-3634	34	31	asp	asp	NOUN
finefocus-3634	34	32	triad	triad	NOUN
finefocus-3634	34	33	removes	remove	VERB
finefocus-3634	34	34	an	an	DET
finefocus-3634	34	35	electron	electron	NOUN
finefocus-3634	34	36	from	from	ADP
finefocus-3634	34	37	the	the	DET
finefocus-3634	34	38	oxygen	oxygen	NOUN
finefocus-3634	34	39	atom	atom	NOUN
finefocus-3634	34	40	of	of	ADP
finefocus-3634	34	41	pet	pet	NOUN
finefocus-3634	34	42	’s	’s	PART
finefocus-3634	34	43	ester	ester	NOUN
finefocus-3634	34	44	linkage	linkage	NOUN
finefocus-3634	34	45	and	and	CCONJ
finefocus-3634	34	46	passes	pass	VERB
finefocus-3634	34	47	the	the	DET
finefocus-3634	34	48	electron	electron	NOUN
finefocus-3634	34	49	to	to	ADP
finefocus-3634	34	50	serine.(yoshida	serine.(yoshida	PROPN
finefocus-3634	34	51	et	et	PROPN
finefocus-3634	34	52	al	al	PROPN
finefocus-3634	34	53	.	.	PROPN
finefocus-3634	34	54	,	,	PUNCT
finefocus-3634	34	55	2016	2016	NUM
finefocus-3634	34	56	)	)	PUNCT
finefocus-3634	34	57	then	then	ADV
finefocus-3634	34	58	this	this	DET
finefocus-3634	34	59	oxygen	oxygen	NOUN
finefocus-3634	34	60	atom	atom	NOUN
finefocus-3634	34	61	takes	take	VERB
finefocus-3634	34	62	an	an	DET
finefocus-3634	34	63	electron	electron	NOUN
finefocus-3634	34	64	from	from	ADP
finefocus-3634	34	65	its	its	PRON
finefocus-3634	34	66	neighboring	neighboring	NOUN
finefocus-3634	34	67	atom	atom	NOUN
finefocus-3634	34	68	,	,	PUNCT
finefocus-3634	34	69	making	make	VERB
finefocus-3634	34	70	a	a	DET
finefocus-3634	34	71	free	free	ADJ
finefocus-3634	34	72	radical	radical	NOUN
finefocus-3634	34	73	on	on	ADP
finefocus-3634	34	74	the	the	DET
finefocus-3634	34	75	carbon	carbon	NOUN
finefocus-3634	34	76	atom	atom	NOUN
finefocus-3634	34	77	,	,	PUNCT
finefocus-3634	34	78	and	and	CCONJ
finefocus-3634	34	79	weakens	weaken	VERB
finefocus-3634	34	80	the	the	DET
finefocus-3634	34	81	c	c	NOUN
finefocus-3634	34	82	-	-	PUNCT
finefocus-3634	34	83	o	o	NOUN
finefocus-3634	34	84	bond	bond	NOUN
finefocus-3634	34	85	of	of	ADP
finefocus-3634	34	86	the	the	DET
finefocus-3634	34	87	ester	ester	NOUN
finefocus-3634	34	88	linkage	linkage	NOUN
finefocus-3634	34	89	.	.	PUNCT
finefocus-3634	35	1	this	this	DET
finefocus-3634	35	2	results	result	VERB
finefocus-3634	35	3	in	in	ADP
finefocus-3634	35	4	cleavage	cleavage	NOUN
finefocus-3634	35	5	of	of	ADP
finefocus-3634	35	6	the	the	DET
finefocus-3634	35	7	ester	ester	NOUN
finefocus-3634	35	8	linkage	linkage	NOUN
finefocus-3634	35	9	and	and	CCONJ
finefocus-3634	35	10	complete	complete	VERB
finefocus-3634	35	11	the	the	DET
finefocus-3634	35	12	redox	redox	ADJ
finefocus-3634	35	13	cycle	cycle	NOUN
finefocus-3634	35	14	.	.	PUNCT
finefocus-3634	36	1	the	the	DET
finefocus-3634	36	2	extra	extra	ADJ
finefocus-3634	36	3	electron	electron	NOUN
finefocus-3634	36	4	gained	gain	VERB
finefocus-3634	36	5	by	by	ADP
finefocus-3634	36	6	asparagine	asparagine	NOUN
finefocus-3634	36	7	at	at	ADP
finefocus-3634	36	8	the	the	DET
finefocus-3634	36	9	beginning	beginning	NOUN
finefocus-3634	36	10	of	of	ADP
finefocus-3634	36	11	the	the	DET
finefocus-3634	36	12	reaction	reaction	NOUN
finefocus-3634	36	13	is	be	AUX
finefocus-3634	36	14	given	give	VERB
finefocus-3634	36	15	to	to	ADP
finefocus-3634	36	16	o2	o2	PROPN
finefocus-3634	36	17	,	,	PUNCT
finefocus-3634	36	18	an	an	DET
finefocus-3634	36	19	electron	electron	NOUN
finefocus-3634	36	20	acceptor	acceptor	NOUN
finefocus-3634	36	21	,	,	PUNCT
finefocus-3634	36	22	resulting	result	VERB
finefocus-3634	36	23	in	in	ADP
finefocus-3634	36	24	formation	formation	NOUN
finefocus-3634	36	25	of	of	ADP
finefocus-3634	36	26	two	two	NUM
finefocus-3634	36	27	molecules	molecule	NOUN
finefocus-3634	36	28	of	of	ADP
finefocus-3634	36	29	h2o	h2o	PROPN
finefocus-3634	36	30	.	.	PUNCT
finefocus-3634	37	1	petase	petase	NOUN
finefocus-3634	37	2	does	do	AUX
finefocus-3634	37	3	not	not	PART
finefocus-3634	37	4	degrade	degrade	VERB
finefocus-3634	37	5	pet	pet	ADJ
finefocus-3634	37	6	film	film	NOUN
finefocus-3634	37	7	at	at	ADP
finefocus-3634	37	8	a	a	DET
finefocus-3634	37	9	rate	rate	NOUN
finefocus-3634	37	10	high	high	ADJ
finefocus-3634	37	11	enough	enough	ADV
finefocus-3634	37	12	to	to	PART
finefocus-3634	37	13	be	be	AUX
finefocus-3634	37	14	utilized	utilize	VERB
finefocus-3634	37	15	in	in	ADP
finefocus-3634	37	16	recycling	recycle	VERB
finefocus-3634	37	17	facilities	facility	NOUN
finefocus-3634	37	18	.	.	PUNCT
finefocus-3634	38	1	commercial	commercial	ADJ
finefocus-3634	38	2	adaptation	adaptation	NOUN
finefocus-3634	38	3	of	of	ADP
finefocus-3634	38	4	this	this	DET
finefocus-3634	38	5	process	process	NOUN
finefocus-3634	38	6	would	would	AUX
finefocus-3634	38	7	need	need	VERB
finefocus-3634	38	8	much	much	ADV
finefocus-3634	38	9	higher	high	ADJ
finefocus-3634	38	10	degradation	degradation	NOUN
finefocus-3634	38	11	rate	rate	NOUN
finefocus-3634	38	12	.	.	PUNCT
finefocus-3634	39	1	(	(	PUNCT
finefocus-3634	39	2	o’brien	o’brien	PROPN
finefocus-3634	39	3	,	,	PUNCT
finefocus-3634	39	4	2019	2019	NUM
finefocus-3634	39	5	)	)	PUNCT
finefocus-3634	39	6	in	in	ADP
finefocus-3634	39	7	2018	2018	NUM
finefocus-3634	39	8	,	,	PUNCT
finefocus-3634	39	9	austin	austin	PROPN
finefocus-3634	39	10	et	et	PROPN
finefocus-3634	39	11	al	al	PROPN
finefocus-3634	39	12	.	.	PROPN
finefocus-3634	39	13	modified	modify	VERB
finefocus-3634	39	14	wild	wild	ADJ
finefocus-3634	39	15	type	type	NOUN
finefocus-3634	39	16	petase	petase	NOUN
finefocus-3634	39	17	and	and	CCONJ
finefocus-3634	39	18	improved	improve	VERB
finefocus-3634	39	19	the	the	DET
finefocus-3634	39	20	activity	activity	NOUN
finefocus-3634	39	21	of	of	ADP
finefocus-3634	39	22	the	the	DET
finefocus-3634	39	23	modified	modified	ADJ
finefocus-3634	39	24	petase	petase	NOUN
finefocus-3634	39	25	to	to	ADP
finefocus-3634	39	26	2.5	2.5	NUM
finefocus-3634	39	27	times	time	NOUN
finefocus-3634	39	28	the	the	DET
finefocus-3634	39	29	wild	wild	ADJ
finefocus-3634	39	30	type.(ma	type.(ma	INTJ
finefocus-3634	39	31	et	et	PROPN
finefocus-3634	39	32	al	al	PROPN
finefocus-3634	39	33	.	.	PROPN
finefocus-3634	39	34	,	,	PUNCT
finefocus-3634	39	35	2018	2018	NUM
finefocus-3634	39	36	)	)	PUNCT
finefocus-3634	39	37	in	in	ADP
finefocus-3634	39	38	the	the	DET
finefocus-3634	39	39	modification	modification	NOUN
finefocus-3634	39	40	process	process	NOUN
finefocus-3634	39	41	,	,	PUNCT
finefocus-3634	39	42	width	width	NOUN
finefocus-3634	39	43	of	of	ADP
finefocus-3634	39	44	the	the	DET
finefocus-3634	39	45	active	active	ADJ
finefocus-3634	39	46	site	site	NOUN
finefocus-3634	39	47	cleft	cleft	NOUN
finefocus-3634	39	48	of	of	ADP
finefocus-3634	39	49	the	the	DET
finefocus-3634	39	50	modified	modify	VERB
finefocus-3634	39	51	petase	petase	NOUN
finefocus-3634	39	52	was	be	AUX
finefocus-3634	39	53	lowered	lower	VERB
finefocus-3634	39	54	through	through	ADP
finefocus-3634	39	55	mutagenesis	mutagenesis	NOUN
finefocus-3634	39	56	of	of	ADP
finefocus-3634	39	57	two	two	NUM
finefocus-3634	39	58	amino	amino	ADJ
finefocus-3634	39	59	acids	acid	NOUN
finefocus-3634	39	60	(	(	PUNCT
finefocus-3634	39	61	phenylalanine	phenylalanine	NOUN
finefocus-3634	39	62	and	and	CCONJ
finefocus-3634	39	63	serine	serine	NOUN
finefocus-3634	39	64	)	)	PUNCT
finefocus-3634	39	65	.	.	PUNCT
finefocus-3634	40	1	the	the	DET
finefocus-3634	40	2	results	result	NOUN
finefocus-3634	40	3	indicated	indicate	VERB
finefocus-3634	40	4	that	that	SCONJ
finefocus-3634	40	5	specificity	specificity	NOUN
finefocus-3634	40	6	of	of	ADP
finefocus-3634	40	7	the	the	DET
finefocus-3634	40	8	active	active	ADJ
finefocus-3634	40	9	site	site	NOUN
finefocus-3634	40	10	caused	cause	VERB
finefocus-3634	40	11	by	by	ADP
finefocus-3634	40	12	a	a	DET
finefocus-3634	40	13	narrower	narrow	ADJ
finefocus-3634	40	14	cleft	cleft	NOUN
finefocus-3634	40	15	allows	allow	VERB
finefocus-3634	40	16	the	the	DET
finefocus-3634	40	17	substrate	substrate	NOUN
finefocus-3634	40	18	(	(	PUNCT
finefocus-3634	40	19	pet	pet	NOUN
finefocus-3634	40	20	)	)	PUNCT
finefocus-3634	40	21	to	to	PART
finefocus-3634	40	22	better	well	ADV
finefocus-3634	40	23	interact	interact	VERB
finefocus-3634	40	24	with	with	ADP
finefocus-3634	40	25	the	the	DET
finefocus-3634	40	26	enzyme	enzyme	NOUN
finefocus-3634	40	27	.	.	PUNCT
finefocus-3634	41	1	(	(	PUNCT
finefocus-3634	41	2	austin	austin	PROPN
finefocus-3634	41	3	et	et	PROPN
finefocus-3634	41	4	al	al	PROPN
finefocus-3634	41	5	.	.	PROPN
finefocus-3634	41	6	,	,	PUNCT
finefocus-3634	41	7	2018	2018	NUM
finefocus-3634	41	8	)	)	PUNCT
finefocus-3634	41	9	while	while	SCONJ
finefocus-3634	41	10	other	other	ADJ
finefocus-3634	41	11	enzymes	enzyme	NOUN
finefocus-3634	41	12	(	(	PUNCT
finefocus-3634	41	13	e.g.	e.g.	ADV
finefocus-3634	41	14	,	,	PUNCT
finefocus-3634	41	15	cutinases	cutinase	NOUN
finefocus-3634	41	16	)	)	PUNCT
finefocus-3634	41	17	have	have	AUX
finefocus-3634	41	18	already	already	ADV
finefocus-3634	41	19	been	be	AUX
finefocus-3634	41	20	perfected	perfect	VERB
finefocus-3634	41	21	by	by	ADP
finefocus-3634	41	22	nature	nature	NOUN
finefocus-3634	41	23	because	because	SCONJ
finefocus-3634	41	24	of	of	ADP
finefocus-3634	41	25	their	their	PRON
finefocus-3634	41	26	long	long	ADJ
finefocus-3634	41	27	existence	existence	NOUN
finefocus-3634	41	28	,	,	PUNCT
finefocus-3634	41	29	petase	petase	NOUN
finefocus-3634	41	30	,	,	PUNCT
finefocus-3634	41	31	a	a	DET
finefocus-3634	41	32	recently	recently	ADV
finefocus-3634	41	33	developed	develop	VERB
finefocus-3634	41	34	enzyme	enzyme	NOUN
finefocus-3634	41	35	,	,	PUNCT
finefocus-3634	41	36	can	can	AUX
finefocus-3634	41	37	be	be	AUX
finefocus-3634	41	38	further	far	ADV
finefocus-3634	41	39	modified	modify	VERB
finefocus-3634	41	40	through	through	ADP
finefocus-3634	41	41	appropriate	appropriate	ADJ
finefocus-3634	41	42	protein	protein	NOUN
finefocus-3634	41	43	design	design	NOUN
finefocus-3634	41	44	.	.	PUNCT
finefocus-3634	42	1	ma	ma	PROPN
finefocus-3634	42	2	et	et	PROPN
finefocus-3634	42	3	al	al	PROPN
finefocus-3634	42	4	.	.	PROPN
finefocus-3634	42	5	also	also	ADV
finefocus-3634	42	6	modified	modify	VERB
finefocus-3634	42	7	wild	wild	ADJ
finefocus-3634	42	8	type	type	NOUN
finefocus-3634	42	9	petase	petase	NOUN
finefocus-3634	42	10	.	.	PUNCT
finefocus-3634	43	1	in	in	ADP
finefocus-3634	43	2	their	their	PRON
finefocus-3634	43	3	modification	modification	NOUN
finefocus-3634	43	4	,	,	PUNCT
finefocus-3634	43	5	hydrophobicity	hydrophobicity	NOUN
finefocus-3634	43	6	was	be	AUX
finefocus-3634	43	7	increased	increase	VERB
finefocus-3634	43	8	near	near	ADP
finefocus-3634	43	9	the	the	DET
finefocus-3634	43	10	active	active	ADJ
finefocus-3634	43	11	site	site	NOUN
finefocus-3634	43	12	of	of	ADP
finefocus-3634	43	13	the	the	DET
finefocus-3634	43	14	enzyme	enzyme	NOUN
finefocus-3634	43	15	through	through	ADP
finefocus-3634	43	16	mutagenesis	mutagenesis	NOUN
finefocus-3634	43	17	under	under	ADP
finefocus-3634	43	18	the	the	DET
finefocus-3634	43	19	hypothesis	hypothesis	NOUN
finefocus-3634	43	20	that	that	SCONJ
finefocus-3634	43	21	hydrophobicity	hydrophobicity	NOUN
finefocus-3634	43	22	would	would	AUX
finefocus-3634	43	23	increase	increase	VERB
finefocus-3634	43	24	pet	pet	ADJ
finefocus-3634	43	25	degradation	degradation	NOUN
finefocus-3634	43	26	.	.	PUNCT
finefocus-3634	44	1	this	this	DET
finefocus-3634	44	2	modification	modification	NOUN
finefocus-3634	44	3	led	lead	VERB
finefocus-3634	44	4	to	to	ADP
finefocus-3634	44	5	a	a	DET
finefocus-3634	44	6	15	15	NUM
finefocus-3634	44	7	-	-	ADJ
finefocus-3634	44	8	fold	fold	ADJ
finefocus-3634	44	9	increase	increase	NOUN
finefocus-3634	44	10	in	in	ADP
finefocus-3634	44	11	degradation	degradation	NOUN
finefocus-3634	44	12	of	of	ADP
finefocus-3634	44	13	pet	pet	NOUN
finefocus-3634	44	14	as	as	SCONJ
finefocus-3634	44	15	compared	compare	VERB
finefocus-3634	44	16	to	to	ADP
finefocus-3634	44	17	the	the	DET
finefocus-3634	44	18	wild	wild	ADJ
finefocus-3634	44	19	-	-	PUNCT
finefocus-3634	44	20	type	type	NOUN
finefocus-3634	44	21	petase.(ma	petase.(ma	NOUN
finefocus-3634	44	22	et	et	PROPN
finefocus-3634	44	23	al	al	PROPN
finefocus-3634	44	24	.	.	PROPN
finefocus-3634	44	25	,	,	PUNCT
finefocus-3634	44	26	2018	2018	NUM
finefocus-3634	44	27	)	)	PUNCT
finefocus-3634	44	28	although	although	SCONJ
finefocus-3634	44	29	significant	significant	ADJ
finefocus-3634	44	30	achievements	achievement	NOUN
finefocus-3634	44	31	have	have	AUX
finefocus-3634	44	32	been	be	AUX
finefocus-3634	44	33	made	make	VERB
finefocus-3634	44	34	by	by	ADP
finefocus-3634	44	35	researchers	researcher	NOUN
finefocus-3634	44	36	in	in	ADP
finefocus-3634	44	37	improving	improve	VERB
finefocus-3634	44	38	wild	wild	ADJ
finefocus-3634	44	39	type	type	NOUN
finefocus-3634	44	40	petase	petase	NOUN
finefocus-3634	44	41	’s	’s	PART
finefocus-3634	44	42	activity	activity	NOUN
finefocus-3634	44	43	,	,	PUNCT
finefocus-3634	44	44	more	more	ADJ
finefocus-3634	44	45	research	research	NOUN
finefocus-3634	44	46	is	be	AUX
finefocus-3634	44	47	necessary	necessary	ADJ
finefocus-3634	44	48	in	in	ADP
finefocus-3634	44	49	developing	develop	VERB
finefocus-3634	44	50	enzymes	enzyme	NOUN
finefocus-3634	44	51	with	with	ADP
finefocus-3634	44	52	higher	high	ADJ
finefocus-3634	44	53	thermostability	thermostability	NOUN
finefocus-3634	44	54	,	,	PUNCT
finefocus-3634	44	55	and	and	CCONJ
finefocus-3634	44	56	better	well	ADJ
finefocus-3634	44	57	degradation	degradation	NOUN
finefocus-3634	44	58	capability	capability	NOUN
finefocus-3634	44	59	,	,	PUNCT
finefocus-3634	44	60	enabling	enable	VERB
finefocus-3634	44	61	their	their	PRON
finefocus-3634	44	62	utilization	utilization	NOUN
finefocus-3634	44	63	for	for	ADP
finefocus-3634	44	64	pet	pet	ADJ
finefocus-3634	44	65	recycling	recycling	NOUN
finefocus-3634	44	66	by	by	ADP
finefocus-3634	44	67	waste	waste	NOUN
finefocus-3634	44	68	management	management	NOUN
finefocus-3634	44	69	facilities	facility	NOUN
finefocus-3634	44	70	and	and	CCONJ
finefocus-3634	44	71	chemical	chemical	NOUN
finefocus-3634	44	72	industries	industry	NOUN
finefocus-3634	44	73	.	.	PUNCT
finefocus-3634	45	1	to	to	PART
finefocus-3634	45	2	develop	develop	VERB
finefocus-3634	45	3	petase	petase	NOUN
finefocus-3634	45	4	for	for	ADP
finefocus-3634	45	5	effective	effective	ADJ
finefocus-3634	45	6	degradation	degradation	NOUN
finefocus-3634	45	7	of	of	ADP
finefocus-3634	45	8	ester	ester	NOUN
finefocus-3634	45	9	linkages	linkage	NOUN
finefocus-3634	45	10	,	,	PUNCT
finefocus-3634	45	11	the	the	DET
finefocus-3634	45	12	following	follow	VERB
finefocus-3634	45	13	section	section	NOUN
finefocus-3634	45	14	summarizes	summarize	NOUN
finefocus-3634	45	15	desirable	desirable	ADJ
finefocus-3634	45	16	features	feature	NOUN
finefocus-3634	45	17	,	,	PUNCT
finefocus-3634	45	18	e.g.	e.g.	ADV
finefocus-3634	45	19	isoelectric	isoelectric	ADJ
finefocus-3634	45	20	point	point	NOUN
finefocus-3634	45	21	,	,	PUNCT
finefocus-3634	45	22	amino	amino	NOUN
finefocus-3634	45	23	acid	acid	NOUN
finefocus-3634	45	24	sequence	sequence	NOUN
finefocus-3634	45	25	,	,	PUNCT
finefocus-3634	45	26	thermostability	thermostability	NOUN
finefocus-3634	45	27	etc	etc	X
finefocus-3634	45	28	.	.	X
finefocus-3634	45	29	of	of	ADP
finefocus-3634	45	30	modified	modify	VERB
finefocus-3634	45	31	petase	petase	NOUN
finefocus-3634	45	32	.	.	PUNCT
finefocus-3634	46	1	petase	petase	NOUN
finefocus-3634	46	2	shares	share	NOUN
finefocus-3634	46	3	52	52	NUM
finefocus-3634	46	4	%	%	NOUN
finefocus-3634	46	5	sequence	sequence	NOUN
finefocus-3634	46	6	identity	identity	NOUN
finefocus-3634	46	7	with	with	ADP
finefocus-3634	46	8	t.	t.	PROPN
finefocus-3634	46	9	fusca	fusca	PROPN
finefocus-3634	46	10	cutinase	cutinase	NOUN
finefocus-3634	46	11	,	,	PUNCT
finefocus-3634	46	12	its	its	PRON
finefocus-3634	46	13	closest	close	ADJ
finefocus-3634	46	14	homolog.(austin	homolog.(austin	X
finefocus-3634	46	15	et	et	PROPN
finefocus-3634	46	16	al	al	PROPN
finefocus-3634	46	17	.	.	PROPN
finefocus-3634	46	18	,	,	PUNCT
finefocus-3634	46	19	2018	2018	NUM
finefocus-3634	46	20	;	;	PUNCT
finefocus-3634	46	21	yoshida	yoshida	PROPN
finefocus-3634	46	22	et	et	PROPN
finefocus-3634	46	23	al	al	PROPN
finefocus-3634	46	24	.	.	PROPN
finefocus-3634	46	25	,	,	PUNCT
finefocus-3634	46	26	2016	2016	NUM
finefocus-3634	46	27	)	)	PUNCT
finefocus-3634	46	28	this	this	DET
finefocus-3634	46	29	sequence	sequence	NOUN
finefocus-3634	46	30	can	can	AUX
finefocus-3634	46	31	be	be	AUX
finefocus-3634	46	32	used	use	VERB
finefocus-3634	46	33	to	to	PART
finefocus-3634	46	34	identify	identify	VERB
finefocus-3634	46	35	features	feature	NOUN
finefocus-3634	46	36	of	of	ADP
finefocus-3634	46	37	petase	petase	NOUN
finefocus-3634	46	38	which	which	PRON
finefocus-3634	46	39	make	make	VERB
finefocus-3634	46	40	it	it	PRON
finefocus-3634	46	41	an	an	DET
finefocus-3634	46	42	effective	effective	ADJ
finefocus-3634	46	43	degrader	degrader	NOUN
finefocus-3634	46	44	of	of	ADP
finefocus-3634	46	45	pet	pet	NOUN
finefocus-3634	46	46	.	.	PUNCT
finefocus-3634	47	1	these	these	DET
finefocus-3634	47	2	features	feature	NOUN
finefocus-3634	47	3	include	include	VERB
finefocus-3634	47	4	3	3	NUM
finefocus-3634	47	5	-	-	ADJ
finefocus-3634	47	6	fold	fold	VERB
finefocus-3634	47	7	wider	wide	ADJ
finefocus-3634	47	8	active	active	ADJ
finefocus-3634	47	9	site	site	NOUN
finefocus-3634	47	10	cleft	cleft	NOUN
finefocus-3634	47	11	and	and	CCONJ
finefocus-3634	47	12	higher	high	ADJ
finefocus-3634	47	13	isoelectric	isoelectric	ADJ
finefocus-3634	47	14	point	point	NOUN
finefocus-3634	47	15	(	(	PUNCT
finefocus-3634	47	16	caused	cause	VERB
finefocus-3634	47	17	by	by	ADP
finefocus-3634	47	18	dipole	dipole	NOUN
finefocus-3634	47	19	;	;	PUNCT
finefocus-3634	47	20	isoelectric	isoelectric	ADJ
finefocus-3634	47	21	point	point	NOUN
finefocus-3634	47	22	of	of	ADP
finefocus-3634	47	23	petase	petase	NOUN
finefocus-3634	47	24	is	be	AUX
finefocus-3634	47	25	9.6	9.6	NUM
finefocus-3634	47	26	while	while	SCONJ
finefocus-3634	47	27	this	this	DET
finefocus-3634	47	28	value	value	NOUN
finefocus-3634	47	29	of	of	ADP
finefocus-3634	47	30	t.	t.	PROPN
finefocus-3634	47	31	fusca	fusca	PROPN
finefocus-3634	47	32	cutinase	cutinase	NOUN
finefocus-3634	47	33	is	be	AUX
finefocus-3634	47	34	6.3	6.3	NUM
finefocus-3634	47	35	)	)	PUNCT
finefocus-3634	47	36	of	of	ADP
finefocus-3634	47	37	petase	petase	NOUN
finefocus-3634	47	38	as	as	SCONJ
finefocus-3634	47	39	compared	compare	VERB
finefocus-3634	47	40	to	to	ADP
finefocus-3634	47	41	t.	t.	PROPN
finefocus-3634	47	42	fusca	fusca	PROPN
finefocus-3634	47	43	cutinase.(austin	cutinase.(austin	X
finefocus-3634	47	44	et	et	PROPN
finefocus-3634	47	45	al	al	PROPN
finefocus-3634	47	46	.	.	PROPN
finefocus-3634	47	47	,	,	PUNCT
finefocus-3634	47	48	2018	2018	NUM
finefocus-3634	47	49	;	;	PUNCT
finefocus-3634	47	50	yoshida	yoshida	PROPN
finefocus-3634	47	51	et	et	PROPN
finefocus-3634	47	52	al	al	PROPN
finefocus-3634	47	53	.	.	PROPN
finefocus-3634	47	54	,	,	PUNCT
finefocus-3634	47	55	2016	2016	NUM
finefocus-3634	47	56	)	)	PUNCT
finefocus-3634	47	57	in	in	ADP
finefocus-3634	47	58	addition	addition	NOUN
finefocus-3634	47	59	,	,	PUNCT
finefocus-3634	47	60	petase	petase	NOUN
finefocus-3634	47	61	contains	contain	VERB
finefocus-3634	47	62	many	many	ADJ
finefocus-3634	47	63	basic	basic	ADJ
finefocus-3634	47	64	amino	amino	ADJ
finefocus-3634	47	65	acids	acid	NOUN
finefocus-3634	47	66	such	such	ADJ
finefocus-3634	47	67	as	as	ADP
finefocus-3634	47	68	lysine	lysine	NOUN
finefocus-3634	47	69	and	and	CCONJ
finefocus-3634	47	70	arginine	arginine	NOUN
finefocus-3634	47	71	,	,	PUNCT
finefocus-3634	47	72	which	which	PRON
finefocus-3634	47	73	are	be	AUX
finefocus-3634	47	74	charged	charge	VERB
finefocus-3634	47	75	and	and	CCONJ
finefocus-3634	47	76	form	form	VERB
finefocus-3634	47	77	salt	salt	NOUN
finefocus-3634	47	78	bridges	bridge	NOUN
finefocus-3634	47	79	to	to	PART
finefocus-3634	47	80	make	make	VERB
finefocus-3634	47	81	petase	petase	NOUN
finefocus-3634	47	82	stable.(yoshida	stable.(yoshida	PROPN
finefocus-3634	47	83	et	et	PROPN
finefocus-3634	47	84	al	al	PROPN
finefocus-3634	47	85	.	.	PROPN
finefocus-3634	47	86	,	,	PUNCT
finefocus-3634	47	87	2016	2016	NUM
finefocus-3634	47	88	)	)	PUNCT
finefocus-3634	47	89	(	(	PUNCT
finefocus-3634	47	90	austin	austin	PROPN
finefocus-3634	47	91	et	et	PROPN
finefocus-3634	47	92	al	al	PROPN
finefocus-3634	47	93	.	.	PROPN
finefocus-3634	47	94	,	,	PUNCT
finefocus-3634	47	95	2018	2018	NUM
finefocus-3634	47	96	)	)	PUNCT
finefocus-3634	47	97	another	another	DET
finefocus-3634	47	98	important	important	ADJ
finefocus-3634	47	99	feature	feature	NOUN
finefocus-3634	47	100	is	be	AUX
finefocus-3634	47	101	thermostability	thermostability	NOUN
finefocus-3634	47	102	.	.	PUNCT
finefocus-3634	48	1	for	for	ADP
finefocus-3634	48	2	example	example	NOUN
finefocus-3634	48	3	,	,	PUNCT
finefocus-3634	48	4	leaf	leaf	NOUN
finefocus-3634	48	5	branch	branch	NOUN
finefocus-3634	48	6	compost	compost	NOUN
finefocus-3634	48	7	cutinase	cutinase	NOUN
finefocus-3634	48	8	(	(	PUNCT
finefocus-3634	48	9	lcc	lcc	PROPN
finefocus-3634	48	10	)	)	PUNCT
finefocus-3634	48	11	,	,	PUNCT
finefocus-3634	48	12	another	another	DET
finefocus-3634	48	13	cutinase	cutinase	NOUN
finefocus-3634	48	14	with	with	ADP
finefocus-3634	48	15	similar	similar	ADJ
finefocus-3634	48	16	sequence	sequence	NOUN
finefocus-3634	48	17	to	to	ADP
finefocus-3634	48	18	petase	petase	NOUN
finefocus-3634	48	19	,	,	PUNCT
finefocus-3634	48	20	has	have	VERB
finefocus-3634	48	21	high	high	ADJ
finefocus-3634	48	22	thermostability	thermostability	NOUN
finefocus-3634	48	23	at	at	ADP
finefocus-3634	48	24	90	90	NUM
finefocus-3634	49	1	i	i	PRON
finefocus-3634	49	2	fine	fine	ADJ
finefocus-3634	49	3	focus	focus	VERB
finefocus-3634	49	4	70	70	NUM
finefocus-3634	49	5	°	°	PROPN
finefocus-3634	49	6	c.(shirke	c.(shirke	X
finefocus-3634	49	7	et	et	NOUN
finefocus-3634	49	8	al	al	PROPN
finefocus-3634	49	9	.	.	PROPN
finefocus-3634	49	10	,	,	PUNCT
finefocus-3634	49	11	2018	2018	NUM
finefocus-3634	49	12	)	)	PUNCT
finefocus-3634	49	13	because	because	SCONJ
finefocus-3634	49	14	glass	glass	NOUN
finefocus-3634	49	15	transition	transition	NOUN
finefocus-3634	49	16	temperature	temperature	NOUN
finefocus-3634	49	17	of	of	ADP
finefocus-3634	49	18	pet	pet	ADJ
finefocus-3634	49	19	plastic	plastic	NOUN
finefocus-3634	49	20	is	be	AUX
finefocus-3634	49	21	around	around	ADV
finefocus-3634	49	22	70	70	NUM
finefocus-3634	49	23	°	°	NOUN
finefocus-3634	49	24	c	c	NOUN
finefocus-3634	49	25	,	,	PUNCT
finefocus-3634	49	26	and	and	CCONJ
finefocus-3634	49	27	pet	pet	NOUN
finefocus-3634	49	28	becomes	become	VERB
finefocus-3634	49	29	more	more	ADV
finefocus-3634	49	30	pliable	pliable	ADJ
finefocus-3634	49	31	and	and	CCONJ
finefocus-3634	49	32	its	its	PRON
finefocus-3634	49	33	bonds	bond	NOUN
finefocus-3634	49	34	weaken	weaken	VERB
finefocus-3634	49	35	,	,	PUNCT
finefocus-3634	49	36	lcc	lcc	PROPN
finefocus-3634	49	37	can	can	AUX
finefocus-3634	49	38	degrade	degrade	VERB
finefocus-3634	49	39	pet	pet	NOUN
finefocus-3634	49	40	effectively	effectively	ADV
finefocus-3634	49	41	at	at	ADP
finefocus-3634	49	42	this	this	DET
finefocus-3634	49	43	temperature	temperature	NOUN
finefocus-3634	49	44	.	.	PUNCT
finefocus-3634	50	1	in	in	ADP
finefocus-3634	50	2	contrast	contrast	NOUN
finefocus-3634	50	3	,	,	PUNCT
finefocus-3634	50	4	petase	petase	NOUN
finefocus-3634	50	5	is	be	AUX
finefocus-3634	50	6	stable	stable	ADJ
finefocus-3634	50	7	and	and	CCONJ
finefocus-3634	50	8	active	active	ADJ
finefocus-3634	50	9	at	at	ADP
finefocus-3634	50	10	much	much	ADV
finefocus-3634	50	11	lower	low	ADJ
finefocus-3634	50	12	temperature	temperature	NOUN
finefocus-3634	50	13	(	(	PUNCT
finefocus-3634	50	14	~37	~37	NOUN
finefocus-3634	50	15	°	°	NOUN
finefocus-3634	50	16	c	c	NOUN
finefocus-3634	50	17	)	)	PUNCT
finefocus-3634	50	18	at	at	ADP
finefocus-3634	50	19	which	which	PRON
finefocus-3634	50	20	pet	pet	NOUN
finefocus-3634	50	21	is	be	AUX
finefocus-3634	50	22	not	not	PART
finefocus-3634	50	23	pliable	pliable	ADJ
finefocus-3634	50	24	and	and	CCONJ
finefocus-3634	50	25	its	its	PRON
finefocus-3634	50	26	bonds	bond	NOUN
finefocus-3634	50	27	are	be	AUX
finefocus-3634	50	28	rigid	rigid	ADJ
finefocus-3634	50	29	.	.	PUNCT
finefocus-3634	51	1	modified	modify	VERB
finefocus-3634	51	2	petase	petase	NOUN
finefocus-3634	51	3	with	with	ADP
finefocus-3634	51	4	high	high	ADJ
finefocus-3634	51	5	thermostability	thermostability	NOUN
finefocus-3634	51	6	would	would	AUX
finefocus-3634	51	7	be	be	AUX
finefocus-3634	51	8	beneficial	beneficial	ADJ
finefocus-3634	51	9	.	.	PUNCT
finefocus-3634	52	1	table	table	NOUN
finefocus-3634	52	2	1	1	NUM
finefocus-3634	52	3	entry	entry	NOUN
finefocus-3634	52	4	enzymes	enzyme	NOUN
finefocus-3634	52	5	reaction	reaction	NOUN
finefocus-3634	52	6	conditions	condition	NOUN
finefocus-3634	52	7	degradation	degradation	NOUN
finefocus-3634	52	8	amount	amount	NOUN
finefocus-3634	52	9	(	(	PUNCT
finefocus-3634	52	10	methods	method	NOUN
finefocus-3634	52	11	used	use	VERB
finefocus-3634	52	12	)	)	PUNCT
finefocus-3634	52	13	ref	ref	NOUN
finefocus-3634	52	14	1	1	NUM
finefocus-3634	52	15	2	2	NUM
finefocus-3634	52	16	3	3	NUM
finefocus-3634	52	17	4	4	NUM
finefocus-3634	52	18	5	5	NUM
finefocus-3634	52	19	6	6	NUM
finefocus-3634	52	20	petase	petase	NOUN
finefocus-3634	52	21	contains	contain	VERB
finefocus-3634	52	22	a	a	DET
finefocus-3634	52	23	disulfide	disulfide	NOUN
finefocus-3634	52	24	bond	bond	NOUN
finefocus-3634	52	25	in	in	ADP
finefocus-3634	52	26	its	its	PRON
finefocus-3634	52	27	active	active	ADJ
finefocus-3634	52	28	site	site	NOUN
finefocus-3634	52	29	.	.	PUNCT
finefocus-3634	53	1	lcc	lcc	PROPN
finefocus-3634	53	2	and	and	CCONJ
finefocus-3634	53	3	t.	t.	PROPN
finefocus-3634	53	4	fusca	fusca	PROPN
finefocus-3634	53	5	cutinases	cutinase	NOUN
finefocus-3634	53	6	do	do	AUX
finefocus-3634	53	7	not	not	PART
finefocus-3634	53	8	have	have	VERB
finefocus-3634	53	9	this	this	DET
finefocus-3634	53	10	disulfide	disulfide	NOUN
finefocus-3634	53	11	bond.(fecker	bond.(fecker	NOUN
finefocus-3634	53	12	et	et	PROPN
finefocus-3634	53	13	al	al	PROPN
finefocus-3634	53	14	.	.	PROPN
finefocus-3634	53	15	,	,	PUNCT
finefocus-3634	53	16	2018	2018	NUM
finefocus-3634	53	17	)	)	PUNCT
finefocus-3634	53	18	simulations	simulation	NOUN
finefocus-3634	53	19	predicted	predict	VERB
finefocus-3634	53	20	that	that	SCONJ
finefocus-3634	53	21	this	this	DET
finefocus-3634	53	22	disulfide	disulfide	NOUN
finefocus-3634	53	23	bond	bond	NOUN
finefocus-3634	53	24	increases	increase	VERB
finefocus-3634	53	25	flexibility	flexibility	NOUN
finefocus-3634	53	26	around	around	ADP
finefocus-3634	53	27	the	the	DET
finefocus-3634	53	28	active	active	ADJ
finefocus-3634	53	29	site.(fecker	site.(fecker	ADV
finefocus-3634	53	30	et	et	PROPN
finefocus-3634	53	31	al	al	PROPN
finefocus-3634	53	32	.	.	PROPN
finefocus-3634	53	33	,	,	PUNCT
finefocus-3634	53	34	2018	2018	NUM
finefocus-3634	53	35	)	)	PUNCT
finefocus-3634	53	36	austin	austin	PROPN
finefocus-3634	53	37	et	et	PROPN
finefocus-3634	53	38	al	al	PROPN
finefocus-3634	53	39	.	.	PUNCT
finefocus-3634	54	1	(	(	PUNCT
finefocus-3634	54	2	austin	austin	PROPN
finefocus-3634	54	3	et	et	PROPN
finefocus-3634	54	4	al	al	PROPN
finefocus-3634	54	5	.	.	PROPN
finefocus-3634	54	6	,	,	PUNCT
finefocus-3634	54	7	2018	2018	NUM
finefocus-3634	54	8	)	)	PUNCT
finefocus-3634	54	9	have	have	AUX
finefocus-3634	54	10	shown	show	VERB
finefocus-3634	54	11	that	that	SCONJ
finefocus-3634	54	12	a	a	DET
finefocus-3634	54	13	narrower	narrow	ADJ
finefocus-3634	54	14	binding	bind	VERB
finefocus-3634	54	15	cleft	cleft	NOUN
finefocus-3634	54	16	of	of	ADP
finefocus-3634	54	17	the	the	DET
finefocus-3634	54	18	active	active	ADJ
finefocus-3634	54	19	site	site	NOUN
finefocus-3634	54	20	,	,	PUNCT
finefocus-3634	54	21	arising	arise	VERB
finefocus-3634	54	22	from	from	ADP
finefocus-3634	54	23	flexibility	flexibility	NOUN
finefocus-3634	54	24	of	of	ADP
finefocus-3634	54	25	enzyme	enzyme	NOUN
finefocus-3634	54	26	,	,	PUNCT
finefocus-3634	54	27	can	can	AUX
finefocus-3634	54	28	improve	improve	VERB
finefocus-3634	54	29	enzyme	enzyme	NOUN
finefocus-3634	54	30	’s	’s	PART
finefocus-3634	54	31	affinity	affinity	NOUN
finefocus-3634	54	32	to	to	ADP
finefocus-3634	54	33	substrates	substrate	NOUN
finefocus-3634	54	34	,	,	PUNCT
finefocus-3634	54	35	e.g.	e.g.	ADV
finefocus-3634	54	36	,	,	PUNCT
finefocus-3634	54	37	pet	pet	ADJ
finefocus-3634	54	38	or	or	CCONJ
finefocus-3634	54	39	bhet	bhet	NOUN
finefocus-3634	54	40	.	.	PUNCT
finefocus-3634	55	1	modified	modify	VERB
finefocus-3634	55	2	petase	petase	NOUN
finefocus-3634	55	3	(	(	PUNCT
finefocus-3634	55	4	mutant	mutant	ADJ
finefocus-3634	55	5	i179f	i179f	NOUN
finefocus-3634	55	6	)	)	PUNCT
finefocus-3634	55	7	pet	pet	NOUN
finefocus-3634	55	8	-	-	PUNCT
finefocus-3634	55	9	g	g	NOUN
finefocus-3634	55	10	/	/	SYM
finefocus-3634	55	11	tfh	tfh	PROPN
finefocus-3634	55	12	*	*	NOUN
finefocus-3634	55	13	pet	pet	NOUN
finefocus-3634	55	14	-	-	PUNCT
finefocus-3634	55	15	g	g	NOUN
finefocus-3634	55	16	/	/	SYM
finefocus-3634	55	17	rtfh	rtfh	NOUN
finefocus-3634	55	18	ab300432	ab300432	NOUN
finefocus-3634	55	19	,	,	PUNCT
finefocus-3634	55	20	ab298783	ab298783	NOUN
finefocus-3634	55	21	,	,	PUNCT
finefocus-3634	55	22	ab300774	ab300774	ADV
finefocus-3634	55	23	est119	est119	PROPN
finefocus-3634	55	24	est1	est1	NOUN
finefocus-3634	55	25	modified	modify	VERB
finefocus-3634	55	26	petase	petase	NOUN
finefocus-3634	55	27	expressed	express	VERB
finefocus-3634	55	28	in	in	ADP
finefocus-3634	55	29	e.	e.	PROPN
finefocus-3634	55	30	coli	coli	PROPN
finefocus-3634	55	31	,	,	PUNCT
finefocus-3634	55	32	5	5	NUM
finefocus-3634	55	33	μg	μg	NOUN
finefocus-3634	55	34	petase	petase	NOUN
finefocus-3634	55	35	reacted	react	VERB
finefocus-3634	55	36	with	with	ADP
finefocus-3634	55	37	pet	pet	NOUN
finefocus-3634	55	38	(	(	PUNCT
finefocus-3634	55	39	1.5x1	1.5x1	NUM
finefocus-3634	55	40	cm2	cm2	NOUN
finefocus-3634	55	41	size	size	NOUN
finefocus-3634	55	42	pieces	piece	NOUN
finefocus-3634	55	43	)	)	PUNCT
finefocus-3634	55	44	in	in	ADP
finefocus-3634	55	45	bicine	bicine	ADJ
finefocus-3634	55	46	buffer	buffer	NOUN
finefocus-3634	55	47	;	;	PUNCT
finefocus-3634	55	48	ph	ph	NOUN
finefocus-3634	55	49	8.5	8.5	NUM
finefocus-3634	55	50	,	,	PUNCT
finefocus-3634	55	51	48	48	NUM
finefocus-3634	55	52	hours	hour	NOUN
finefocus-3634	55	53	,	,	PUNCT
finefocus-3634	55	54	30	30	NUM
finefocus-3634	55	55	°	°	SYM
finefocus-3634	55	56	c	c	NOUN
finefocus-3634	55	57	20	20	NUM
finefocus-3634	55	58	-	-	SYM
finefocus-3634	55	59	25	25	NUM
finefocus-3634	55	60	mg	mg	PROPN
finefocus-3634	55	61	pet	pet	NOUN
finefocus-3634	55	62	(	(	PUNCT
finefocus-3634	55	63	12	12	NUM
finefocus-3634	55	64	mm	mm	NOUN
finefocus-3634	55	65	diameter	diameter	NOUN
finefocus-3634	55	66	disks	disk	NOUN
finefocus-3634	55	67	)	)	PUNCT
finefocus-3634	55	68	reacted	react	VERB
finefocus-3634	55	69	with	with	ADP
finefocus-3634	55	70	enzyme	enzyme	NOUN
finefocus-3634	55	71	of	of	ADP
finefocus-3634	55	72	concentration	concentration	NOUN
finefocus-3634	55	73	0.1	0.1	NUM
finefocus-3634	55	74	mg	mg	NUM
finefocus-3634	55	75	/	/	SYM
finefocus-3634	55	76	ml	ml	X
finefocus-3634	55	77	in	in	ADP
finefocus-3634	55	78	buffer	buffer	NOUN
finefocus-3634	55	79	;	;	PUNCT
finefocus-3634	55	80	5	5	NUM
finefocus-3634	55	81	ml	ml	NOUN
finefocus-3634	55	82	buffer	buffer	NOUN
finefocus-3634	55	83	;	;	PUNCT
finefocus-3634	55	84	ph	ph	PROPN
finefocus-3634	55	85	7.0	7.0	NUM
finefocus-3634	55	86	;	;	PUNCT
finefocus-3634	55	87	21	21	NUM
finefocus-3634	55	88	days	day	NOUN
finefocus-3634	55	89	;	;	PUNCT
finefocus-3634	55	90	55	55	NUM
finefocus-3634	55	91	°	°	NOUN
finefocus-3634	55	92	c	c	PROPN
finefocus-3634	55	93	20	20	NUM
finefocus-3634	55	94	-	-	SYM
finefocus-3634	55	95	25	25	NUM
finefocus-3634	55	96	mg	mg	PROPN
finefocus-3634	55	97	pet	pet	NOUN
finefocus-3634	55	98	(	(	PUNCT
finefocus-3634	55	99	12	12	NUM
finefocus-3634	55	100	mm	mm	NOUN
finefocus-3634	55	101	diameter	diameter	NOUN
finefocus-3634	55	102	disks	disk	NOUN
finefocus-3634	55	103	)	)	PUNCT
finefocus-3634	55	104	reacted	react	VERB
finefocus-3634	55	105	with	with	ADP
finefocus-3634	55	106	enzyme	enzyme	NOUN
finefocus-3634	55	107	of	of	ADP
finefocus-3634	55	108	concentration	concentration	NOUN
finefocus-3634	55	109	0.1	0.1	NUM
finefocus-3634	55	110	mg	mg	NUM
finefocus-3634	55	111	/	/	SYM
finefocus-3634	55	112	ml	ml	X
finefocus-3634	55	113	in	in	ADP
finefocus-3634	55	114	buffer	buffer	NOUN
finefocus-3634	55	115	;	;	PUNCT
finefocus-3634	55	116	5	5	NUM
finefocus-3634	55	117	ml	ml	NOUN
finefocus-3634	55	118	buffer	buffer	NOUN
finefocus-3634	55	119	;	;	PUNCT
finefocus-3634	55	120	ph	ph	PROPN
finefocus-3634	55	121	7.0	7.0	NUM
finefocus-3634	55	122	;	;	PUNCT
finefocus-3634	55	123	21	21	NUM
finefocus-3634	55	124	days	day	NOUN
finefocus-3634	55	125	;	;	PUNCT
finefocus-3634	55	126	55	55	NUM
finefocus-3634	55	127	°	°	NOUN
finefocus-3634	55	128	c	c	PROPN
finefocus-3634	55	129	7	7	NUM
finefocus-3634	55	130	×	×	NOUN
finefocus-3634	55	131	7	7	NUM
finefocus-3634	55	132	cm2	cm2	NOUN
finefocus-3634	55	133	biomax	biomax	NOUN
finefocus-3634	55	134	®	®	NOUN
finefocus-3634	55	135	films	film	NOUN
finefocus-3634	55	136	in	in	ADP
finefocus-3634	55	137	compost	compost	NOUN
finefocus-3634	55	138	;	;	PUNCT
finefocus-3634	55	139	55	55	NUM
finefocus-3634	55	140	-	-	SYM
finefocus-3634	55	141	60	60	NUM
finefocus-3634	55	142	°	°	NOUN
finefocus-3634	55	143	c	c	NOUN
finefocus-3634	55	144	;	;	PUNCT
finefocus-3634	55	145	70	70	NUM
finefocus-3634	55	146	-	-	SYM
finefocus-3634	55	147	100	100	NUM
finefocus-3634	55	148	cm	cm	NOUN
finefocus-3634	55	149	below	below	ADP
finefocus-3634	55	150	surface	surface	NOUN
finefocus-3634	55	151	;	;	PUNCT
finefocus-3634	55	152	3	3	NUM
finefocus-3634	55	153	weeks	week	NOUN
finefocus-3634	55	154	and	and	CCONJ
finefocus-3634	55	155	4	4	NUM
finefocus-3634	55	156	weeks	week	NOUN
finefocus-3634	55	157	1	1	NUM
finefocus-3634	55	158	×	×	NOUN
finefocus-3634	55	159	1	1	NUM
finefocus-3634	55	160	cm2	cm2	NOUN
finefocus-3634	55	161	pet	pet	NOUN
finefocus-3634	55	162	film	film	NOUN
finefocus-3634	55	163	reacted	react	VERB
finefocus-3634	55	164	with	with	ADP
finefocus-3634	55	165	sufficient	sufficient	ADJ
finefocus-3634	55	166	amount	amount	NOUN
finefocus-3634	55	167	enzyme	enzyme	NOUN
finefocus-3634	55	168	in	in	ADP
finefocus-3634	55	169	the	the	DET
finefocus-3634	55	170	presence	presence	NOUN
finefocus-3634	55	171	of	of	ADP
finefocus-3634	55	172	300	300	NUM
finefocus-3634	55	173	mm	mm	NOUN
finefocus-3634	55	174	ca2+;50	ca2+;50	NOUN
finefocus-3634	55	175	°	°	ADP
finefocus-3634	55	176	c	c	NOUN
finefocus-3634	55	177	;	;	PUNCT
finefocus-3634	55	178	ph	ph	NOUN
finefocus-3634	55	179	7	7	NUM
finefocus-3634	55	180	;	;	PUNCT
finefocus-3634	55	181	3	3	NUM
finefocus-3634	55	182	h	h	NOUN
finefocus-3634	55	183	1	1	NUM
finefocus-3634	55	184	×	×	NOUN
finefocus-3634	55	185	1	1	NUM
finefocus-3634	55	186	cm2	cm2	NOUN
finefocus-3634	55	187	pet	pet	NOUN
finefocus-3634	55	188	film	film	NOUN
finefocus-3634	55	189	reacted	react	VERB
finefocus-3634	55	190	with	with	ADP
finefocus-3634	55	191	sufficient	sufficient	ADJ
finefocus-3634	55	192	amount	amount	NOUN
finefocus-3634	55	193	enzyme	enzyme	NOUN
finefocus-3634	55	194	in	in	ADP
finefocus-3634	55	195	the	the	DET
finefocus-3634	55	196	presence	presence	NOUN
finefocus-3634	55	197	of	of	ADP
finefocus-3634	55	198	300	300	NUM
finefocus-3634	55	199	mm	mm	NOUN
finefocus-3634	55	200	ca2+;50	ca2+;50	NOUN
finefocus-3634	55	201	°	°	ADP
finefocus-3634	55	202	c	c	NOUN
finefocus-3634	55	203	;	;	PUNCT
finefocus-3634	55	204	ph	ph	NOUN
finefocus-3634	55	205	7	7	NUM
finefocus-3634	55	206	;	;	PUNCT
finefocus-3634	55	207	3	3	NUM
finefocus-3634	55	208	h	h	NOUN
finefocus-3634	55	209	mutant	mutant	NOUN
finefocus-3634	55	210	i179f	i179f	PROPN
finefocus-3634	55	211	has	have	VERB
finefocus-3634	55	212	2.5	2.5	NUM
finefocus-3634	55	213	times	time	NOUN
finefocus-3634	55	214	more	more	ADJ
finefocus-3634	55	215	degradation	degradation	NOUN
finefocus-3634	55	216	than	than	ADP
finefocus-3634	55	217	wild	wild	ADJ
finefocus-3634	55	218	-	-	PUNCT
finefocus-3634	55	219	type	type	NOUN
finefocus-3634	55	220	pet	pet	NOUN
finefocus-3634	55	221	[	[	PUNCT
finefocus-3634	55	222	22.5	22.5	NUM
finefocus-3634	55	223	mg	mg	ADJ
finefocus-3634	55	224	μmol-1·l−1	μmol-1·l−1	NOUN
finefocus-3634	55	225	petase	petase	NOUN
finefocus-3634	55	226	per	per	ADP
finefocus-3634	55	227	day	day	NOUN
finefocus-3634	55	228	biodegraded	biodegrade	VERB
finefocus-3634	55	229	by	by	ADP
finefocus-3634	55	230	mutant	mutant	NOUN
finefocus-3634	55	231	]	]	PUNCT
finefocus-3634	55	232	(	(	PUNCT
finefocus-3634	55	233	sem	sem	NOUN
finefocus-3634	55	234	)	)	PUNCT
finefocus-3634	55	235	49.7	49.7	NUM
finefocus-3634	55	236	 	 	SPACE
finefocus-3634	55	237	±	±	NOUN
finefocus-3634	55	238	 	 	SPACE
finefocus-3634	55	239	1.0	1.0	NUM
finefocus-3634	55	240	%	%	NOUN
finefocus-3634	55	241	mass	mass	NOUN
finefocus-3634	55	242	loss	loss	NOUN
finefocus-3634	55	243	(	(	PUNCT
finefocus-3634	55	244	mass	mass	NOUN
finefocus-3634	55	245	weighed	weigh	VERB
finefocus-3634	55	246	)	)	PUNCT
finefocus-3634	55	247	54.2%%	54.2%%	NUM
finefocus-3634	55	248	mass	mass	NOUN
finefocus-3634	55	249	loss	loss	NOUN
finefocus-3634	55	250	(	(	PUNCT
finefocus-3634	55	251	mass	mass	NOUN
finefocus-3634	55	252	weighed	weigh	VERB
finefocus-3634	55	253	)	)	PUNCT
finefocus-3634	55	254	all	all	DET
finefocus-3634	55	255	films	film	NOUN
finefocus-3634	55	256	fragmented	fragment	VERB
finefocus-3634	55	257	in	in	ADP
finefocus-3634	55	258	4	4	NUM
finefocus-3634	55	259	weeks	week	NOUN
finefocus-3634	55	260	no	no	DET
finefocus-3634	55	261	weight	weight	NOUN
finefocus-3634	55	262	loss	loss	NOUN
finefocus-3634	55	263	or	or	CCONJ
finefocus-3634	55	264	visible	visible	ADJ
finefocus-3634	55	265	surface	surface	NOUN
finefocus-3634	55	266	change	change	NOUN
finefocus-3634	55	267	(	(	PUNCT
finefocus-3634	55	268	mass	mass	NOUN
finefocus-3634	55	269	weighed	weigh	VERB
finefocus-3634	55	270	and	and	CCONJ
finefocus-3634	55	271	sem	sem	NOUN
finefocus-3634	55	272	)	)	PUNCT
finefocus-3634	55	273	no	no	DET
finefocus-3634	55	274	weight	weight	NOUN
finefocus-3634	55	275	loss	loss	NOUN
finefocus-3634	55	276	or	or	CCONJ
finefocus-3634	55	277	visible	visible	ADJ
finefocus-3634	55	278	surface	surface	NOUN
finefocus-3634	55	279	change	change	NOUN
finefocus-3634	55	280	(	(	PUNCT
finefocus-3634	55	281	mass	mass	NOUN
finefocus-3634	55	282	weighed	weigh	VERB
finefocus-3634	55	283	and	and	CCONJ
finefocus-3634	55	284	sem	sem	NOUN
finefocus-3634	55	285	)	)	PUNCT
finefocus-3634	55	286	(	(	PUNCT
finefocus-3634	55	287	austin	austin	PROPN
finefocus-3634	55	288	et	et	PROPN
finefocus-3634	55	289	al	al	PROPN
finefocus-3634	55	290	.	.	PROPN
finefocus-3634	55	291	,	,	PUNCT
finefocus-3634	55	292	2018	2018	NUM
finefocus-3634	55	293	)	)	PUNCT
finefocus-3634	56	1	(	(	PUNCT
finefocus-3634	56	2	müller	müller	PROPN
finefocus-3634	56	3	et	et	PROPN
finefocus-3634	56	4	al	al	PROPN
finefocus-3634	56	5	.	.	PROPN
finefocus-3634	56	6	,	,	PUNCT
finefocus-3634	56	7	2005	2005	NUM
finefocus-3634	56	8	)	)	PUNCT
finefocus-3634	56	9	(	(	PUNCT
finefocus-3634	56	10	müller	müller	PROPN
finefocus-3634	56	11	et	et	PROPN
finefocus-3634	56	12	al	al	PROPN
finefocus-3634	56	13	.	.	PROPN
finefocus-3634	56	14	,	,	PUNCT
finefocus-3634	56	15	2005	2005	NUM
finefocus-3634	56	16	)	)	PUNCT
finefocus-3634	56	17	(	(	PUNCT
finefocus-3634	56	18	hu	hu	PROPN
finefocus-3634	56	19	et	et	PROPN
finefocus-3634	56	20	al	al	PROPN
finefocus-3634	56	21	.	.	PROPN
finefocus-3634	56	22	,	,	PUNCT
finefocus-3634	56	23	2008	2008	NUM
finefocus-3634	56	24	)	)	PUNCT
finefocus-3634	56	25	(	(	PUNCT
finefocus-3634	56	26	thumarat	thumarat	NOUN
finefocus-3634	56	27	et	et	PROPN
finefocus-3634	56	28	al	al	PROPN
finefocus-3634	56	29	.	.	PROPN
finefocus-3634	56	30	,	,	PUNCT
finefocus-3634	56	31	2015	2015	NUM
finefocus-3634	56	32	)	)	PUNCT
finefocus-3634	56	33	(	(	PUNCT
finefocus-3634	56	34	thumarat	thumarat	NOUN
finefocus-3634	56	35	et	et	PROPN
finefocus-3634	56	36	al	al	PROPN
finefocus-3634	56	37	.	.	PROPN
finefocus-3634	56	38	,	,	PUNCT
finefocus-3634	56	39	2015	2015	NUM
finefocus-3634	56	40	)	)	PUNCT
finefocus-3634	56	41	vol	vol	NOUN
finefocus-3634	56	42	8	8	NUM
finefocus-3634	56	43	i	i	NOUN
finefocus-3634	56	44	91	91	NUM
finefocus-3634	56	45	entry	entry	NOUN
finefocus-3634	56	46	enzymes	enzyme	NOUN
finefocus-3634	56	47	reaction	reaction	NOUN
finefocus-3634	56	48	conditions	condition	NOUN
finefocus-3634	56	49	degradation	degradation	NOUN
finefocus-3634	56	50	amount	amount	NOUN
finefocus-3634	56	51	(	(	PUNCT
finefocus-3634	56	52	methods	method	NOUN
finefocus-3634	56	53	used	use	VERB
finefocus-3634	56	54	)	)	PUNCT
finefocus-3634	56	55	ref	ref	VERB
finefocus-3634	56	56	7	7	NUM
finefocus-3634	56	57	8	8	NUM
finefocus-3634	56	58	9	9	NUM
finefocus-3634	56	59	10	10	NUM
finefocus-3634	56	60	thc_cut1	thc_cut1	NOUN
finefocus-3634	56	61	thc_cut2	thc_cut2	PROPN
finefocus-3634	56	62	*	*	NOUN
finefocus-3634	56	63	thf42_cut1	thf42_cut1	NUM
finefocus-3634	56	64	tha_cut1	tha_cut1	NUM
finefocus-3634	56	65	10	10	NUM
finefocus-3634	56	66	×	×	NOUN
finefocus-3634	56	67	100	100	NUM
finefocus-3634	56	68	mm2	mm2	NOUN
finefocus-3634	56	69	pet	pet	ADJ
finefocus-3634	56	70	film	film	NOUN
finefocus-3634	56	71	reacted	react	VERB
finefocus-3634	56	72	with	with	ADP
finefocus-3634	56	73	6.75	6.75	NUM
finefocus-3634	56	74	μm	μm	ADJ
finefocus-3634	56	75	enzyme	enzyme	NOUN
finefocus-3634	56	76	in	in	ADP
finefocus-3634	56	77	13	13	NUM
finefocus-3634	56	78	ml	ml	NOUN
finefocus-3634	56	79	buffer	buffer	NOUN
finefocus-3634	56	80	;	;	PUNCT
finefocus-3634	56	81	50	50	NUM
finefocus-3634	56	82	°	°	NOUN
finefocus-3634	56	83	c	c	NOUN
finefocus-3634	56	84	;	;	PUNCT
finefocus-3634	56	85	ph	ph	PROPN
finefocus-3634	56	86	7.0	7.0	NUM
finefocus-3634	56	87	;	;	PUNCT
finefocus-3634	56	88	2	2	NUM
finefocus-3634	56	89	hours	hour	NOUN
finefocus-3634	56	90	10	10	NUM
finefocus-3634	56	91	×	×	NOUN
finefocus-3634	56	92	100	100	NUM
finefocus-3634	56	93	mm2	mm2	NOUN
finefocus-3634	56	94	pet	pet	ADJ
finefocus-3634	56	95	film	film	NOUN
finefocus-3634	56	96	reacted	react	VERB
finefocus-3634	56	97	with	with	ADP
finefocus-3634	56	98	6.75	6.75	NUM
finefocus-3634	56	99	μm	μm	ADJ
finefocus-3634	56	100	enzyme	enzyme	NOUN
finefocus-3634	56	101	in	in	ADP
finefocus-3634	56	102	13	13	NUM
finefocus-3634	56	103	ml	ml	NOUN
finefocus-3634	56	104	buffer	buffer	NOUN
finefocus-3634	56	105	;	;	PUNCT
finefocus-3634	56	106	50	50	NUM
finefocus-3634	56	107	°	°	NOUN
finefocus-3634	56	108	c	c	NOUN
finefocus-3634	56	109	;	;	PUNCT
finefocus-3634	56	110	ph	ph	PROPN
finefocus-3634	56	111	7.0	7.0	NUM
finefocus-3634	56	112	;	;	PUNCT
finefocus-3634	56	113	2	2	NUM
finefocus-3634	56	114	hours	hour	NOUN
finefocus-3634	56	115	10	10	NUM
finefocus-3634	56	116	×	×	NOUN
finefocus-3634	56	117	100	100	NUM
finefocus-3634	56	118	mm2	mm2	NOUN
finefocus-3634	56	119	pet	pet	ADJ
finefocus-3634	56	120	film	film	NOUN
finefocus-3634	56	121	reacted	react	VERB
finefocus-3634	56	122	with	with	ADP
finefocus-3634	56	123	6.75	6.75	NUM
finefocus-3634	56	124	μm	μm	ADJ
finefocus-3634	56	125	enzyme	enzyme	NOUN
finefocus-3634	56	126	in	in	ADP
finefocus-3634	56	127	13	13	NUM
finefocus-3634	56	128	ml	ml	NOUN
finefocus-3634	56	129	buffer	buffer	NOUN
finefocus-3634	56	130	;	;	PUNCT
finefocus-3634	56	131	50	50	NUM
finefocus-3634	56	132	°	°	NOUN
finefocus-3634	56	133	c	c	NOUN
finefocus-3634	56	134	;	;	PUNCT
finefocus-3634	56	135	ph	ph	PROPN
finefocus-3634	56	136	7.0	7.0	NUM
finefocus-3634	56	137	;	;	PUNCT
finefocus-3634	56	138	120	120	NUM
finefocus-3634	56	139	hours	hour	NOUN
finefocus-3634	56	140	10	10	NUM
finefocus-3634	56	141	×	×	NOUN
finefocus-3634	56	142	100	100	NUM
finefocus-3634	56	143	mm2	mm2	NOUN
finefocus-3634	56	144	pet	pet	ADJ
finefocus-3634	56	145	film	film	NOUN
finefocus-3634	56	146	reacted	react	VERB
finefocus-3634	56	147	with	with	ADP
finefocus-3634	56	148	6.75	6.75	NUM
finefocus-3634	56	149	μm	μm	ADJ
finefocus-3634	56	150	enzyme	enzyme	NOUN
finefocus-3634	56	151	in	in	ADP
finefocus-3634	56	152	13	13	NUM
finefocus-3634	56	153	ml	ml	NOUN
finefocus-3634	56	154	buffer	buffer	NOUN
finefocus-3634	56	155	;	;	PUNCT
finefocus-3634	56	156	50	50	NUM
finefocus-3634	56	157	°	°	NOUN
finefocus-3634	56	158	c	c	NOUN
finefocus-3634	56	159	;	;	PUNCT
finefocus-3634	56	160	ph	ph	PROPN
finefocus-3634	56	161	7.0	7.0	NUM
finefocus-3634	56	162	;	;	PUNCT
finefocus-3634	56	163	2	2	NUM
finefocus-3634	56	164	hours	hour	NOUN
finefocus-3634	56	165	wca	wca	NOUN
finefocus-3634	56	166	decreased	decrease	VERB
finefocus-3634	56	167	from	from	ADP
finefocus-3634	56	168	74.2	74.2	NUM
finefocus-3634	56	169	°	°	NUM
finefocus-3634	56	170	±	±	NUM
finefocus-3634	56	171	1.6	1.6	NUM
finefocus-3634	56	172	°	°	NOUN
finefocus-3634	56	173	to	to	ADP
finefocus-3634	56	174	66.3	66.3	NUM
finefocus-3634	56	175	°	°	NOUN
finefocus-3634	56	176	±	±	NUM
finefocus-3634	56	177	2.7	2.7	NUM
finefocus-3634	56	178	°	°	NOUN
finefocus-3634	56	179	(	(	PUNCT
finefocus-3634	56	180	wca	wca	NOUN
finefocus-3634	56	181	analyzer	analyzer	PROPN
finefocus-3634	56	182	)	)	PUNCT
finefocus-3634	56	183	wca	wca	NOUN
finefocus-3634	56	184	decreased	decrease	VERB
finefocus-3634	56	185	from	from	ADP
finefocus-3634	56	186	74.2	74.2	NUM
finefocus-3634	56	187	°	°	NUM
finefocus-3634	56	188	±	±	NUM
finefocus-3634	56	189	1.6	1.6	NUM
finefocus-3634	56	190	°	°	NOUN
finefocus-3634	56	191	to	to	ADP
finefocus-3634	56	192	71.2	71.2	NUM
finefocus-3634	56	193	°	°	NUM
finefocus-3634	56	194	±	±	NUM
finefocus-3634	56	195	0.9	0.9	NUM
finefocus-3634	56	196	°	°	NOUN
finefocus-3634	56	197	(	(	PUNCT
finefocus-3634	56	198	wca	wca	NOUN
finefocus-3634	56	199	analyzer	analyzer	NOUN
finefocus-3634	56	200	)	)	PUNCT
finefocus-3634	56	201	crystallinity	crystallinity	NOUN
finefocus-3634	56	202	loss	loss	NOUN
finefocus-3634	56	203	(	(	PUNCT
finefocus-3634	56	204	ftir	ftir	NOUN
finefocus-3634	56	205	-	-	ADJ
finefocus-3634	56	206	atr	atr	ADJ
finefocus-3634	56	207	)	)	PUNCT
finefocus-3634	56	208	wca	wca	NOUN
finefocus-3634	56	209	decreased	decrease	VERB
finefocus-3634	56	210	from	from	ADP
finefocus-3634	56	211	87.7	87.7	NUM
finefocus-3634	56	212	°	°	NUM
finefocus-3634	56	213	±	±	NUM
finefocus-3634	56	214	4.8	4.8	NUM
finefocus-3634	56	215	°	°	NOUN
finefocus-3634	56	216	to	to	ADP
finefocus-3634	56	217	45.0	45.0	NUM
finefocus-3634	56	218	°	°	NUM
finefocus-3634	56	219	±	±	NUM
finefocus-3634	56	220	6.0	6.0	NUM
finefocus-3634	56	221	°	°	NOUN
finefocus-3634	56	222	(	(	PUNCT
finefocus-3634	56	223	wca	wca	NOUN
finefocus-3634	56	224	analyzer	analyzer	NOUN
finefocus-3634	56	225	)	)	PUNCT
finefocus-3634	56	226	(	(	PUNCT
finefocus-3634	56	227	herrero	herrero	PROPN
finefocus-3634	56	228	acero	acero	PROPN
finefocus-3634	56	229	et	et	PROPN
finefocus-3634	56	230	al	al	PROPN
finefocus-3634	56	231	.	.	PROPN
finefocus-3634	56	232	,	,	PUNCT
finefocus-3634	56	233	2011	2011	NUM
finefocus-3634	56	234	)	)	PUNCT
finefocus-3634	56	235	(	(	PUNCT
finefocus-3634	56	236	herrero	herrero	PROPN
finefocus-3634	56	237	acero	acero	PROPN
finefocus-3634	56	238	et	et	PROPN
finefocus-3634	56	239	al	al	PROPN
finefocus-3634	56	240	.	.	PROPN
finefocus-3634	56	241	,	,	PUNCT
finefocus-3634	56	242	2011	2011	NUM
finefocus-3634	56	243	)	)	PUNCT
finefocus-3634	56	244	(	(	PUNCT
finefocus-3634	56	245	herrero	herrero	PROPN
finefocus-3634	56	246	acero	acero	PROPN
finefocus-3634	56	247	et	et	PROPN
finefocus-3634	56	248	al	al	PROPN
finefocus-3634	56	249	.	.	PROPN
finefocus-3634	56	250	,	,	PUNCT
finefocus-3634	56	251	2011	2011	NUM
finefocus-3634	56	252	)	)	PUNCT
finefocus-3634	56	253	(	(	PUNCT
finefocus-3634	56	254	ribitsch	ribitsch	VERB
finefocus-3634	56	255	et	et	PROPN
finefocus-3634	56	256	al	al	PROPN
finefocus-3634	56	257	.	.	PROPN
finefocus-3634	56	258	,	,	PUNCT
finefocus-3634	56	259	2012	2012	NUM
finefocus-3634	56	260	)	)	PUNCT
finefocus-3634	57	1	*	*	PUNCT
finefocus-3634	57	2	tfu	tfu	NOUN
finefocus-3634	57	3	=	=	PUNCT
finefocus-3634	57	4	t.	t.	NOUN
finefocus-3634	57	5	fusca	fusca	NOUN
finefocus-3634	57	6	;	;	PUNCT
finefocus-3634	57	7	*	*	PUNCT
finefocus-3634	57	8	*	*	NOUN
finefocus-3634	57	9	tfcu	tfcu	NOUN
finefocus-3634	57	10	=	=	PUNCT
finefocus-3634	57	11	t.	t.	NOUN
finefocus-3634	57	12	fusca	fusca	NOUN
finefocus-3634	57	13	cutinase	cutinase	NOUN
finefocus-3634	57	14	;	;	PUNCT
finefocus-3634	57	15	sem	sem	NOUN
finefocus-3634	57	16	=	=	SYM
finefocus-3634	57	17	scanning	scan	VERB
finefocus-3634	57	18	electron	electron	NOUN
finefocus-3634	57	19	microscopy	microscopy	NOUN
finefocus-3634	57	20	;	;	PUNCT
finefocus-3634	57	21	ftri	ftri	ADJ
finefocus-3634	57	22	=	=	PUNCT
finefocus-3634	57	23	fourier	fourier	NOUN
finefocus-3634	57	24	-	-	PUNCT
finefocus-3634	57	25	transform	transform	NOUN
finefocus-3634	57	26	infrared	infrared	ADJ
finefocus-3634	57	27	spectroscopy	spectroscopy	NOUN
finefocus-3634	57	28	;	;	PUNCT
finefocus-3634	57	29	wca	wca	NOUN
finefocus-3634	57	30	=	=	PUNCT
finefocus-3634	57	31	water	water	NOUN
finefocus-3634	57	32	contact	contact	NOUN
finefocus-3634	57	33	angle	angle	NOUN
finefocus-3634	57	34	it	it	PRON
finefocus-3634	57	35	is	be	AUX
finefocus-3634	57	36	hypothesized	hypothesize	VERB
finefocus-3634	57	37	that	that	SCONJ
finefocus-3634	57	38	the	the	DET
finefocus-3634	57	39	flexibility	flexibility	NOUN
finefocus-3634	57	40	provided	provide	VERB
finefocus-3634	57	41	by	by	ADP
finefocus-3634	57	42	the	the	DET
finefocus-3634	57	43	disulfide	disulfide	NOUN
finefocus-3634	57	44	bond	bond	NOUN
finefocus-3634	57	45	attributed	attribute	VERB
finefocus-3634	57	46	to	to	ADP
finefocus-3634	57	47	petase	petase	NOUN
finefocus-3634	57	48	’s	’s	PART
finefocus-3634	57	49	degradation	degradation	NOUN
finefocus-3634	57	50	performance	performance	NOUN
finefocus-3634	57	51	.	.	PUNCT
finefocus-3634	58	1	the	the	DET
finefocus-3634	58	2	role	role	NOUN
finefocus-3634	58	3	of	of	ADP
finefocus-3634	58	4	the	the	DET
finefocus-3634	58	5	disulfide	disulfide	NOUN
finefocus-3634	58	6	bond	bond	NOUN
finefocus-3634	58	7	,	,	PUNCT
finefocus-3634	58	8	which	which	PRON
finefocus-3634	58	9	is	be	AUX
finefocus-3634	58	10	unique	unique	ADJ
finefocus-3634	58	11	to	to	ADP
finefocus-3634	58	12	petase	petase	NOUN
finefocus-3634	58	13	,	,	PUNCT
finefocus-3634	58	14	has	have	AUX
finefocus-3634	58	15	not	not	PART
finefocus-3634	58	16	been	be	AUX
finefocus-3634	58	17	experimentally	experimentally	ADV
finefocus-3634	58	18	tested	test	VERB
finefocus-3634	58	19	in	in	ADP
finefocus-3634	58	20	the	the	DET
finefocus-3634	58	21	degradation	degradation	NOUN
finefocus-3634	58	22	of	of	ADP
finefocus-3634	58	23	pet	pet	NOUN
finefocus-3634	58	24	,	,	PUNCT
finefocus-3634	58	25	despite	despite	SCONJ
finefocus-3634	58	26	it	it	PRON
finefocus-3634	58	27	predicted	predict	VERB
finefocus-3634	58	28	positive	positive	ADJ
finefocus-3634	58	29	traits	trait	NOUN
finefocus-3634	58	30	from	from	ADP
finefocus-3634	58	31	simulation	simulation	NOUN
finefocus-3634	58	32	.	.	PUNCT
finefocus-3634	59	1	the	the	DET
finefocus-3634	59	2	present	present	ADJ
finefocus-3634	59	3	work	work	NOUN
finefocus-3634	59	4	experimentally	experimentally	ADV
finefocus-3634	59	5	demonstrates	demonstrate	VERB
finefocus-3634	59	6	the	the	DET
finefocus-3634	59	7	effect	effect	NOUN
finefocus-3634	59	8	of	of	ADP
finefocus-3634	59	9	disulfide	disulfide	NOUN
finefocus-3634	59	10	bond	bond	NOUN
finefocus-3634	59	11	of	of	ADP
finefocus-3634	59	12	petase	petase	NOUN
finefocus-3634	59	13	to	to	ADP
finefocus-3634	59	14	the	the	DET
finefocus-3634	59	15	degradation	degradation	NOUN
finefocus-3634	59	16	of	of	ADP
finefocus-3634	59	17	ester	ester	NOUN
finefocus-3634	59	18	linkage	linkage	NOUN
finefocus-3634	59	19	of	of	ADP
finefocus-3634	59	20	pet	pet	NOUN
finefocus-3634	59	21	.	.	PUNCT
finefocus-3634	60	1	first	first	ADV
finefocus-3634	60	2	,	,	PUNCT
finefocus-3634	60	3	amino	amino	NOUN
finefocus-3634	60	4	acid	acid	NOUN
finefocus-3634	60	5	sequence	sequence	NOUN
finefocus-3634	60	6	of	of	ADP
finefocus-3634	60	7	a	a	DET
finefocus-3634	60	8	petase	petase	NOUN
finefocus-3634	60	9	protein	protein	NOUN
finefocus-3634	60	10	without	without	ADP
finefocus-3634	60	11	disulfide	disulfide	NOUN
finefocus-3634	60	12	bond	bond	NOUN
finefocus-3634	60	13	was	be	AUX
finefocus-3634	60	14	modeled	model	VERB
finefocus-3634	60	15	.	.	PUNCT
finefocus-3634	61	1	then	then	ADV
finefocus-3634	61	2	petases	petase	VERB
finefocus-3634	61	3	with	with	ADP
finefocus-3634	61	4	and	and	CCONJ
finefocus-3634	61	5	without	without	ADP
finefocus-3634	61	6	disulfide	disulfide	NOUN
finefocus-3634	61	7	bond	bond	NOUN
finefocus-3634	61	8	were	be	AUX
finefocus-3634	61	9	synthesized	synthesize	VERB
finefocus-3634	61	10	following	follow	VERB
finefocus-3634	61	11	their	their	PRON
finefocus-3634	61	12	sequences	sequence	NOUN
finefocus-3634	61	13	and	and	CCONJ
finefocus-3634	61	14	their	their	PRON
finefocus-3634	61	15	activities	activity	NOUN
finefocus-3634	61	16	in	in	ADP
finefocus-3634	61	17	the	the	DET
finefocus-3634	61	18	degradation	degradation	NOUN
finefocus-3634	61	19	of	of	ADP
finefocus-3634	61	20	ester	ester	NOUN
finefocus-3634	61	21	linkage	linkage	NOUN
finefocus-3634	61	22	of	of	ADP
finefocus-3634	61	23	pet	pet	NOUN
finefocus-3634	61	24	have	have	AUX
finefocus-3634	61	25	been	be	AUX
finefocus-3634	61	26	experimentally	experimentally	ADV
finefocus-3634	61	27	tested	test	VERB
finefocus-3634	61	28	using	use	VERB
finefocus-3634	61	29	bhet	bhet	NOUN
finefocus-3634	61	30	as	as	ADP
finefocus-3634	61	31	a	a	DET
finefocus-3634	61	32	model	model	NOUN
finefocus-3634	61	33	compound	compound	NOUN
finefocus-3634	61	34	.	.	PUNCT
finefocus-3634	62	1	bhet	bhet	PROPN
finefocus-3634	62	2	,	,	PUNCT
finefocus-3634	62	3	a	a	DET
finefocus-3634	62	4	building	building	NOUN
finefocus-3634	62	5	block	block	NOUN
finefocus-3634	62	6	oligomeric	oligomeric	ADJ
finefocus-3634	62	7	unit	unit	NOUN
finefocus-3634	62	8	of	of	ADP
finefocus-3634	62	9	pet	pet	NOUN
finefocus-3634	62	10	which	which	PRON
finefocus-3634	62	11	contains	contain	VERB
finefocus-3634	62	12	eg	eg	NOUN
finefocus-3634	62	13	and	and	CCONJ
finefocus-3634	62	14	tpa	tpa	NOUN
finefocus-3634	62	15	monomeric	monomeric	ADJ
finefocus-3634	62	16	units	unit	NOUN
finefocus-3634	62	17	in	in	ADP
finefocus-3634	62	18	2:1	2:1	NUM
finefocus-3634	62	19	molar	molar	ADJ
finefocus-3634	62	20	ratio	ratio	NOUN
finefocus-3634	62	21	,	,	PUNCT
finefocus-3634	62	22	is	be	AUX
finefocus-3634	62	23	used	use	VERB
finefocus-3634	62	24	as	as	ADP
finefocus-3634	62	25	a	a	DET
finefocus-3634	62	26	surrogate	surrogate	ADJ
finefocus-3634	62	27	substate	substate	NOUN
finefocus-3634	62	28	in	in	ADP
finefocus-3634	62	29	this	this	DET
finefocus-3634	62	30	study	study	NOUN
finefocus-3634	62	31	because	because	SCONJ
finefocus-3634	62	32	(	(	PUNCT
finefocus-3634	62	33	1	1	X
finefocus-3634	62	34	)	)	PUNCT
finefocus-3634	62	35	it	it	PRON
finefocus-3634	62	36	is	be	AUX
finefocus-3634	62	37	expected	expect	VERB
finefocus-3634	62	38	to	to	PART
finefocus-3634	62	39	have	have	VERB
finefocus-3634	62	40	faster	fast	ADJ
finefocus-3634	62	41	degradation	degradation	NOUN
finefocus-3634	62	42	rate	rate	NOUN
finefocus-3634	62	43	than	than	ADP
finefocus-3634	62	44	pet	pet	ADJ
finefocus-3634	62	45	and	and	CCONJ
finefocus-3634	62	46	(	(	PUNCT
finefocus-3634	62	47	2	2	X
finefocus-3634	62	48	)	)	PUNCT
finefocus-3634	62	49	it	it	PRON
finefocus-3634	62	50	can	can	AUX
finefocus-3634	62	51	completely	completely	ADV
finefocus-3634	62	52	degrade	degrade	VERB
finefocus-3634	62	53	to	to	ADP
finefocus-3634	62	54	eg	eg	NOUN
finefocus-3634	62	55	and	and	CCONJ
finefocus-3634	62	56	tpa	tpa	PROPN
finefocus-3634	62	57	,	,	PUNCT
finefocus-3634	62	58	which	which	PRON
finefocus-3634	62	59	can	can	AUX
finefocus-3634	62	60	be	be	AUX
finefocus-3634	62	61	quantitatively	quantitatively	ADV
finefocus-3634	62	62	measured	measure	VERB
finefocus-3634	62	63	to	to	PART
finefocus-3634	62	64	accurately	accurately	ADV
finefocus-3634	62	65	determine	determine	VERB
finefocus-3634	62	66	the	the	DET
finefocus-3634	62	67	role	role	NOUN
finefocus-3634	62	68	of	of	ADP
finefocus-3634	62	69	the	the	DET
finefocus-3634	62	70	disulfide	disulfide	NOUN
finefocus-3634	62	71	bond	bond	NOUN
finefocus-3634	62	72	.	.	PUNCT
finefocus-3634	63	1	controlled	control	VERB
finefocus-3634	63	2	experiments	experiment	NOUN
finefocus-3634	63	3	were	be	AUX
finefocus-3634	63	4	performed	perform	VERB
finefocus-3634	63	5	without	without	ADP
finefocus-3634	63	6	petase	petase	NOUN
finefocus-3634	63	7	and	and	CCONJ
finefocus-3634	63	8	in	in	ADP
finefocus-3634	63	9	the	the	DET
finefocus-3634	63	10	presence	presence	NOUN
finefocus-3634	63	11	of	of	ADP
finefocus-3634	63	12	phenylmethylsulfonyl	phenylmethylsulfonyl	NOUN
finefocus-3634	63	13	fluoride	fluoride	NOUN
finefocus-3634	63	14	(	(	PUNCT
finefocus-3634	63	15	pmsf	pmsf	NOUN
finefocus-3634	63	16	)	)	PUNCT
finefocus-3634	63	17	to	to	PART
finefocus-3634	63	18	evaluate	evaluate	VERB
finefocus-3634	63	19	if	if	SCONJ
finefocus-3634	63	20	pmsf	pmsf	NOUN
finefocus-3634	63	21	disrupts	disrupt	VERB
finefocus-3634	63	22	petase	petase	NOUN
finefocus-3634	63	23	’s	’s	PART
finefocus-3634	63	24	activity	activity	NOUN
finefocus-3634	63	25	by	by	ADP
finefocus-3634	63	26	interacting	interact	VERB
finefocus-3634	63	27	with	with	ADP
finefocus-3634	63	28	their	their	PRON
finefocus-3634	63	29	catalytic	catalytic	ADJ
finefocus-3634	63	30	triad	triad	ADJ
finefocus-3634	63	31	serine	serine	NOUN
finefocus-3634	63	32	.	.	PUNCT
finefocus-3634	64	1	the	the	DET
finefocus-3634	64	2	results	result	NOUN
finefocus-3634	64	3	indicate	indicate	VERB
finefocus-3634	64	4	that	that	SCONJ
finefocus-3634	64	5	the	the	DET
finefocus-3634	64	6	disulfide	disulfide	NOUN
finefocus-3634	64	7	bond	bond	NOUN
finefocus-3634	64	8	does	do	AUX
finefocus-3634	64	9	not	not	PART
finefocus-3634	64	10	significantly	significantly	ADV
finefocus-3634	64	11	influence	influence	VERB
finefocus-3634	64	12	the	the	DET
finefocus-3634	64	13	degradation	degradation	NOUN
finefocus-3634	64	14	of	of	ADP
finefocus-3634	64	15	bhet	bhet	NOUN
finefocus-3634	64	16	’s	’s	PART
finefocus-3634	64	17	ester	ester	NOUN
finefocus-3634	64	18	linkage	linkage	NOUN
finefocus-3634	64	19	.	.	PUNCT
finefocus-3634	65	1	experimental	experimental	ADJ
finefocus-3634	65	2	section	section	NOUN
finefocus-3634	65	3	materials	material	NOUN
finefocus-3634	65	4	luria	luria	PROPN
finefocus-3634	65	5	bertani	bertani	NOUN
finefocus-3634	65	6	(	(	PUNCT
finefocus-3634	65	7	lb	lb	X
finefocus-3634	65	8	)	)	PUNCT
finefocus-3634	65	9	broth	broth	NOUN
finefocus-3634	65	10	,	,	PUNCT
finefocus-3634	65	11	calcium	calcium	NOUN
finefocus-3634	65	12	chloride	chloride	NOUN
finefocus-3634	65	13	,	,	PUNCT
finefocus-3634	65	14	ampicillin	ampicillin	PROPN
finefocus-3634	65	15	,	,	PUNCT
finefocus-3634	65	16	lysogeny	lysogeny	NOUN
finefocus-3634	65	17	broth	broth	NOUN
finefocus-3634	65	18	,	,	PUNCT
finefocus-3634	65	19	tris	tris	ADJ
finefocus-3634	65	20	buffer	buffer	NOUN
finefocus-3634	65	21	,	,	PUNCT
finefocus-3634	65	22	hcl	hcl	PROPN
finefocus-3634	65	23	,	,	PUNCT
finefocus-3634	65	24	phenylmethylsulfonyl	phenylmethylsulfonyl	PROPN
finefocus-3634	65	25	fluoride	fluoride	NOUN
finefocus-3634	65	26	(	(	PUNCT
finefocus-3634	65	27	pmsf	pmsf	NOUN
finefocus-3634	65	28	)	)	PUNCT
finefocus-3634	65	29	,	,	PUNCT
finefocus-3634	65	30	hi	hi	ADJ
finefocus-3634	65	31	-	-	PUNCT
finefocus-3634	65	32	trap	trap	NOUN
finefocus-3634	65	33	columns	column	NOUN
finefocus-3634	65	34	,	,	PUNCT
finefocus-3634	65	35	and	and	CCONJ
finefocus-3634	65	36	nacl	nacl	NOUN
finefocus-3634	65	37	were	be	AUX
finefocus-3634	65	38	procured	procure	VERB
finefocus-3634	65	39	from	from	ADP
finefocus-3634	65	40	sigma	sigma	PROPN
finefocus-3634	65	41	-	-	PUNCT
finefocus-3634	65	42	aldrich	aldrich	NOUN
finefocus-3634	65	43	.	.	PUNCT
finefocus-3634	66	1	isopropyl	isopropyl	PROPN
finefocus-3634	66	2	βd-1	βd-1	NOUN
finefocus-3634	66	3	-	-	NOUN
finefocus-3634	66	4	thiogalactopyranoside	thiogalactopyranoside	ADJ
finefocus-3634	66	5	(	(	PUNCT
finefocus-3634	66	6	iptg	iptg	NOUN
finefocus-3634	66	7	)	)	PUNCT
finefocus-3634	66	8	and	and	CCONJ
finefocus-3634	66	9	bichionic	bichionic	ADJ
finefocus-3634	66	10	acid	acid	NOUN
finefocus-3634	66	11	assay	assay	NOUN
finefocus-3634	66	12	were	be	AUX
finefocus-3634	66	13	obtained	obtain	VERB
finefocus-3634	66	14	from	from	ADP
finefocus-3634	66	15	fisher	fisher	PROPN
finefocus-3634	66	16	scientific	scientific	PROPN
finefocus-3634	66	17	.	.	PUNCT
finefocus-3634	67	1	a	a	DET
finefocus-3634	67	2	refractometer	refractometer	NOUN
finefocus-3634	67	3	was	be	AUX
finefocus-3634	67	4	purchased	purchase	VERB
finefocus-3634	67	5	from	from	ADP
finefocus-3634	67	6	hanna	hanna	PROPN
finefocus-3634	67	7	92	92	NUM
finefocus-3634	67	8	i	i	PRON
finefocus-3634	67	9	fine	fine	ADJ
finefocus-3634	67	10	focus	focus	NOUN
finefocus-3634	67	11	instruments	instrument	NOUN
finefocus-3634	67	12	.	.	PUNCT
finefocus-3634	68	1	bl21	bl21	PROPN
finefocus-3634	68	2	e.	e.	PROPN
finefocus-3634	68	3	coli	coli	NOUN
finefocus-3634	68	4	cells	cell	NOUN
finefocus-3634	68	5	were	be	AUX
finefocus-3634	68	6	obtained	obtain	VERB
finefocus-3634	68	7	from	from	ADP
finefocus-3634	68	8	dr	dr	PROPN
finefocus-3634	68	9	.	.	PROPN
finefocus-3634	68	10	clark	clark	PROPN
finefocus-3634	68	11	gedney	gedney	PROPN
finefocus-3634	68	12	’s	’s	PART
finefocus-3634	68	13	lab	lab	NOUN
finefocus-3634	68	14	in	in	ADP
finefocus-3634	68	15	biological	biological	ADJ
finefocus-3634	68	16	science	science	PROPN
finefocus-3634	68	17	department	department	PROPN
finefocus-3634	68	18	at	at	ADP
finefocus-3634	68	19	purdue	purdue	PROPN
finefocus-3634	68	20	university	university	PROPN
finefocus-3634	68	21	.	.	PUNCT
finefocus-3634	69	1	petase	petase	ADP
finefocus-3634	69	2	recombinant	recombinant	ADJ
finefocus-3634	69	3	plasmid	plasmid	NOUN
finefocus-3634	69	4	containing	contain	VERB
finefocus-3634	69	5	the	the	DET
finefocus-3634	69	6	gene	gene	NOUN
finefocus-3634	69	7	to	to	PART
finefocus-3634	69	8	produce	produce	VERB
finefocus-3634	69	9	petase	petase	NOUN
finefocus-3634	69	10	with	with	ADP
finefocus-3634	69	11	a	a	DET
finefocus-3634	69	12	disulfide	disulfide	NOUN
finefocus-3634	69	13	bond	bond	NOUN
finefocus-3634	69	14	(	(	PUNCT
finefocus-3634	69	15	referred	refer	VERB
finefocus-3634	69	16	hereto	hereto	NOUN
finefocus-3634	69	17	as	as	ADP
finefocus-3634	69	18	a2	a2	PROPN
finefocus-3634	69	19	)	)	PUNCT
finefocus-3634	69	20	was	be	AUX
finefocus-3634	69	21	purchased	purchase	VERB
finefocus-3634	69	22	from	from	ADP
finefocus-3634	69	23	integrated	integrate	VERB
finefocus-3634	69	24	dna	dna	PROPN
finefocus-3634	69	25	technologies	technology	NOUN
finefocus-3634	69	26	(	(	PUNCT
finefocus-3634	69	27	idt	idt	PROPN
finefocus-3634	69	28	)	)	PUNCT
finefocus-3634	69	29	.	.	PUNCT
finefocus-3634	70	1	amino	amino	NOUN
finefocus-3634	70	2	acid	acid	NOUN
finefocus-3634	70	3	sequence	sequence	NOUN
finefocus-3634	70	4	of	of	ADP
finefocus-3634	70	5	the	the	DET
finefocus-3634	70	6	modified	modify	VERB
finefocus-3634	70	7	petase	petase	NOUN
finefocus-3634	70	8	without	without	ADP
finefocus-3634	70	9	a	a	DET
finefocus-3634	70	10	disulfide	disulfide	NOUN
finefocus-3634	70	11	bond	bond	NOUN
finefocus-3634	70	12	(	(	PUNCT
finefocus-3634	70	13	referred	refer	VERB
finefocus-3634	70	14	here	here	ADV
finefocus-3634	70	15	to	to	ADP
finefocus-3634	70	16	as	as	ADP
finefocus-3634	70	17	a1	a1	NOUN
finefocus-3634	70	18	)	)	PUNCT
finefocus-3634	70	19	was	be	AUX
finefocus-3634	70	20	modeled	model	VERB
finefocus-3634	70	21	using	use	VERB
finefocus-3634	70	22	pymol	pymol	NOUN
finefocus-3634	70	23	™	™	ADJ
finefocus-3634	70	24	software	software	NOUN
finefocus-3634	70	25	(	(	PUNCT
finefocus-3634	70	26	schrödinger	schrödinger	PROPN
finefocus-3634	70	27	,	,	PUNCT
finefocus-3634	70	28	inc	inc	PROPN
finefocus-3634	70	29	.	.	PROPN
finefocus-3634	70	30	version	version	PROPN
finefocus-3634	70	31	3	3	NUM
finefocus-3634	70	32	)	)	PUNCT
finefocus-3634	70	33	.	.	PUNCT
finefocus-3634	71	1	the	the	DET
finefocus-3634	71	2	sequence	sequence	NOUN
finefocus-3634	71	3	was	be	AUX
finefocus-3634	71	4	sent	send	VERB
finefocus-3634	71	5	to	to	ADP
finefocus-3634	71	6	idt	idt	PROPN
finefocus-3634	71	7	to	to	PART
finefocus-3634	71	8	synthesize	synthesize	VERB
finefocus-3634	71	9	the	the	DET
finefocus-3634	71	10	modified	modified	ADJ
finefocus-3634	71	11	petase	petase	NOUN
finefocus-3634	71	12	.	.	PUNCT
finefocus-3634	72	1	both	both	CCONJ
finefocus-3634	72	2	the	the	DET
finefocus-3634	72	3	organism	organism	NOUN
finefocus-3634	72	4	containing	contain	VERB
finefocus-3634	72	5	/	/	SYM
finefocus-3634	72	6	expressing	express	VERB
finefocus-3634	72	7	the	the	DET
finefocus-3634	72	8	plasmid	plasmid	NOUN
finefocus-3634	72	9	were	be	AUX
finefocus-3634	72	10	cultured	cultured	ADJ
finefocus-3634	72	11	for	for	ADP
finefocus-3634	72	12	extracting	extract	VERB
finefocus-3634	72	13	proteins	protein	NOUN
finefocus-3634	72	14	by	by	ADP
finefocus-3634	72	15	following	follow	VERB
finefocus-3634	72	16	similar	similar	ADJ
finefocus-3634	72	17	procedures	procedure	NOUN
finefocus-3634	72	18	as	as	SCONJ
finefocus-3634	72	19	described	describe	VERB
finefocus-3634	72	20	below	below	ADV
finefocus-3634	72	21	.	.	PUNCT
finefocus-3634	73	1	petase	petase	NOUN
finefocus-3634	73	2	sequence	sequence	NOUN
finefocus-3634	73	3	modification	modification	NOUN
finefocus-3634	73	4	the	the	DET
finefocus-3634	73	5	software	software	NOUN
finefocus-3634	73	6	pymol	pymol	PROPN
finefocus-3634	73	7	™	™	NOUN
finefocus-3634	73	8	was	be	AUX
finefocus-3634	73	9	utilized	utilize	VERB
finefocus-3634	73	10	in	in	ADP
finefocus-3634	73	11	order	order	NOUN
finefocus-3634	73	12	to	to	PART
finefocus-3634	73	13	model	model	VERB
finefocus-3634	73	14	a1	a1	NOUN
finefocus-3634	73	15	and	and	CCONJ
finefocus-3634	73	16	a2	a2	PROPN
finefocus-3634	73	17	.	.	PUNCT
finefocus-3634	74	1	a2	a2	PROPN
finefocus-3634	74	2	,	,	PUNCT
finefocus-3634	74	3	which	which	PRON
finefocus-3634	74	4	contains	contain	VERB
finefocus-3634	74	5	a	a	DET
finefocus-3634	74	6	disulfide	disulfide	NOUN
finefocus-3634	74	7	bond	bond	NOUN
finefocus-3634	74	8	,	,	PUNCT
finefocus-3634	74	9	was	be	AUX
finefocus-3634	74	10	produced	produce	VERB
finefocus-3634	74	11	by	by	ADP
finefocus-3634	74	12	isolating	isolate	VERB
finefocus-3634	74	13	the	the	DET
finefocus-3634	74	14	active	active	ADJ
finefocus-3634	74	15	site	site	NOUN
finefocus-3634	74	16	of	of	ADP
finefocus-3634	74	17	petase	petase	NOUN
finefocus-3634	74	18	.	.	PUNCT
finefocus-3634	75	1	its	its	PRON
finefocus-3634	75	2	sequence	sequence	NOUN
finefocus-3634	75	3	is	be	AUX
finefocus-3634	75	4	shown	show	VERB
finefocus-3634	75	5	in	in	ADP
finefocus-3634	75	6	figure	figure	NOUN
finefocus-3634	75	7	1c	1c	NOUN
finefocus-3634	75	8	.	.	PUNCT
finefocus-3634	76	1	to	to	PART
finefocus-3634	76	2	produce	produce	VERB
finefocus-3634	76	3	the	the	DET
finefocus-3634	76	4	sequence	sequence	NOUN
finefocus-3634	76	5	of	of	ADP
finefocus-3634	76	6	a1	a1	NOUN
finefocus-3634	76	7	(	(	PUNCT
finefocus-3634	76	8	figure	figure	NOUN
finefocus-3634	76	9	1b	1b	NUM
finefocus-3634	76	10	)	)	PUNCT
finefocus-3634	76	11	,	,	PUNCT
finefocus-3634	76	12	disulfide	disulfide	NOUN
finefocus-3634	76	13	bond	bond	NOUN
finefocus-3634	76	14	(	(	PUNCT
finefocus-3634	76	15	red	red	ADJ
finefocus-3634	76	16	colored	colored	ADJ
finefocus-3634	76	17	portion	portion	NOUN
finefocus-3634	76	18	)	)	PUNCT
finefocus-3634	76	19	of	of	ADP
finefocus-3634	76	20	the	the	DET
finefocus-3634	76	21	sequence	sequence	NOUN
finefocus-3634	76	22	in	in	ADP
finefocus-3634	76	23	figure	figure	NOUN
finefocus-3634	76	24	1c	1c	NOUN
finefocus-3634	76	25	was	be	AUX
finefocus-3634	76	26	removed	remove	VERB
finefocus-3634	76	27	.	.	PUNCT
finefocus-3634	77	1	rather	rather	ADV
finefocus-3634	77	2	than	than	ADP
finefocus-3634	77	3	using	use	VERB
finefocus-3634	77	4	the	the	DET
finefocus-3634	77	5	entire	entire	ADJ
finefocus-3634	77	6	petase	petase	NOUN
finefocus-3634	77	7	sequence	sequence	NOUN
finefocus-3634	77	8	,	,	PUNCT
finefocus-3634	77	9	the	the	DET
finefocus-3634	77	10	active	active	ADJ
finefocus-3634	77	11	site	site	NOUN
finefocus-3634	77	12	was	be	AUX
finefocus-3634	77	13	isolated	isolate	VERB
finefocus-3634	77	14	to	to	PART
finefocus-3634	77	15	enable	enable	VERB
finefocus-3634	77	16	a	a	DET
finefocus-3634	77	17	focused	focused	ADJ
finefocus-3634	77	18	investigation	investigation	NOUN
finefocus-3634	77	19	into	into	ADP
finefocus-3634	77	20	the	the	DET
finefocus-3634	77	21	disulfide	disulfide	NOUN
finefocus-3634	77	22	bond	bond	NOUN
finefocus-3634	77	23	’s	’s	PART
finefocus-3634	77	24	effect	effect	NOUN
finefocus-3634	77	25	on	on	ADP
finefocus-3634	77	26	petase	petase	NOUN
finefocus-3634	77	27	’s	’s	PART
finefocus-3634	77	28	active	active	ADJ
finefocus-3634	77	29	site	site	NOUN
finefocus-3634	77	30	.	.	PUNCT
finefocus-3634	78	1	transformation	transformation	NOUN
finefocus-3634	78	2	of	of	ADP
finefocus-3634	78	3	e.	e.	PROPN
finefocus-3634	78	4	coli	coli	NOUN
finefocus-3634	78	5	cells	cell	NOUN
finefocus-3634	78	6	frozen	freeze	VERB
finefocus-3634	78	7	bl21	bl21	PROPN
finefocus-3634	78	8	cells	cell	NOUN
finefocus-3634	78	9	were	be	AUX
finefocus-3634	78	10	grown	grow	VERB
finefocus-3634	78	11	on	on	ADP
finefocus-3634	78	12	petri	petri	ADJ
finefocus-3634	78	13	dishes	dish	NOUN
finefocus-3634	78	14	of	of	ADP
finefocus-3634	78	15	luriabertani	luriabertani	ADJ
finefocus-3634	78	16	broth	broth	NOUN
finefocus-3634	78	17	media	medium	NOUN
finefocus-3634	78	18	until	until	SCONJ
finefocus-3634	78	19	20	20	NUM
finefocus-3634	78	20	colonies	colony	NOUN
finefocus-3634	78	21	were	be	AUX
finefocus-3634	78	22	visible	visible	ADJ
finefocus-3634	78	23	on	on	ADP
finefocus-3634	78	24	each	each	DET
finefocus-3634	78	25	plate	plate	NOUN
finefocus-3634	78	26	.	.	PUNCT
finefocus-3634	79	1	approximately	approximately	ADV
finefocus-3634	79	2	20	20	NUM
finefocus-3634	79	3	colonies	colony	NOUN
finefocus-3634	79	4	of	of	ADP
finefocus-3634	79	5	e.	e.	PROPN
finefocus-3634	79	6	coli	coli	PROPN
finefocus-3634	79	7	were	be	AUX
finefocus-3634	79	8	transferred	transfer	VERB
finefocus-3634	79	9	to	to	ADP
finefocus-3634	79	10	250	250	NUM
finefocus-3634	79	11	μl	μl	ADP
finefocus-3634	79	12	of	of	ADP
finefocus-3634	79	13	0.1	0.1	NUM
finefocus-3634	79	14	m	m	NOUN
finefocus-3634	79	15	calcium	calcium	NOUN
finefocus-3634	79	16	chloride	chloride	NOUN
finefocus-3634	79	17	solution	solution	NOUN
finefocus-3634	79	18	in	in	ADP
finefocus-3634	79	19	a	a	DET
finefocus-3634	79	20	sterile	sterile	ADJ
finefocus-3634	79	21	microcentrifuge	microcentrifuge	ADJ
finefocus-3634	79	22	tube	tube	NOUN
finefocus-3634	79	23	and	and	CCONJ
finefocus-3634	79	24	mixed	mixed	ADJ
finefocus-3634	79	25	.	.	PUNCT
finefocus-3634	80	1	to	to	ADP
finefocus-3634	80	2	another	another	DET
finefocus-3634	80	3	microcentrifuge	microcentrifuge	ADJ
finefocus-3634	80	4	tube	tube	NOUN
finefocus-3634	80	5	,	,	PUNCT
finefocus-3634	80	6	20	20	NUM
finefocus-3634	80	7	colonies	colony	NOUN
finefocus-3634	80	8	of	of	ADP
finefocus-3634	80	9	e.	e.	PROPN
finefocus-3634	80	10	coli	coli	PROPN
finefocus-3634	80	11	were	be	AUX
finefocus-3634	80	12	added	add	VERB
finefocus-3634	80	13	to	to	ADP
finefocus-3634	80	14	250	250	NUM
finefocus-3634	80	15	μl	μl	ADP
finefocus-3634	80	16	of	of	ADP
finefocus-3634	80	17	calcium	calcium	NOUN
finefocus-3634	80	18	chloride	chloride	NOUN
finefocus-3634	80	19	solution	solution	NOUN
finefocus-3634	80	20	and	and	CCONJ
finefocus-3634	80	21	mixed	mixed	ADJ
finefocus-3634	80	22	.	.	PUNCT
finefocus-3634	81	1	10	10	NUM
finefocus-3634	81	2	μl	μl	ADP
finefocus-3634	81	3	of	of	ADP
finefocus-3634	81	4	petase	petase	NOUN
finefocus-3634	81	5	plasmid	plasmid	NOUN
finefocus-3634	81	6	(	(	PUNCT
finefocus-3634	81	7	e.g.	e.g.	ADV
finefocus-3634	81	8	a1	a1	NOUN
finefocus-3634	81	9	)	)	PUNCT
finefocus-3634	81	10	was	be	AUX
finefocus-3634	81	11	added	add	VERB
finefocus-3634	81	12	to	to	ADP
finefocus-3634	81	13	one	one	NUM
finefocus-3634	81	14	of	of	ADP
finefocus-3634	81	15	these	these	DET
finefocus-3634	81	16	two	two	NUM
finefocus-3634	81	17	tubes	tube	NOUN
finefocus-3634	81	18	(	(	PUNCT
finefocus-3634	81	19	tube	tube	NOUN
finefocus-3634	81	20	1	1	NUM
finefocus-3634	81	21	)	)	PUNCT
finefocus-3634	81	22	and	and	CCONJ
finefocus-3634	81	23	vortexed	vortexe	VERB
finefocus-3634	81	24	for	for	ADP
finefocus-3634	81	25	5	5	NUM
finefocus-3634	81	26	seconds	second	NOUN
finefocus-3634	81	27	.	.	PUNCT
finefocus-3634	82	1	the	the	DET
finefocus-3634	82	2	second	second	ADJ
finefocus-3634	82	3	tube	tube	NOUN
finefocus-3634	82	4	without	without	ADP
finefocus-3634	82	5	plasmids	plasmid	NOUN
finefocus-3634	82	6	is	be	AUX
finefocus-3634	82	7	referred	refer	VERB
finefocus-3634	82	8	here	here	ADV
finefocus-3634	82	9	to	to	ADP
finefocus-3634	82	10	as	as	ADP
finefocus-3634	82	11	tube-2	tube-2	NUM
finefocus-3634	82	12	.	.	PUNCT
finefocus-3634	83	1	then	then	ADV
finefocus-3634	83	2	both	both	DET
finefocus-3634	83	3	tubes	tube	NOUN
finefocus-3634	83	4	were	be	AUX
finefocus-3634	83	5	placed	place	VERB
finefocus-3634	83	6	in	in	ADP
finefocus-3634	83	7	an	an	DET
finefocus-3634	83	8	ice	ice	NOUN
finefocus-3634	83	9	bath	bath	NOUN
finefocus-3634	83	10	for	for	ADP
finefocus-3634	83	11	10	10	NUM
finefocus-3634	83	12	minutes	minute	NOUN
finefocus-3634	83	13	,	,	PUNCT
finefocus-3634	83	14	followed	follow	VERB
finefocus-3634	83	15	by	by	ADP
finefocus-3634	83	16	90	90	NUM
finefocus-3634	83	17	seconds	second	NOUN
finefocus-3634	83	18	in	in	ADP
finefocus-3634	83	19	a	a	DET
finefocus-3634	83	20	heating	heating	NOUN
finefocus-3634	83	21	block	block	NOUN
finefocus-3634	83	22	preset	preset	ADJ
finefocus-3634	83	23	at	at	ADP
finefocus-3634	83	24	42	42	NUM
finefocus-3634	83	25	°	°	NOUN
finefocus-3634	83	26	c	c	NOUN
finefocus-3634	83	27	,	,	PUNCT
finefocus-3634	83	28	and	and	CCONJ
finefocus-3634	83	29	finally	finally	ADV
finefocus-3634	83	30	submerged	submerge	VERB
finefocus-3634	83	31	in	in	ADP
finefocus-3634	83	32	an	an	DET
finefocus-3634	83	33	ice	ice	NOUN
finefocus-3634	83	34	bath	bath	NOUN
finefocus-3634	83	35	for	for	ADP
finefocus-3634	83	36	an	an	DET
finefocus-3634	83	37	additional	additional	ADJ
finefocus-3634	83	38	2	2	NUM
finefocus-3634	83	39	minutes	minute	NOUN
finefocus-3634	83	40	.	.	PUNCT
finefocus-3634	84	1	500	500	NUM
finefocus-3634	84	2	μl	μl	ADP
finefocus-3634	84	3	of	of	ADP
finefocus-3634	84	4	super	super	ADV
finefocus-3634	84	5	optimal	optimal	ADJ
finefocus-3634	84	6	(	(	PUNCT
finefocus-3634	84	7	so	so	ADV
finefocus-3634	84	8	)	)	PUNCT
finefocus-3634	84	9	broth	broth	NOUN
finefocus-3634	84	10	was	be	AUX
finefocus-3634	84	11	added	add	VERB
finefocus-3634	84	12	to	to	ADP
finefocus-3634	84	13	both	both	DET
finefocus-3634	84	14	tubes	tube	NOUN
finefocus-3634	84	15	and	and	CCONJ
finefocus-3634	84	16	vortexed	vortexe	VERB
finefocus-3634	84	17	,	,	PUNCT
finefocus-3634	84	18	and	and	CCONJ
finefocus-3634	84	19	then	then	ADV
finefocus-3634	84	20	the	the	DET
finefocus-3634	84	21	tubes	tube	NOUN
finefocus-3634	84	22	were	be	AUX
finefocus-3634	84	23	placed	place	VERB
finefocus-3634	84	24	in	in	ADP
finefocus-3634	84	25	a	a	DET
finefocus-3634	84	26	heating	heating	NOUN
finefocus-3634	84	27	block	block	NOUN
finefocus-3634	84	28	at	at	ADP
finefocus-3634	84	29	37	37	NUM
finefocus-3634	84	30	°	°	NOUN
finefocus-3634	84	31	c	c	NOUN
finefocus-3634	84	32	for	for	ADP
finefocus-3634	84	33	30	30	NUM
finefocus-3634	84	34	minutes	minute	NOUN
finefocus-3634	84	35	.	.	PUNCT
finefocus-3634	85	1	the	the	DET
finefocus-3634	85	2	contents	content	NOUN
finefocus-3634	85	3	of	of	ADP
finefocus-3634	85	4	tube-1	tube-1	NUM
finefocus-3634	85	5	and	and	CCONJ
finefocus-3634	85	6	tube-2	tube-2	NUM
finefocus-3634	85	7	were	be	AUX
finefocus-3634	85	8	added	add	VERB
finefocus-3634	85	9	to	to	ADP
finefocus-3634	85	10	two	two	NUM
finefocus-3634	85	11	separate	separate	ADJ
finefocus-3634	85	12	flasks	flask	NOUN
finefocus-3634	85	13	,	,	PUNCT
finefocus-3634	85	14	each	each	PRON
finefocus-3634	85	15	of	of	ADP
finefocus-3634	85	16	which	which	PRON
finefocus-3634	85	17	contained	contain	VERB
finefocus-3634	85	18	1	1	NUM
finefocus-3634	85	19	l	l	NOUN
finefocus-3634	85	20	of	of	ADP
finefocus-3634	85	21	lysogeny	lysogeny	NOUN
finefocus-3634	85	22	broth	broth	NOUN
finefocus-3634	85	23	medium	medium	NOUN
finefocus-3634	85	24	and	and	CCONJ
finefocus-3634	85	25	200	200	NUM
finefocus-3634	85	26	mg	mg	PROPN
finefocus-3634	85	27	ampicillin	ampicillin	PROPN
finefocus-3634	85	28	,	,	PUNCT
finefocus-3634	85	29	and	and	CCONJ
finefocus-3634	85	30	they	they	PRON
finefocus-3634	85	31	were	be	AUX
finefocus-3634	85	32	cultured	cultured	ADJ
finefocus-3634	85	33	in	in	ADP
finefocus-3634	85	34	a	a	DET
finefocus-3634	85	35	shaker	shaker	NOUN
finefocus-3634	85	36	at	at	ADP
finefocus-3634	85	37	37	37	NUM
finefocus-3634	85	38	℃	℃	PROPN
finefocus-3634	85	39	until	until	SCONJ
finefocus-3634	85	40	an	an	DET
finefocus-3634	85	41	optical	optical	ADJ
finefocus-3634	85	42	density	density	NOUN
finefocus-3634	85	43	of	of	ADP
finefocus-3634	85	44	0.6	0.6	NUM
finefocus-3634	85	45	at	at	ADP
finefocus-3634	85	46	600	600	NUM
finefocus-3634	85	47	nm	nm	NOUN
finefocus-3634	85	48	was	be	AUX
finefocus-3634	85	49	reached	reach	VERB
finefocus-3634	85	50	.	.	PUNCT
finefocus-3634	86	1	to	to	PART
finefocus-3634	86	2	confirm	confirm	VERB
finefocus-3634	86	3	transformation	transformation	NOUN
finefocus-3634	86	4	,	,	PUNCT
finefocus-3634	86	5	the	the	DET
finefocus-3634	86	6	cells	cell	NOUN
finefocus-3634	86	7	from	from	ADP
finefocus-3634	86	8	flask-1	flask-1	NUM
finefocus-3634	86	9	were	be	AUX
finefocus-3634	86	10	checked	check	VERB
finefocus-3634	86	11	against	against	ADP
finefocus-3634	86	12	the	the	DET
finefocus-3634	86	13	cells	cell	NOUN
finefocus-3634	86	14	from	from	ADP
finefocus-3634	86	15	flask	flask	NOUN
finefocus-3634	86	16	2	2	NUM
finefocus-3634	86	17	.	.	PUNCT
finefocus-3634	87	1	flask-1	flask-1	NUM
finefocus-3634	87	2	was	be	AUX
finefocus-3634	87	3	cloudy	cloudy	ADJ
finefocus-3634	87	4	due	due	ADP
finefocus-3634	87	5	to	to	ADP
finefocus-3634	87	6	the	the	DET
finefocus-3634	87	7	addition	addition	NOUN
finefocus-3634	87	8	of	of	ADP
finefocus-3634	87	9	the	the	DET
finefocus-3634	87	10	plasmids	plasmid	NOUN
finefocus-3634	87	11	,	,	PUNCT
finefocus-3634	87	12	whereas	whereas	SCONJ
finefocus-3634	87	13	flask	flask	NOUN
finefocus-3634	87	14	2	2	NUM
finefocus-3634	87	15	was	be	AUX
finefocus-3634	87	16	the	the	DET
finefocus-3634	87	17	negative	negative	ADJ
finefocus-3634	87	18	control	control	NOUN
finefocus-3634	87	19	and	and	CCONJ
finefocus-3634	87	20	remained	remain	VERB
finefocus-3634	87	21	clear	clear	ADJ
finefocus-3634	87	22	.	.	PUNCT
finefocus-3634	88	1	after	after	ADP
finefocus-3634	88	2	this	this	DET
finefocus-3634	88	3	control	control	NOUN
finefocus-3634	88	4	test	test	NOUN
finefocus-3634	88	5	,	,	PUNCT
finefocus-3634	88	6	the	the	DET
finefocus-3634	88	7	content	content	NOUN
finefocus-3634	88	8	of	of	ADP
finefocus-3634	88	9	flask	flask	NOUN
finefocus-3634	88	10	2	2	NUM
finefocus-3634	88	11	was	be	AUX
finefocus-3634	88	12	discarded	discard	VERB
finefocus-3634	88	13	.	.	PUNCT
finefocus-3634	89	1	0.1	0.1	NUM
finefocus-3634	89	2	mm	mm	NOUN
finefocus-3634	89	3	iptg	iptg	PROPN
finefocus-3634	89	4	was	be	AUX
finefocus-3634	89	5	added	add	VERB
finefocus-3634	89	6	to	to	ADP
finefocus-3634	89	7	flask-1	flask-1	NUM
finefocus-3634	89	8	at	at	ADP
finefocus-3634	89	9	this	this	DET
finefocus-3634	89	10	stage	stage	NOUN
finefocus-3634	89	11	,	,	PUNCT
finefocus-3634	89	12	and	and	CCONJ
finefocus-3634	89	13	the	the	DET
finefocus-3634	89	14	cells	cell	NOUN
finefocus-3634	89	15	of	of	ADP
finefocus-3634	89	16	flask-1	flask-1	NUM
finefocus-3634	89	17	were	be	AUX
finefocus-3634	89	18	further	far	ADV
finefocus-3634	89	19	incubated	incubate	VERB
finefocus-3634	89	20	for	for	ADP
finefocus-3634	89	21	24	24	NUM
finefocus-3634	89	22	h	h	NOUN
finefocus-3634	89	23	at	at	ADP
finefocus-3634	89	24	37	37	NUM
finefocus-3634	89	25	℃	℃	PROPN
finefocus-3634	89	26	in	in	ADP
finefocus-3634	89	27	the	the	DET
finefocus-3634	89	28	shaker	shaker	NOUN
finefocus-3634	89	29	at	at	ADP
finefocus-3634	89	30	rpm	rpm	NOUN
finefocus-3634	89	31	of	of	ADP
finefocus-3634	89	32	250.(yoshida	250.(yoshida	NUM
finefocus-3634	89	33	et	et	NOUN
finefocus-3634	89	34	al	al	PROPN
finefocus-3634	89	35	.	.	PROPN
finefocus-3634	89	36	,	,	PUNCT
finefocus-3634	89	37	2016	2016	NUM
finefocus-3634	89	38	)	)	PUNCT
finefocus-3634	89	39	the	the	DET
finefocus-3634	89	40	content	content	NOUN
finefocus-3634	89	41	of	of	ADP
finefocus-3634	89	42	flask-1	flask-1	NUM
finefocus-3634	89	43	was	be	AUX
finefocus-3634	89	44	transferred	transfer	VERB
finefocus-3634	89	45	to	to	ADP
finefocus-3634	89	46	several	several	ADJ
finefocus-3634	89	47	15	15	NUM
finefocus-3634	89	48	ml	ml	NOUN
finefocus-3634	89	49	centrifuge	centrifuge	NOUN
finefocus-3634	89	50	tubes	tube	NOUN
finefocus-3634	89	51	and	and	CCONJ
finefocus-3634	89	52	they	they	PRON
finefocus-3634	89	53	were	be	AUX
finefocus-3634	89	54	centrifuged	centrifuge	VERB
finefocus-3634	89	55	at	at	ADP
finefocus-3634	89	56	4000	4000	NUM
finefocus-3634	89	57	rpm	rpm	NOUN
finefocus-3634	89	58	for	for	ADP
finefocus-3634	89	59	20	20	NUM
finefocus-3634	89	60	minutes	minute	NOUN
finefocus-3634	89	61	on	on	ADP
finefocus-3634	89	62	an	an	DET
finefocus-3634	89	63	allegra	allegra	ADJ
finefocus-3634	89	64	centrifuge	centrifuge	NOUN
finefocus-3634	89	65	instrument	instrument	NOUN
finefocus-3634	89	66	.	.	PUNCT
finefocus-3634	90	1	supernatant	supernatant	NOUN
finefocus-3634	90	2	from	from	ADP
finefocus-3634	90	3	all	all	PRON
finefocus-3634	90	4	of	of	ADP
finefocus-3634	90	5	the	the	DET
finefocus-3634	90	6	centrifuged	centrifuged	ADJ
finefocus-3634	90	7	tubes	tube	NOUN
finefocus-3634	90	8	was	be	AUX
finefocus-3634	90	9	stored	store	VERB
finefocus-3634	90	10	in	in	ADP
finefocus-3634	90	11	a	a	DET
finefocus-3634	90	12	glass	glass	NOUN
finefocus-3634	90	13	bottle	bottle	NOUN
finefocus-3634	90	14	.	.	PUNCT
finefocus-3634	91	1	the	the	DET
finefocus-3634	91	2	cell	cell	NOUN
finefocus-3634	91	3	pellets	pellet	VERB
finefocus-3634	91	4	from	from	ADP
finefocus-3634	91	5	all	all	DET
finefocus-3634	91	6	centrifuged	centrifuged	ADJ
finefocus-3634	91	7	tubes	tube	NOUN
finefocus-3634	91	8	were	be	AUX
finefocus-3634	91	9	collected	collect	VERB
finefocus-3634	91	10	and	and	CCONJ
finefocus-3634	91	11	resuspended	resuspend	VERB
finefocus-3634	91	12	in	in	ADP
finefocus-3634	91	13	50	50	NUM
finefocus-3634	91	14	ml	ml	NOUN
finefocus-3634	91	15	of	of	ADP
finefocus-3634	91	16	40	40	NUM
finefocus-3634	91	17	mm	mm	NOUN
finefocus-3634	91	18	ph	ph	ADJ
finefocus-3634	91	19	7.4	7.4	NUM
finefocus-3634	91	20	tris	tris	ADJ
finefocus-3634	91	21	-	-	PUNCT
finefocus-3634	91	22	hcl	hcl	NOUN
finefocus-3634	91	23	buffer	buffer	NOUN
finefocus-3634	91	24	containing	contain	VERB
finefocus-3634	91	25	0.5	0.5	NUM
finefocus-3634	91	26	m	m	NOUN
finefocus-3634	91	27	nacl	nacl	NOUN
finefocus-3634	91	28	(	(	PUNCT
finefocus-3634	91	29	buffer	buffer	NOUN
finefocus-3634	91	30	1	1	NUM
finefocus-3634	91	31	)	)	PUNCT
finefocus-3634	91	32	.	.	PUNCT
finefocus-3634	92	1	the	the	DET
finefocus-3634	92	2	resuspended	resuspend	VERB
finefocus-3634	92	3	cells	cell	NOUN
finefocus-3634	92	4	were	be	AUX
finefocus-3634	92	5	vortexed	vortexe	VERB
finefocus-3634	92	6	and	and	CCONJ
finefocus-3634	92	7	divided	divide	VERB
finefocus-3634	92	8	equally	equally	ADV
finefocus-3634	92	9	into	into	ADP
finefocus-3634	92	10	two	two	NUM
finefocus-3634	92	11	centrifuge	centrifuge	NOUN
finefocus-3634	92	12	tubes	tube	NOUN
finefocus-3634	92	13	of	of	ADP
finefocus-3634	92	14	size	size	NOUN
finefocus-3634	92	15	30	30	NUM
finefocus-3634	92	16	ml	ml	NOUN
finefocus-3634	92	17	.	.	PUNCT
finefocus-3634	93	1	to	to	ADP
finefocus-3634	93	2	one	one	NUM
finefocus-3634	93	3	of	of	ADP
finefocus-3634	93	4	the	the	DET
finefocus-3634	93	5	tubes	tube	NOUN
finefocus-3634	93	6	,	,	PUNCT
finefocus-3634	93	7	0.1	0.1	NUM
finefocus-3634	93	8	m	m	NOUN
finefocus-3634	93	9	pmsf	pmsf	NOUN
finefocus-3634	93	10	was	be	AUX
finefocus-3634	93	11	added	add	VERB
finefocus-3634	93	12	to	to	PART
finefocus-3634	93	13	test	test	VERB
finefocus-3634	93	14	the	the	DET
finefocus-3634	93	15	effect	effect	NOUN
finefocus-3634	93	16	of	of	ADP
finefocus-3634	93	17	this	this	DET
finefocus-3634	93	18	protease	protease	NOUN
finefocus-3634	93	19	inhibitor	inhibitor	NOUN
finefocus-3634	93	20	on	on	ADP
finefocus-3634	93	21	enzyme	enzyme	NOUN
finefocus-3634	93	22	activity	activity	NOUN
finefocus-3634	93	23	.	.	PUNCT
finefocus-3634	94	1	it	it	PRON
finefocus-3634	94	2	is	be	AUX
finefocus-3634	94	3	used	use	VERB
finefocus-3634	94	4	for	for	ADP
finefocus-3634	94	5	protein	protein	NOUN
finefocus-3634	94	6	purification	purification	NOUN
finefocus-3634	94	7	during	during	ADP
finefocus-3634	94	8	cell	cell	NOUN
finefocus-3634	94	9	lysis	lysis	NOUN
finefocus-3634	94	10	to	to	PART
finefocus-3634	94	11	prevent	prevent	VERB
finefocus-3634	94	12	the	the	DET
finefocus-3634	94	13	proteases	protease	NOUN
finefocus-3634	94	14	from	from	ADP
finefocus-3634	94	15	degrading	degrade	VERB
finefocus-3634	94	16	the	the	DET
finefocus-3634	94	17	protein	protein	NOUN
finefocus-3634	94	18	.	.	PUNCT
finefocus-3634	95	1	lysis	lysis	VERB
finefocus-3634	95	2	the	the	DET
finefocus-3634	95	3	cells	cell	NOUN
finefocus-3634	95	4	from	from	ADP
finefocus-3634	95	5	both	both	DET
finefocus-3634	95	6	30	30	NUM
finefocus-3634	95	7	ml	ml	NOUN
finefocus-3634	95	8	size	size	NOUN
finefocus-3634	95	9	tubes	tube	NOUN
finefocus-3634	95	10	were	be	AUX
finefocus-3634	95	11	separately	separately	ADV
finefocus-3634	95	12	added	add	VERB
finefocus-3634	95	13	to	to	ADP
finefocus-3634	95	14	a	a	DET
finefocus-3634	95	15	mortar	mortar	NOUN
finefocus-3634	95	16	and	and	CCONJ
finefocus-3634	95	17	pestle	pestle	NOUN
finefocus-3634	95	18	containing	contain	VERB
finefocus-3634	95	19	liquid	liquid	ADJ
finefocus-3634	95	20	nitrogen	nitrogen	NOUN
finefocus-3634	95	21	in	in	ADP
finefocus-3634	95	22	it	it	PRON
finefocus-3634	95	23	to	to	PART
finefocus-3634	95	24	allow	allow	VERB
finefocus-3634	95	25	the	the	DET
finefocus-3634	95	26	content	content	NOUN
finefocus-3634	95	27	of	of	ADP
finefocus-3634	95	28	each	each	DET
finefocus-3634	95	29	tube	tube	NOUN
finefocus-3634	95	30	to	to	PART
finefocus-3634	95	31	solidify	solidify	VERB
finefocus-3634	95	32	and	and	CCONJ
finefocus-3634	95	33	ground	ground	VERB
finefocus-3634	95	34	until	until	SCONJ
finefocus-3634	95	35	fine	fine	ADJ
finefocus-3634	95	36	powders	powder	NOUN
finefocus-3634	95	37	were	be	AUX
finefocus-3634	95	38	formed	form	VERB
finefocus-3634	95	39	,	,	PUNCT
finefocus-3634	95	40	which	which	PRON
finefocus-3634	95	41	were	be	AUX
finefocus-3634	95	42	then	then	ADV
finefocus-3634	95	43	stored	store	VERB
finefocus-3634	95	44	at	at	ADP
finefocus-3634	95	45	-20	-20	PROPN
finefocus-3634	95	46	℃	℃	PROPN
finefocus-3634	95	47	.	.	NOUN
finefocus-3634	95	48	5	5	NUM
finefocus-3634	95	49	grams	gram	NOUN
finefocus-3634	95	50	of	of	ADP
finefocus-3634	95	51	these	these	DET
finefocus-3634	95	52	lysed	lyse	VERB
finefocus-3634	95	53	cells	cell	NOUN
finefocus-3634	95	54	were	be	AUX
finefocus-3634	95	55	resuspended	resuspend	VERB
finefocus-3634	95	56	in	in	ADP
finefocus-3634	95	57	20	20	NUM
finefocus-3634	95	58	ml	ml	NOUN
finefocus-3634	95	59	of	of	ADP
finefocus-3634	95	60	20	20	NUM
finefocus-3634	95	61	mm	mm	NOUN
finefocus-3634	95	62	phosphate	phosphate	NOUN
finefocus-3634	95	63	buffer	buffer	NOUN
finefocus-3634	95	64	at	at	ADP
finefocus-3634	95	65	ph	ph	PROPN
finefocus-3634	95	66	7.4	7.4	NUM
finefocus-3634	95	67	(	(	PUNCT
finefocus-3634	95	68	buffer	buffer	NOUN
finefocus-3634	95	69	2	2	NUM
finefocus-3634	95	70	)	)	PUNCT
finefocus-3634	95	71	containing	contain	VERB
finefocus-3634	95	72	20	20	NUM
finefocus-3634	95	73	mm	mm	NUM
finefocus-3634	95	74	imidazole	imidazole	NOUN
finefocus-3634	95	75	.	.	PUNCT
finefocus-3634	96	1	they	they	PRON
finefocus-3634	96	2	were	be	AUX
finefocus-3634	96	3	centrifuged	centrifuge	VERB
finefocus-3634	96	4	at	at	ADP
finefocus-3634	96	5	4300	4300	NUM
finefocus-3634	96	6	rpm	rpm	NOUN
finefocus-3634	96	7	for	for	ADP
finefocus-3634	96	8	30	30	NUM
finefocus-3634	96	9	minutes	minute	NOUN
finefocus-3634	96	10	.	.	PUNCT
finefocus-3634	97	1	the	the	DET
finefocus-3634	97	2	pellet	pellet	NOUN
finefocus-3634	97	3	was	be	AUX
finefocus-3634	97	4	discarded	discard	VERB
finefocus-3634	97	5	and	and	CCONJ
finefocus-3634	97	6	the	the	DET
finefocus-3634	97	7	supernatant	supernatant	NOUN
finefocus-3634	97	8	,	,	PUNCT
finefocus-3634	97	9	which	which	PRON
finefocus-3634	97	10	contained	contain	VERB
finefocus-3634	97	11	protein	protein	NOUN
finefocus-3634	97	12	expressed	express	VERB
finefocus-3634	97	13	from	from	ADP
finefocus-3634	97	14	the	the	DET
finefocus-3634	97	15	transformed	transform	VERB
finefocus-3634	97	16	cells	cell	NOUN
finefocus-3634	97	17	,	,	PUNCT
finefocus-3634	97	18	was	be	AUX
finefocus-3634	97	19	syringe	syringe	NOUN
finefocus-3634	97	20	-	-	PUNCT
finefocus-3634	97	21	filtered	filter	VERB
finefocus-3634	97	22	through	through	ADP
finefocus-3634	97	23	a	a	DET
finefocus-3634	97	24	0.45	0.45	NUM
finefocus-3634	97	25	micrometer	micrometer	NOUN
finefocus-3634	97	26	syringe	syringe	NOUN
finefocus-3634	97	27	.	.	PUNCT
finefocus-3634	98	1	protein	protein	NOUN
finefocus-3634	98	2	purification	purification	NOUN
finefocus-3634	98	3	a	a	DET
finefocus-3634	98	4	histidine	histidine	NOUN
finefocus-3634	98	5	column	column	NOUN
finefocus-3634	98	6	(	(	PUNCT
finefocus-3634	98	7	1	1	NUM
finefocus-3634	98	8	-	-	PUNCT
finefocus-3634	98	9	ml	ml	NOUN
finefocus-3634	98	10	hitrap	hitrap	NOUN
finefocus-3634	98	11	syringe	syringe	NOUN
finefocus-3634	98	12	)	)	PUNCT
finefocus-3634	98	13	was	be	AUX
finefocus-3634	98	14	used	use	VERB
finefocus-3634	98	15	to	to	PART
finefocus-3634	98	16	purify	purify	VERB
finefocus-3634	98	17	the	the	DET
finefocus-3634	98	18	protein	protein	NOUN
finefocus-3634	98	19	in	in	ADP
finefocus-3634	98	20	the	the	DET
finefocus-3634	98	21	supernatant	supernatant	NOUN
finefocus-3634	98	22	.	.	PUNCT
finefocus-3634	99	1	the	the	DET
finefocus-3634	99	2	elution	elution	NOUN
finefocus-3634	99	3	buffer	buffer	NOUN
finefocus-3634	99	4	consisted	consist	VERB
finefocus-3634	99	5	of	of	ADP
finefocus-3634	99	6	500	500	NUM
finefocus-3634	99	7	mm	mm	NOUN
finefocus-3634	99	8	imidazole	imidazole	NOUN
finefocus-3634	99	9	in	in	ADP
finefocus-3634	99	10	buffer	buffer	NOUN
finefocus-3634	99	11	1	1	NUM
finefocus-3634	99	12	,	,	PUNCT
finefocus-3634	99	13	and	and	CCONJ
finefocus-3634	99	14	the	the	DET
finefocus-3634	99	15	binding	bind	VERB
finefocus-3634	99	16	buffer	buffer	NOUN
finefocus-3634	99	17	consisted	consist	VERB
finefocus-3634	99	18	of	of	ADP
finefocus-3634	99	19	20	20	NUM
finefocus-3634	99	20	mm	mm	NOUN
finefocus-3634	99	21	imidazole	imidazole	NOUN
finefocus-3634	99	22	in	in	ADP
finefocus-3634	99	23	buffer	buffer	NOUN
finefocus-3634	99	24	1	1	NUM
finefocus-3634	99	25	.	.	PUNCT
finefocus-3634	100	1	the	the	DET
finefocus-3634	100	2	hi	hi	ADJ
finefocus-3634	100	3	-	-	PUNCT
finefocus-3634	100	4	trap	trap	NOUN
finefocus-3634	100	5	column	column	NOUN
finefocus-3634	100	6	was	be	AUX
finefocus-3634	100	7	first	first	ADV
finefocus-3634	100	8	prepared	prepare	VERB
finefocus-3634	100	9	by	by	ADP
finefocus-3634	100	10	eluting	elute	VERB
finefocus-3634	100	11	the	the	DET
finefocus-3634	100	12	binding	bind	VERB
finefocus-3634	100	13	buffer	buffer	NOUN
finefocus-3634	100	14	twice	twice	ADV
finefocus-3634	100	15	through	through	ADP
finefocus-3634	100	16	the	the	DET
finefocus-3634	100	17	column	column	NOUN
finefocus-3634	100	18	at	at	ADP
finefocus-3634	100	19	a	a	DET
finefocus-3634	100	20	rate	rate	NOUN
finefocus-3634	100	21	of	of	ADP
finefocus-3634	100	22	approximately	approximately	ADV
finefocus-3634	100	23	1	1	NUM
finefocus-3634	100	24	ml	ml	NOUN
finefocus-3634	100	25	/	/	SYM
finefocus-3634	100	26	min	min	NOUN
finefocus-3634	100	27	.	.	PROPN
finefocus-3634	100	28	vol	vol	NOUN
finefocus-3634	100	29	8	8	NUM
finefocus-3634	101	1	i	i	PRON
finefocus-3634	101	2	93	93	NUM
finefocus-3634	101	3	the	the	DET
finefocus-3634	101	4	supernatant	supernatant	NOUN
finefocus-3634	101	5	containing	contain	VERB
finefocus-3634	101	6	the	the	DET
finefocus-3634	101	7	expressed	express	VERB
finefocus-3634	101	8	protein	protein	NOUN
finefocus-3634	101	9	was	be	AUX
finefocus-3634	101	10	then	then	ADV
finefocus-3634	101	11	eluted	elute	VERB
finefocus-3634	101	12	through	through	ADP
finefocus-3634	101	13	the	the	DET
finefocus-3634	101	14	column	column	NOUN
finefocus-3634	101	15	.	.	PUNCT
finefocus-3634	102	1	the	the	DET
finefocus-3634	102	2	elution	elution	NOUN
finefocus-3634	102	3	buffer	buffer	NOUN
finefocus-3634	102	4	was	be	AUX
finefocus-3634	102	5	run	run	VERB
finefocus-3634	102	6	through	through	ADP
finefocus-3634	102	7	the	the	DET
finefocus-3634	102	8	column	column	NOUN
finefocus-3634	102	9	in	in	ADP
finefocus-3634	102	10	batches	batch	NOUN
finefocus-3634	102	11	of	of	ADP
finefocus-3634	102	12	4	4	NUM
finefocus-3634	102	13	ml	ml	NOUN
finefocus-3634	102	14	each	each	DET
finefocus-3634	102	15	time	time	NOUN
finefocus-3634	102	16	to	to	PART
finefocus-3634	102	17	elute	elute	VERB
finefocus-3634	102	18	the	the	DET
finefocus-3634	102	19	expressed	express	VERB
finefocus-3634	102	20	protein	protein	NOUN
finefocus-3634	102	21	which	which	PRON
finefocus-3634	102	22	was	be	AUX
finefocus-3634	102	23	collected	collect	VERB
finefocus-3634	102	24	separately	separately	ADV
finefocus-3634	102	25	in	in	ADP
finefocus-3634	102	26	15	15	NUM
finefocus-3634	102	27	ml	ml	NOUN
finefocus-3634	102	28	centrifuge	centrifuge	NOUN
finefocus-3634	102	29	tubes	tube	NOUN
finefocus-3634	102	30	.	.	PUNCT
finefocus-3634	103	1	a	a	DET
finefocus-3634	103	2	total	total	NOUN
finefocus-3634	103	3	of	of	ADP
finefocus-3634	103	4	5	5	NUM
finefocus-3634	103	5	samples	sample	NOUN
finefocus-3634	103	6	of	of	ADP
finefocus-3634	103	7	each	each	PRON
finefocus-3634	103	8	containing	contain	VERB
finefocus-3634	103	9	4	4	NUM
finefocus-3634	103	10	ml	ml	NOUN
finefocus-3634	103	11	eluant	eluant	ADJ
finefocus-3634	103	12	was	be	AUX
finefocus-3634	103	13	collected	collect	VERB
finefocus-3634	103	14	.	.	PUNCT
finefocus-3634	104	1	these	these	DET
finefocus-3634	104	2	5	5	NUM
finefocus-3634	104	3	aliquots	aliquot	NOUN
finefocus-3634	104	4	or	or	CCONJ
finefocus-3634	104	5	samples	sample	NOUN
finefocus-3634	104	6	were	be	AUX
finefocus-3634	104	7	used	use	VERB
finefocus-3634	104	8	for	for	ADP
finefocus-3634	104	9	studying	study	VERB
finefocus-3634	104	10	degradation	degradation	NOUN
finefocus-3634	104	11	experiments	experiment	NOUN
finefocus-3634	104	12	of	of	ADP
finefocus-3634	104	13	pet	pet	ADJ
finefocus-3634	104	14	model	model	NOUN
finefocus-3634	104	15	compound	compound	NOUN
finefocus-3634	104	16	written	write	VERB
finefocus-3634	104	17	below	below	ADV
finefocus-3634	104	18	.	.	PUNCT
finefocus-3634	105	1	plasmid	plasmid	NOUN
finefocus-3634	105	2	containing	contain	VERB
finefocus-3634	105	3	petase	petase	ADJ
finefocus-3634	105	4	enzyme	enzyme	NOUN
finefocus-3634	105	5	with	with	ADP
finefocus-3634	105	6	disulfide	disulfide	NOUN
finefocus-3634	105	7	bond	bond	NOUN
finefocus-3634	105	8	(	(	PUNCT
finefocus-3634	105	9	a2	a2	PROPN
finefocus-3634	105	10	)	)	PUNCT
finefocus-3634	105	11	was	be	AUX
finefocus-3634	105	12	similarly	similarly	ADV
finefocus-3634	105	13	processed	process	VERB
finefocus-3634	105	14	to	to	PART
finefocus-3634	105	15	obtain	obtain	VERB
finefocus-3634	105	16	expressed	express	VERB
finefocus-3634	105	17	protein	protein	NOUN
finefocus-3634	105	18	for	for	ADP
finefocus-3634	105	19	degradation	degradation	NOUN
finefocus-3634	105	20	study	study	NOUN
finefocus-3634	105	21	written	write	VERB
finefocus-3634	105	22	below	below	ADV
finefocus-3634	105	23	.	.	PUNCT
finefocus-3634	106	1	a	a	DET
finefocus-3634	106	2	bichionic	bichionic	ADJ
finefocus-3634	106	3	(	(	PUNCT
finefocus-3634	106	4	bca	bca	PROPN
finefocus-3634	106	5	)	)	PUNCT
finefocus-3634	106	6	assay	assay	NOUN
finefocus-3634	106	7	of	of	ADP
finefocus-3634	106	8	each	each	DET
finefocus-3634	106	9	aliquot	aliquot	NOUN
finefocus-3634	106	10	was	be	AUX
finefocus-3634	106	11	done	do	VERB
finefocus-3634	106	12	to	to	PART
finefocus-3634	106	13	measure	measure	VERB
finefocus-3634	106	14	total	total	ADJ
finefocus-3634	106	15	protein	protein	NOUN
finefocus-3634	106	16	concentration	concentration	NOUN
finefocus-3634	106	17	.	.	PUNCT
finefocus-3634	107	1	for	for	ADP
finefocus-3634	107	2	this	this	DET
finefocus-3634	107	3	assay	assay	NOUN
finefocus-3634	107	4	,	,	PUNCT
finefocus-3634	107	5	each	each	DET
finefocus-3634	107	6	sample	sample	NOUN
finefocus-3634	107	7	was	be	AUX
finefocus-3634	107	8	mixed	mix	VERB
finefocus-3634	107	9	with	with	ADP
finefocus-3634	107	10	bichionic	bichionic	ADJ
finefocus-3634	107	11	acid	acid	NOUN
finefocus-3634	107	12	obtained	obtain	VERB
finefocus-3634	107	13	from	from	ADP
finefocus-3634	107	14	sigma	sigma	NOUN
finefocus-3634	107	15	and	and	CCONJ
finefocus-3634	107	16	the	the	DET
finefocus-3634	107	17	mixture	mixture	NOUN
finefocus-3634	107	18	was	be	AUX
finefocus-3634	107	19	kept	keep	VERB
finefocus-3634	107	20	on	on	ADP
finefocus-3634	107	21	a	a	DET
finefocus-3634	107	22	microplate	microplate	NOUN
finefocus-3634	107	23	for	for	ADP
finefocus-3634	107	24	30	30	NUM
finefocus-3634	107	25	minute	minute	NOUN
finefocus-3634	107	26	at	at	ADP
finefocus-3634	107	27	37	37	NUM
finefocus-3634	107	28	°	°	NOUN
finefocus-3634	107	29	c	c	NOUN
finefocus-3634	107	30	before	before	ADP
finefocus-3634	107	31	measuring	measure	VERB
finefocus-3634	107	32	its	its	PRON
finefocus-3634	107	33	color	color	NOUN
finefocus-3634	107	34	change	change	NOUN
finefocus-3634	107	35	at	at	ADP
finefocus-3634	107	36	526	526	NUM
finefocus-3634	107	37	nm	nm	NOUN
finefocus-3634	107	38	using	use	VERB
finefocus-3634	107	39	a	a	DET
finefocus-3634	107	40	tecan	tecan	PROPN
finefocus-3634	107	41	microplate	microplate	NOUN
finefocus-3634	107	42	reader	reader	PROPN
finefocus-3634	107	43	.	.	PUNCT
finefocus-3634	108	1	bhet	bhet	ADJ
finefocus-3634	108	2	degradation	degradation	NOUN
finefocus-3634	108	3	1	1	NUM
finefocus-3634	108	4	m	m	NOUN
finefocus-3634	108	5	of	of	ADP
finefocus-3634	108	6	bis(2	bis(2	NOUN
finefocus-3634	108	7	-	-	PUNCT
finefocus-3634	108	8	hydroxyethyl	hydroxyethyl	NOUN
finefocus-3634	108	9	)	)	PUNCT
finefocus-3634	108	10	terephthalate	terephthalate	NOUN
finefocus-3634	108	11	(	(	PUNCT
finefocus-3634	108	12	bhet	bhet	NOUN
finefocus-3634	108	13	)	)	PUNCT
finefocus-3634	108	14	was	be	AUX
finefocus-3634	108	15	added	add	VERB
finefocus-3634	108	16	to	to	ADP
finefocus-3634	108	17	each	each	DET
finefocus-3634	108	18	eluted	eluted	ADJ
finefocus-3634	108	19	protein	protein	NOUN
finefocus-3634	108	20	samples	sample	NOUN
finefocus-3634	108	21	and	and	CCONJ
finefocus-3634	108	22	the	the	DET
finefocus-3634	108	23	mixtures	mixture	NOUN
finefocus-3634	108	24	were	be	AUX
finefocus-3634	108	25	allowed	allow	VERB
finefocus-3634	108	26	to	to	PART
finefocus-3634	108	27	continuously	continuously	ADV
finefocus-3634	108	28	shake	shake	VERB
finefocus-3634	108	29	at	at	ADP
finefocus-3634	108	30	250	250	NUM
finefocus-3634	108	31	rpm	rpm	NOUN
finefocus-3634	108	32	and	and	CCONJ
finefocus-3634	108	33	37	37	NUM
finefocus-3634	108	34	°	°	NOUN
finefocus-3634	108	35	c	c	NOUN
finefocus-3634	108	36	for	for	ADP
finefocus-3634	108	37	72	72	NUM
finefocus-3634	108	38	hours	hour	NOUN
finefocus-3634	108	39	.	.	PUNCT
finefocus-3634	109	1	after	after	ADP
finefocus-3634	109	2	72	72	NUM
finefocus-3634	109	3	hours	hour	NOUN
finefocus-3634	109	4	of	of	ADP
finefocus-3634	109	5	reaction	reaction	NOUN
finefocus-3634	109	6	,	,	PUNCT
finefocus-3634	109	7	the	the	DET
finefocus-3634	109	8	tubes	tube	NOUN
finefocus-3634	109	9	were	be	AUX
finefocus-3634	109	10	centrifuged	centrifuge	VERB
finefocus-3634	109	11	,	,	PUNCT
finefocus-3634	109	12	and	and	CCONJ
finefocus-3634	109	13	1	1	NUM
finefocus-3634	109	14	ml	ml	NOUN
finefocus-3634	109	15	supernatant	supernatant	NOUN
finefocus-3634	109	16	from	from	ADP
finefocus-3634	109	17	each	each	DET
finefocus-3634	109	18	tube	tube	NOUN
finefocus-3634	109	19	was	be	AUX
finefocus-3634	109	20	collected	collect	VERB
finefocus-3634	109	21	for	for	ADP
finefocus-3634	109	22	analysis	analysis	NOUN
finefocus-3634	109	23	by	by	ADP
finefocus-3634	109	24	a	a	DET
finefocus-3634	109	25	refractometer	refractometer	NOUN
finefocus-3634	109	26	and	and	CCONJ
finefocus-3634	109	27	a	a	DET
finefocus-3634	109	28	uplc	uplc	ADJ
finefocus-3634	109	29	instrument	instrument	NOUN
finefocus-3634	109	30	.	.	PUNCT
finefocus-3634	110	1	the	the	DET
finefocus-3634	110	2	reaction	reaction	NOUN
finefocus-3634	110	3	was	be	AUX
finefocus-3634	110	4	terminated	terminate	VERB
finefocus-3634	110	5	by	by	ADP
finefocus-3634	110	6	heating	heat	VERB
finefocus-3634	110	7	the	the	DET
finefocus-3634	110	8	solution	solution	NOUN
finefocus-3634	110	9	in	in	ADP
finefocus-3634	110	10	tubes	tube	NOUN
finefocus-3634	110	11	at	at	ADP
finefocus-3634	110	12	85	85	NUM
finefocus-3634	110	13	°	°	ADP
finefocus-3634	110	14	c	c	NOUN
finefocus-3634	110	15	for	for	ADP
finefocus-3634	110	16	15	15	NUM
finefocus-3634	110	17	minutes	minute	NOUN
finefocus-3634	110	18	.(austin	.(austin	PUNCT
finefocus-3634	110	19	et	et	PROPN
finefocus-3634	110	20	al	al	PROPN
finefocus-3634	110	21	.	.	PROPN
finefocus-3634	110	22	,	,	PUNCT
finefocus-3634	110	23	2018	2018	NUM
finefocus-3634	110	24	)	)	PUNCT
finefocus-3634	110	25	a	a	DET
finefocus-3634	110	26	total	total	NOUN
finefocus-3634	110	27	of	of	ADP
finefocus-3634	110	28	5	5	NUM
finefocus-3634	110	29	a1	a1	NOUN
finefocus-3634	110	30	samples	sample	NOUN
finefocus-3634	110	31	,	,	PUNCT
finefocus-3634	110	32	5	5	NUM
finefocus-3634	110	33	a2	a2	NOUN
finefocus-3634	110	34	samples	sample	NOUN
finefocus-3634	110	35	and	and	CCONJ
finefocus-3634	110	36	2	2	NUM
finefocus-3634	110	37	buffer	buffer	NOUN
finefocus-3634	110	38	solutions	solution	NOUN
finefocus-3634	110	39	(	(	PUNCT
finefocus-3634	110	40	control	control	NOUN
finefocus-3634	110	41	)	)	PUNCT
finefocus-3634	110	42	were	be	AUX
finefocus-3634	110	43	tested	test	VERB
finefocus-3634	110	44	for	for	ADP
finefocus-3634	110	45	bhet	bhet	ADJ
finefocus-3634	110	46	degradation	degradation	NOUN
finefocus-3634	110	47	.	.	PUNCT
finefocus-3634	111	1	product	product	NOUN
finefocus-3634	111	2	analysis	analysis	NOUN
finefocus-3634	111	3	.	.	PUNCT
finefocus-3634	112	1	analysis	analysis	NOUN
finefocus-3634	112	2	of	of	ADP
finefocus-3634	112	3	eg	eg	NOUN
finefocus-3634	112	4	production	production	NOUN
finefocus-3634	112	5	in	in	ADP
finefocus-3634	112	6	each	each	DET
finefocus-3634	112	7	sample	sample	NOUN
finefocus-3634	112	8	collected	collect	VERB
finefocus-3634	112	9	at	at	ADP
finefocus-3634	112	10	72	72	NUM
finefocus-3634	112	11	hours	hour	NOUN
finefocus-3634	112	12	was	be	AUX
finefocus-3634	112	13	done	do	VERB
finefocus-3634	112	14	using	use	VERB
finefocus-3634	112	15	a	a	DET
finefocus-3634	112	16	uplc	uplc	ADJ
finefocus-3634	112	17	equipped	equip	VERB
finefocus-3634	112	18	with	with	ADP
finefocus-3634	112	19	a	a	DET
finefocus-3634	112	20	c18	c18	NOUN
finefocus-3634	112	21	column	column	NOUN
finefocus-3634	112	22	.	.	PUNCT
finefocus-3634	113	1	a	a	DET
finefocus-3634	113	2	mixture	mixture	NOUN
finefocus-3634	113	3	of	of	ADP
finefocus-3634	113	4	water	water	NOUN
finefocus-3634	113	5	and	and	CCONJ
finefocus-3634	113	6	acetonitrile	acetonitrile	NOUN
finefocus-3634	113	7	(	(	PUNCT
finefocus-3634	113	8	45/55	45/55	NUM
finefocus-3634	113	9	wt/	wt/	PROPN
finefocus-3634	113	10	wt	wt	VERB
finefocus-3634	113	11	)	)	PUNCT
finefocus-3634	113	12	was	be	AUX
finefocus-3634	113	13	used	use	VERB
finefocus-3634	113	14	as	as	ADP
finefocus-3634	113	15	a	a	DET
finefocus-3634	113	16	mobile	mobile	ADJ
finefocus-3634	113	17	phase	phase	NOUN
finefocus-3634	113	18	at	at	ADP
finefocus-3634	113	19	a	a	DET
finefocus-3634	113	20	flow	flow	NOUN
finefocus-3634	113	21	rate	rate	NOUN
finefocus-3634	113	22	of	of	ADP
finefocus-3634	113	23	50	50	NUM
finefocus-3634	113	24	μl	μl	PROPN
finefocus-3634	113	25	/	/	SYM
finefocus-3634	113	26	min	min	NOUN
finefocus-3634	113	27	.	.	PUNCT
finefocus-3634	114	1	the	the	DET
finefocus-3634	114	2	sample	sample	NOUN
finefocus-3634	114	3	injection	injection	NOUN
finefocus-3634	114	4	volume	volume	NOUN
finefocus-3634	114	5	was	be	AUX
finefocus-3634	114	6	1	1	NUM
finefocus-3634	114	7	μl	μl	NOUN
finefocus-3634	114	8	.	.	PUNCT
finefocus-3634	115	1	the	the	DET
finefocus-3634	115	2	yield	yield	NOUN
finefocus-3634	115	3	of	of	ADP
finefocus-3634	115	4	eg	eg	NOUN
finefocus-3634	115	5	was	be	AUX
finefocus-3634	115	6	calculated	calculate	VERB
finefocus-3634	115	7	from	from	ADP
finefocus-3634	115	8	uplc	uplc	PROPN
finefocus-3634	115	9	peak	peak	PROPN
finefocus-3634	115	10	area	area	NOUN
finefocus-3634	115	11	using	use	VERB
finefocus-3634	115	12	a	a	DET
finefocus-3634	115	13	pre	pre	ADJ
finefocus-3634	115	14	-	-	ADJ
finefocus-3634	115	15	calibrated	calibrate	VERB
finefocus-3634	115	16	plot	plot	NOUN
finefocus-3634	115	17	of	of	ADP
finefocus-3634	115	18	peak	peak	NOUN
finefocus-3634	115	19	area	area	NOUN
finefocus-3634	115	20	versus	versus	ADP
finefocus-3634	115	21	eg	eg	NOUN
finefocus-3634	115	22	concentrations	concentration	NOUN
finefocus-3634	115	23	ranging	range	VERB
finefocus-3634	115	24	between	between	ADP
finefocus-3634	115	25	10	10	NUM
finefocus-3634	115	26	µg	µg	NOUN
finefocus-3634	115	27	/	/	SYM
finefocus-3634	115	28	ml	ml	NOUN
finefocus-3634	115	29	to	to	ADP
finefocus-3634	115	30	1000	1000	NUM
finefocus-3634	115	31	µg	µg	NOUN
finefocus-3634	115	32	/	/	SYM
finefocus-3634	115	33	ml	ml	NOUN
finefocus-3634	115	34	.	.	PUNCT
finefocus-3634	116	1	a	a	DET
finefocus-3634	116	2	refractometer	refractometer	NOUN
finefocus-3634	116	3	was	be	AUX
finefocus-3634	116	4	also	also	ADV
finefocus-3634	116	5	used	use	VERB
finefocus-3634	116	6	to	to	PART
finefocus-3634	116	7	measure	measure	VERB
finefocus-3634	116	8	eg	eg	NOUN
finefocus-3634	116	9	production	production	NOUN
finefocus-3634	116	10	.	.	PUNCT
finefocus-3634	117	1	for	for	ADP
finefocus-3634	117	2	refractometer	refractometer	NOUN
finefocus-3634	117	3	,	,	PUNCT
finefocus-3634	117	4	a	a	DET
finefocus-3634	117	5	standard	standard	ADJ
finefocus-3634	117	6	calibration	calibration	NOUN
finefocus-3634	117	7	plot	plot	NOUN
finefocus-3634	117	8	for	for	ADP
finefocus-3634	117	9	eg	eg	NOUN
finefocus-3634	117	10	solutions	solution	NOUN
finefocus-3634	117	11	of	of	ADP
finefocus-3634	117	12	known	know	VERB
finefocus-3634	117	13	concentrations	concentration	NOUN
finefocus-3634	117	14	was	be	AUX
finefocus-3634	117	15	prepared	prepared	ADJ
finefocus-3634	117	16	to	to	PART
finefocus-3634	117	17	assess	assess	VERB
finefocus-3634	117	18	the	the	DET
finefocus-3634	117	19	accuracy	accuracy	NOUN
finefocus-3634	117	20	in	in	ADP
finefocus-3634	117	21	measurements	measurement	NOUN
finefocus-3634	117	22	of	of	ADP
finefocus-3634	117	23	eg	eg	NOUN
finefocus-3634	117	24	percentage	percentage	NOUN
finefocus-3634	117	25	for	for	ADP
finefocus-3634	117	26	known	know	VERB
finefocus-3634	117	27	solutions	solution	NOUN
finefocus-3634	117	28	.	.	PUNCT
finefocus-3634	118	1	then	then	ADV
finefocus-3634	118	2	,	,	PUNCT
finefocus-3634	118	3	the	the	DET
finefocus-3634	118	4	percentage	percentage	NOUN
finefocus-3634	118	5	of	of	ADP
finefocus-3634	118	6	eg	eg	NOUN
finefocus-3634	118	7	yields	yield	NOUN
finefocus-3634	118	8	in	in	ADP
finefocus-3634	118	9	the	the	DET
finefocus-3634	118	10	bhet	bhet	ADJ
finefocus-3634	118	11	degraded	degrade	VERB
finefocus-3634	118	12	solutions	solution	NOUN
finefocus-3634	118	13	were	be	AUX
finefocus-3634	118	14	measured	measure	VERB
finefocus-3634	118	15	.	.	PUNCT
finefocus-3634	119	1	a	a	DET
finefocus-3634	119	2	good	good	ADJ
finefocus-3634	119	3	correlation	correlation	NOUN
finefocus-3634	119	4	in	in	ADP
finefocus-3634	119	5	the	the	DET
finefocus-3634	119	6	yield	yield	NOUN
finefocus-3634	119	7	of	of	ADP
finefocus-3634	119	8	eg	eg	NOUN
finefocus-3634	119	9	from	from	ADP
finefocus-3634	119	10	uplc	uplc	ADJ
finefocus-3634	119	11	and	and	CCONJ
finefocus-3634	119	12	refractometry	refractometry	NOUN
finefocus-3634	119	13	techniques	technique	NOUN
finefocus-3634	119	14	was	be	AUX
finefocus-3634	119	15	observed	observe	VERB
finefocus-3634	119	16	.	.	PUNCT
finefocus-3634	120	1	the	the	DET
finefocus-3634	120	2	conversion	conversion	NOUN
finefocus-3634	120	3	of	of	ADP
finefocus-3634	120	4	bhet	bhet	NOUN
finefocus-3634	120	5	from	from	ADP
finefocus-3634	120	6	the	the	DET
finefocus-3634	120	7	yield	yield	NOUN
finefocus-3634	120	8	of	of	ADP
finefocus-3634	120	9	eg	eg	NOUN
finefocus-3634	120	10	was	be	AUX
finefocus-3634	120	11	calculated	calculate	VERB
finefocus-3634	120	12	using	use	VERB
finefocus-3634	120	13	the	the	DET
finefocus-3634	120	14	following	follow	VERB
finefocus-3634	120	15	equation	equation	NOUN
finefocus-3634	120	16	:	:	PUNCT
finefocus-3634	120	17	bhet	bhet	PROPN
finefocus-3634	120	18	conversion	conversion	PROPN
finefocus-3634	120	19	bhet	bhet	NOUN
finefocus-3634	120	20	(	(	PUNCT
finefocus-3634	120	21	g	g	NOUN
finefocus-3634	120	22	)	)	PUNCT
finefocus-3634	120	23	=	=	SYM
finefocus-3634	121	1	(	(	PUNCT
finefocus-3634	121	2	(	(	PUNCT
finefocus-3634	121	3	%	%	NOUN
finefocus-3634	121	4	eg)(1097	eg)(1097	ADP
finefocus-3634	121	5	g	g	PROPN
finefocus-3634	121	6	/	/	SYM
finefocus-3634	121	7	l	l	NOUN
finefocus-3634	121	8	eg)(254.238	eg)(254.238	NOUN
finefocus-3634	121	9	g	g	PROPN
finefocus-3634	121	10	/	/	SYM
finefocus-3634	121	11	mol	mol	X
finefocus-3634	121	12	bhet	bhet	NOUN
finefocus-3634	121	13	)	)	PUNCT
finefocus-3634	121	14	(	(	PUNCT
finefocus-3634	121	15	0.5))/((100)(62.07	0.5))/((100)(62.07	NOUN
finefocus-3634	121	16	g	g	NOUN
finefocus-3634	121	17	/	/	SYM
finefocus-3634	121	18	mol	mol	NOUN
finefocus-3634	121	19	eg	eg	NOUN
finefocus-3634	121	20	)	)	PUNCT
finefocus-3634	121	21	)	)	PUNCT
finefocus-3634	122	1	the	the	DET
finefocus-3634	122	2	yield	yield	NOUN
finefocus-3634	122	3	of	of	ADP
finefocus-3634	122	4	terephthalic	terephthalic	ADJ
finefocus-3634	122	5	acid	acid	NOUN
finefocus-3634	122	6	was	be	AUX
finefocus-3634	122	7	not	not	PART
finefocus-3634	122	8	measured	measure	VERB
finefocus-3634	122	9	because	because	SCONJ
finefocus-3634	122	10	it	it	PRON
finefocus-3634	122	11	precipitates	precipitate	VERB
finefocus-3634	122	12	in	in	ADP
finefocus-3634	122	13	water	water	NOUN
finefocus-3634	122	14	.	.	PUNCT
finefocus-3634	123	1	results	result	NOUN
finefocus-3634	123	2	and	and	CCONJ
finefocus-3634	123	3	discussion	discussion	NOUN
finefocus-3634	123	4	modeling	model	VERB
finefocus-3634	123	5	modified	modify	VERB
finefocus-3634	123	6	petase	petase	NOUN
finefocus-3634	123	7	plasmid	plasmid	ADJ
finefocus-3634	123	8	sequence	sequence	NOUN
finefocus-3634	123	9	it	it	PRON
finefocus-3634	123	10	has	have	AUX
finefocus-3634	123	11	been	be	AUX
finefocus-3634	123	12	reported	report	VERB
finefocus-3634	123	13	that	that	SCONJ
finefocus-3634	123	14	e.	e.	PROPN
finefocus-3634	123	15	coli	coli	PROPN
finefocus-3634	123	16	is	be	AUX
finefocus-3634	123	17	a	a	DET
finefocus-3634	123	18	compatible	compatible	ADJ
finefocus-3634	123	19	host	host	NOUN
finefocus-3634	123	20	of	of	ADP
finefocus-3634	123	21	petase.(seo	petase.(seo	PROPN
finefocus-3634	123	22	et	et	PROPN
finefocus-3634	123	23	al	al	PROPN
finefocus-3634	123	24	.	.	PROPN
finefocus-3634	123	25	,	,	PUNCT
finefocus-3634	123	26	2019	2019	NUM
finefocus-3634	123	27	)	)	PUNCT
finefocus-3634	124	1	bl21	bl21	PROPN
finefocus-3634	124	2	e.	e.	PROPN
finefocus-3634	124	3	coli	coli	NOUN
finefocus-3634	124	4	cells	cell	NOUN
finefocus-3634	124	5	were	be	AUX
finefocus-3634	124	6	utilized	utilize	VERB
finefocus-3634	124	7	as	as	ADP
finefocus-3634	124	8	vectors	vector	NOUN
finefocus-3634	124	9	of	of	ADP
finefocus-3634	124	10	the	the	DET
finefocus-3634	124	11	plasmids	plasmid	NOUN
finefocus-3634	124	12	.	.	PUNCT
finefocus-3634	125	1	using	use	VERB
finefocus-3634	125	2	pymol	pymol	NOUN
finefocus-3634	125	3	™	™	ADJ
finefocus-3634	125	4	software	software	NOUN
finefocus-3634	125	5	(	(	PUNCT
finefocus-3634	125	6	schrödinger	schrödinger	PROPN
finefocus-3634	125	7	,	,	PUNCT
finefocus-3634	125	8	inc	inc	PROPN
finefocus-3634	125	9	.	.	PROPN
finefocus-3634	125	10	version	version	PROPN
finefocus-3634	125	11	3	3	NUM
finefocus-3634	125	12	)	)	PUNCT
finefocus-3634	125	13	,	,	PUNCT
finefocus-3634	125	14	amino	amino	NOUN
finefocus-3634	125	15	acid	acid	NOUN
finefocus-3634	125	16	sequence	sequence	NOUN
finefocus-3634	125	17	of	of	ADP
finefocus-3634	125	18	petase	petase	NOUN
finefocus-3634	125	19	was	be	AUX
finefocus-3634	125	20	modeled	model	VERB
finefocus-3634	125	21	.	.	PUNCT
finefocus-3634	126	1	figure	figure	NOUN
finefocus-3634	126	2	1a	1a	PROPN
finefocus-3634	126	3	shows	show	VERB
finefocus-3634	126	4	the	the	DET
finefocus-3634	126	5	complete	complete	ADJ
finefocus-3634	126	6	petase	petase	NOUN
finefocus-3634	126	7	structure	structure	NOUN
finefocus-3634	126	8	,	,	PUNCT
finefocus-3634	126	9	with	with	ADP
finefocus-3634	126	10	the	the	DET
finefocus-3634	126	11	active	active	ADJ
finefocus-3634	126	12	site	site	NOUN
finefocus-3634	126	13	highlighted	highlight	VERB
finefocus-3634	126	14	in	in	ADP
finefocus-3634	126	15	yellow	yellow	ADJ
finefocus-3634	126	16	and	and	CCONJ
finefocus-3634	126	17	red	red	ADJ
finefocus-3634	126	18	.	.	PUNCT
finefocus-3634	127	1	in	in	ADP
finefocus-3634	127	2	figure	figure	NOUN
finefocus-3634	127	3	1b	1b	NUM
finefocus-3634	127	4	,	,	PUNCT
finefocus-3634	127	5	the	the	DET
finefocus-3634	127	6	active	active	ADJ
finefocus-3634	127	7	site	site	NOUN
finefocus-3634	127	8	of	of	ADP
finefocus-3634	127	9	petase	petase	NOUN
finefocus-3634	127	10	was	be	AUX
finefocus-3634	127	11	isolated	isolate	VERB
finefocus-3634	127	12	and	and	CCONJ
finefocus-3634	127	13	modified	modify	VERB
finefocus-3634	127	14	,	,	PUNCT
finefocus-3634	127	15	and	and	CCONJ
finefocus-3634	127	16	the	the	DET
finefocus-3634	127	17	region	region	NOUN
finefocus-3634	127	18	which	which	PRON
finefocus-3634	127	19	contains	contain	VERB
finefocus-3634	127	20	disulfide	disulfide	NOUN
finefocus-3634	127	21	bond	bond	NOUN
finefocus-3634	127	22	sequence	sequence	NOUN
finefocus-3634	127	23	was	be	AUX
finefocus-3634	127	24	removed	remove	VERB
finefocus-3634	127	25	.	.	PUNCT
finefocus-3634	128	1	this	this	PRON
finefocus-3634	128	2	was	be	AUX
finefocus-3634	128	3	done	do	VERB
finefocus-3634	128	4	to	to	PART
finefocus-3634	128	5	test	test	VERB
finefocus-3634	128	6	the	the	DET
finefocus-3634	128	7	effect	effect	NOUN
finefocus-3634	128	8	of	of	ADP
finefocus-3634	128	9	this	this	DET
finefocus-3634	128	10	disulfide	disulfide	NOUN
finefocus-3634	128	11	bond	bond	NOUN
finefocus-3634	128	12	on	on	ADP
finefocus-3634	128	13	the	the	DET
finefocus-3634	128	14	activity	activity	NOUN
finefocus-3634	128	15	of	of	ADP
finefocus-3634	128	16	petase	petase	NOUN
finefocus-3634	128	17	.	.	PUNCT
finefocus-3634	129	1	removal	removal	NOUN
finefocus-3634	129	2	of	of	ADP
finefocus-3634	129	3	the	the	DET
finefocus-3634	129	4	disulfide	disulfide	NOUN
finefocus-3634	129	5	bond	bond	NOUN
finefocus-3634	129	6	sequence	sequence	NOUN
finefocus-3634	129	7	produced	produce	VERB
finefocus-3634	129	8	a	a	DET
finefocus-3634	129	9	much	much	ADV
finefocus-3634	129	10	shorter	short	ADJ
finefocus-3634	129	11	protein	protein	NOUN
finefocus-3634	129	12	with	with	ADP
finefocus-3634	129	13	two	two	NUM
finefocus-3634	129	14	helices	helix	NOUN
finefocus-3634	129	15	and	and	CCONJ
finefocus-3634	129	16	three	three	NUM
finefocus-3634	129	17	beta	beta	ADJ
finefocus-3634	129	18	strands	strand	NOUN
finefocus-3634	129	19	(	(	PUNCT
finefocus-3634	129	20	figure	figure	NOUN
finefocus-3634	129	21	1b	1b	NUM
finefocus-3634	129	22	)	)	PUNCT
finefocus-3634	129	23	.	.	PUNCT
finefocus-3634	130	1	the	the	DET
finefocus-3634	130	2	sequence	sequence	NOUN
finefocus-3634	130	3	of	of	ADP
finefocus-3634	130	4	the	the	DET
finefocus-3634	130	5	modified	modify	VERB
finefocus-3634	130	6	active	active	ADJ
finefocus-3634	130	7	site	site	NOUN
finefocus-3634	130	8	(	(	PUNCT
finefocus-3634	130	9	a1	a1	PROPN
finefocus-3634	130	10	)	)	PUNCT
finefocus-3634	130	11	was	be	AUX
finefocus-3634	130	12	gvmgwsmggggslisaannpslkaa	gvmgwsmggggslisaannpslkaa	PROPN
finefocus-3634	130	13	apqapwdsstnfssvtvptlifacendsiapvn	apqapwdsstnfssvtvptlifacendsiapvn	NOUN
finefocus-3634	130	14	.	.	PUNCT
finefocus-3634	131	1	the	the	DET
finefocus-3634	131	2	sequence	sequence	NOUN
finefocus-3634	131	3	of	of	ADP
finefocus-3634	131	4	the	the	DET
finefocus-3634	131	5	modified	modify	VERB
finefocus-3634	131	6	petase	petase	NOUN
finefocus-3634	131	7	was	be	AUX
finefocus-3634	131	8	sent	send	VERB
finefocus-3634	131	9	to	to	ADP
finefocus-3634	131	10	idt	idt	PROPN
finefocus-3634	131	11	to	to	PART
finefocus-3634	131	12	synthesize	synthesize	VERB
finefocus-3634	131	13	it	it	PRON
finefocus-3634	131	14	.	.	PUNCT
finefocus-3634	132	1	the	the	DET
finefocus-3634	132	2	unmodified	unmodified	ADJ
finefocus-3634	132	3	petase	petase	NOUN
finefocus-3634	132	4	active	active	ADJ
finefocus-3634	132	5	site	site	NOUN
finefocus-3634	132	6	sequence	sequence	NOUN
finefocus-3634	132	7	(	(	PUNCT
finefocus-3634	132	8	a2	a2	PROPN
finefocus-3634	132	9	)	)	PUNCT
finefocus-3634	132	10	consisted	consist	VERB
finefocus-3634	132	11	of	of	ADP
finefocus-3634	132	12	three	three	NUM
finefocus-3634	132	13	alpha	alpha	ADJ
finefocus-3634	132	14	helices	helix	NOUN
finefocus-3634	132	15	and	and	CCONJ
finefocus-3634	132	16	four	four	NUM
finefocus-3634	132	17	beta	beta	ADJ
finefocus-3634	132	18	strands	strand	NOUN
finefocus-3634	132	19	(	(	PUNCT
finefocus-3634	132	20	figure	figure	NOUN
finefocus-3634	132	21	1c	1c	NOUN
finefocus-3634	132	22	)	)	PUNCT
finefocus-3634	132	23	.	.	PUNCT
finefocus-3634	133	1	the	the	DET
finefocus-3634	133	2	portion	portion	NOUN
finefocus-3634	133	3	highlighted	highlight	VERB
finefocus-3634	133	4	in	in	ADP
finefocus-3634	133	5	red	red	ADJ
finefocus-3634	133	6	displays	display	VERB
finefocus-3634	133	7	the	the	DET
finefocus-3634	133	8	section	section	NOUN
finefocus-3634	133	9	of	of	ADP
finefocus-3634	133	10	protein	protein	NOUN
finefocus-3634	133	11	which	which	PRON
finefocus-3634	133	12	was	be	AUX
finefocus-3634	133	13	not	not	PART
finefocus-3634	133	14	included	include	VERB
finefocus-3634	133	15	in	in	ADP
finefocus-3634	133	16	a1	a1	NOUN
finefocus-3634	133	17	.	.	PUNCT
finefocus-3634	134	1	the	the	DET
finefocus-3634	134	2	sequence	sequence	NOUN
finefocus-3634	134	3	of	of	ADP
finefocus-3634	134	4	a2	a2	PROPN
finefocus-3634	134	5	was	be	AUX
finefocus-3634	134	6	gvmgwsmgggg	gvmgwsmgggg	NOUN
finefocus-3634	134	7	slisaannpslkaaapqapwdsstnfssvtvpt	slisaannpslkaaapqapwdsstnfssvtvpt	NOUN
finefocus-3634	134	8	lifacendsiapvnssalpiydsmsrnakqflei	lifacendsiapvnssalpiydsmsrnakqflei	PROPN
finefocus-3634	134	9	nggshsc	nggshsc	PROPN
finefocus-3634	134	10	.	.	PUNCT
finefocus-3634	135	1	busca	busca	PROPN
finefocus-3634	135	2	software,(savojardo	software,(savojardo	PROPN
finefocus-3634	135	3	et	et	PROPN
finefocus-3634	135	4	al	al	PROPN
finefocus-3634	135	5	.	.	PROPN
finefocus-3634	135	6	,	,	PUNCT
finefocus-3634	135	7	2018	2018	NUM
finefocus-3634	135	8	)	)	PUNCT
finefocus-3634	135	9	which	which	PRON
finefocus-3634	135	10	is	be	AUX
finefocus-3634	135	11	a	a	DET
finefocus-3634	135	12	server	server	NOUN
finefocus-3634	135	13	through	through	ADP
finefocus-3634	135	14	which	which	PRON
finefocus-3634	135	15	a	a	DET
finefocus-3634	135	16	protein	protein	NOUN
finefocus-3634	135	17	sequence	sequence	NOUN
finefocus-3634	135	18	can	can	AUX
finefocus-3634	135	19	be	be	AUX
finefocus-3634	135	20	analyzed	analyze	VERB
finefocus-3634	135	21	,	,	PUNCT
finefocus-3634	135	22	was	be	AUX
finefocus-3634	135	23	used	use	VERB
finefocus-3634	135	24	to	to	PART
finefocus-3634	135	25	predict	predict	VERB
finefocus-3634	135	26	expression	expression	NOUN
finefocus-3634	135	27	of	of	ADP
finefocus-3634	135	28	the	the	DET
finefocus-3634	135	29	petase	petase	ADJ
finefocus-3634	135	30	active	active	ADJ
finefocus-3634	135	31	site	site	NOUN
finefocus-3634	135	32	.	.	PUNCT
finefocus-3634	136	1	this	this	DET
finefocus-3634	136	2	program	program	NOUN
finefocus-3634	136	3	determined	determine	VERB
finefocus-3634	136	4	that	that	SCONJ
finefocus-3634	136	5	unmodified	unmodified	ADJ
finefocus-3634	136	6	petase	petase	NOUN
finefocus-3634	136	7	94	94	NUM
finefocus-3634	136	8	i	i	PRON
finefocus-3634	136	9	fine	fine	ADJ
finefocus-3634	136	10	focus	focus	NOUN
finefocus-3634	136	11	is	be	AUX
finefocus-3634	136	12	an	an	DET
finefocus-3634	136	13	extracellular	extracellular	ADJ
finefocus-3634	136	14	protein	protein	NOUN
finefocus-3634	136	15	while	while	SCONJ
finefocus-3634	136	16	the	the	DET
finefocus-3634	136	17	modified	modify	VERB
finefocus-3634	136	18	petase	petase	NOUN
finefocus-3634	136	19	is	be	AUX
finefocus-3634	136	20	intracellularly	intracellularly	ADV
finefocus-3634	136	21	expressed	express	VERB
finefocus-3634	136	22	in	in	ADP
finefocus-3634	136	23	the	the	DET
finefocus-3634	136	24	cytoplasm	cytoplasm	NOUN
finefocus-3634	136	25	.	.	PUNCT
finefocus-3634	137	1	6	6	NUM
finefocus-3634	137	2	-	-	PUNCT
finefocus-3634	137	3	histidine	histidine	NOUN
finefocus-3634	137	4	tags	tag	NOUN
finefocus-3634	137	5	were	be	AUX
finefocus-3634	137	6	attached	attach	VERB
finefocus-3634	137	7	to	to	ADP
finefocus-3634	137	8	the	the	DET
finefocus-3634	137	9	ends	end	NOUN
finefocus-3634	137	10	of	of	ADP
finefocus-3634	137	11	the	the	DET
finefocus-3634	137	12	modified	modified	ADJ
finefocus-3634	137	13	petase	petase	NOUN
finefocus-3634	137	14	to	to	PART
finefocus-3634	137	15	enable	enable	VERB
finefocus-3634	137	16	purification	purification	NOUN
finefocus-3634	137	17	with	with	ADP
finefocus-3634	137	18	a	a	DET
finefocus-3634	137	19	histidine	histidine	ADJ
finefocus-3634	137	20	syringe	syringe	NOUN
finefocus-3634	137	21	column	column	NOUN
finefocus-3634	137	22	.	.	PUNCT
finefocus-3634	138	1	bhet	bhet	ADJ
finefocus-3634	138	2	degradation	degradation	NOUN
finefocus-3634	138	3	efficiency	efficiency	NOUN
finefocus-3634	138	4	using	use	VERB
finefocus-3634	138	5	a1	a1	NOUN
finefocus-3634	138	6	and	and	CCONJ
finefocus-3634	138	7	a2	a2	PROPN
finefocus-3634	138	8	petase	petase	ADP
finefocus-3634	138	9	active	active	ADJ
finefocus-3634	138	10	sites	site	NOUN
finefocus-3634	138	11	figure	figure	VERB
finefocus-3634	138	12	2	2	NUM
finefocus-3634	138	13	shows	show	VERB
finefocus-3634	138	14	protein	protein	NOUN
finefocus-3634	138	15	concentrations	concentration	NOUN
finefocus-3634	138	16	,	,	PUNCT
finefocus-3634	138	17	which	which	PRON
finefocus-3634	138	18	is	be	AUX
finefocus-3634	138	19	equivalent	equivalent	ADJ
finefocus-3634	138	20	to	to	ADP
finefocus-3634	138	21	enzyme	enzyme	VERB
finefocus-3634	138	22	concentrations	concentration	NOUN
finefocus-3634	138	23	of	of	ADP
finefocus-3634	138	24	a1	a1	NOUN
finefocus-3634	138	25	and	and	CCONJ
finefocus-3634	138	26	a2	a2	PROPN
finefocus-3634	138	27	petase	petase	NOUN
finefocus-3634	138	28	,	,	PUNCT
finefocus-3634	138	29	in	in	ADP
finefocus-3634	138	30	the	the	DET
finefocus-3634	138	31	absence	absence	NOUN
finefocus-3634	138	32	and	and	CCONJ
finefocus-3634	138	33	presence	presence	NOUN
finefocus-3634	138	34	of	of	ADP
finefocus-3634	138	35	pmsf	pmsf	NOUN
finefocus-3634	138	36	.	.	PUNCT
finefocus-3634	139	1	the	the	DET
finefocus-3634	139	2	error	error	NOUN
finefocus-3634	139	3	bars	bar	NOUN
finefocus-3634	139	4	show	show	VERB
finefocus-3634	139	5	standard	standard	ADJ
finefocus-3634	139	6	deviation	deviation	NOUN
finefocus-3634	139	7	from	from	ADP
finefocus-3634	139	8	five	five	NUM
finefocus-3634	139	9	measurements	measurement	NOUN
finefocus-3634	139	10	.	.	PUNCT
finefocus-3634	140	1	protein	protein	NOUN
finefocus-3634	140	2	concentrations	concentration	NOUN
finefocus-3634	140	3	of	of	ADP
finefocus-3634	140	4	a1	a1	NOUN
finefocus-3634	140	5	petase	petase	NOUN
finefocus-3634	140	6	in	in	ADP
finefocus-3634	140	7	the	the	DET
finefocus-3634	140	8	absence	absence	NOUN
finefocus-3634	140	9	and	and	CCONJ
finefocus-3634	140	10	presence	presence	NOUN
finefocus-3634	140	11	of	of	ADP
finefocus-3634	140	12	pmsf	pmsf	NOUN
finefocus-3634	140	13	are	be	AUX
finefocus-3634	140	14	31.57	31.57	NUM
finefocus-3634	140	15	±	±	NUM
finefocus-3634	140	16	3.09	3.09	NUM
finefocus-3634	140	17	μg	μg	PROPN
finefocus-3634	140	18	/	/	SYM
finefocus-3634	140	19	ml	ml	PROPN
finefocus-3634	140	20	and	and	CCONJ
finefocus-3634	140	21	37.52	37.52	NUM
finefocus-3634	140	22	±2	±2	NOUN
finefocus-3634	140	23	.	.	PUNCT
finefocus-3634	141	1	59	59	NUM
finefocus-3634	141	2	μg	μg	NOUN
finefocus-3634	141	3	/	/	SYM
finefocus-3634	141	4	ml	ml	NOUN
finefocus-3634	141	5	,	,	PUNCT
finefocus-3634	141	6	respectively	respectively	ADV
finefocus-3634	141	7	,	,	PUNCT
finefocus-3634	141	8	while	while	SCONJ
finefocus-3634	141	9	these	these	DET
finefocus-3634	141	10	values	value	NOUN
finefocus-3634	141	11	for	for	ADP
finefocus-3634	141	12	a2	a2	PROPN
finefocus-3634	141	13	petase	petase	NOUN
finefocus-3634	141	14	are	be	AUX
finefocus-3634	141	15	33.82	33.82	NUM
finefocus-3634	141	16	±	±	NUM
finefocus-3634	141	17	3.52	3.52	NUM
finefocus-3634	141	18	μg	μg	NOUN
finefocus-3634	141	19	/	/	SYM
finefocus-3634	141	20	ml	ml	PROPN
finefocus-3634	141	21	and	and	CCONJ
finefocus-3634	141	22	33.82	33.82	NUM
finefocus-3634	141	23	±	±	NUM
finefocus-3634	141	24	3.48	3.48	NUM
finefocus-3634	141	25	μg	μg	NOUN
finefocus-3634	141	26	/	/	SYM
finefocus-3634	141	27	ml	ml	X
finefocus-3634	141	28	respectively	respectively	ADV
finefocus-3634	141	29	.	.	PUNCT
finefocus-3634	142	1	the	the	DET
finefocus-3634	142	2	results	result	NOUN
finefocus-3634	142	3	indicate	indicate	VERB
finefocus-3634	142	4	that	that	SCONJ
finefocus-3634	142	5	protein	protein	NOUN
finefocus-3634	142	6	concentration	concentration	NOUN
finefocus-3634	142	7	of	of	ADP
finefocus-3634	142	8	a2	a2	PROPN
finefocus-3634	142	9	petase	petase	NOUN
finefocus-3634	142	10	,	,	PUNCT
finefocus-3634	142	11	which	which	PRON
finefocus-3634	142	12	contains	contain	VERB
finefocus-3634	142	13	disulfide	disulfide	NOUN
finefocus-3634	142	14	bond	bond	NOUN
finefocus-3634	142	15	,	,	PUNCT
finefocus-3634	142	16	did	do	AUX
finefocus-3634	142	17	not	not	PART
finefocus-3634	142	18	change	change	VERB
finefocus-3634	142	19	significantly	significantly	ADV
finefocus-3634	142	20	in	in	ADP
finefocus-3634	142	21	the	the	DET
finefocus-3634	142	22	presence	presence	NOUN
finefocus-3634	142	23	of	of	ADP
finefocus-3634	142	24	pmsf	pmsf	NOUN
finefocus-3634	142	25	.	.	PUNCT
finefocus-3634	143	1	there	there	PRON
finefocus-3634	143	2	is	be	VERB
finefocus-3634	143	3	a	a	DET
finefocus-3634	143	4	significant	significant	ADJ
finefocus-3634	143	5	increase	increase	NOUN
finefocus-3634	143	6	in	in	ADP
finefocus-3634	143	7	protein	protein	NOUN
finefocus-3634	143	8	concentration	concentration	NOUN
finefocus-3634	143	9	of	of	ADP
finefocus-3634	143	10	a1	a1	NOUN
finefocus-3634	143	11	petase	petase	NOUN
finefocus-3634	143	12	,	,	PUNCT
finefocus-3634	143	13	which	which	PRON
finefocus-3634	143	14	does	do	AUX
finefocus-3634	143	15	not	not	PART
finefocus-3634	143	16	contain	contain	VERB
finefocus-3634	143	17	disulfide	disulfide	NOUN
finefocus-3634	143	18	bond	bond	NOUN
finefocus-3634	143	19	,	,	PUNCT
finefocus-3634	143	20	in	in	ADP
finefocus-3634	143	21	the	the	DET
finefocus-3634	143	22	presence	presence	NOUN
finefocus-3634	143	23	of	of	ADP
finefocus-3634	143	24	pmsf	pmsf	NOUN
finefocus-3634	143	25	.	.	PUNCT
finefocus-3634	144	1	pmsf	pmsf	NOUN
finefocus-3634	144	2	is	be	AUX
finefocus-3634	144	3	a	a	DET
finefocus-3634	144	4	serine	serine	ADJ
finefocus-3634	144	5	protease	protease	NOUN
finefocus-3634	144	6	inhibitor	inhibitor	NOUN
finefocus-3634	144	7	,	,	PUNCT
finefocus-3634	144	8	which	which	PRON
finefocus-3634	144	9	blocks	block	VERB
finefocus-3634	144	10	the	the	DET
finefocus-3634	144	11	activity	activity	NOUN
finefocus-3634	144	12	of	of	ADP
finefocus-3634	144	13	proteases	protease	NOUN
finefocus-3634	144	14	such	such	ADJ
finefocus-3634	144	15	figure	figure	NOUN
finefocus-3634	144	16	1a	1a	NOUN
finefocus-3634	144	17	.	.	PUNCT
finefocus-3634	145	1	structure	structure	NOUN
finefocus-3634	145	2	of	of	ADP
finefocus-3634	145	3	complete	complete	ADJ
finefocus-3634	145	4	petase	petase	NOUN
finefocus-3634	145	5	.	.	PUNCT
finefocus-3634	146	1	figure	figure	NOUN
finefocus-3634	146	2	1b	1b	NUM
finefocus-3634	146	3	.	.	PUNCT
finefocus-3634	147	1	modified	modify	VERB
finefocus-3634	147	2	petase	petase	NOUN
finefocus-3634	147	3	sequence	sequence	NOUN
finefocus-3634	147	4	figure	figure	NOUN
finefocus-3634	147	5	1c	1c	NOUN
finefocus-3634	147	6	.	.	PUNCT
finefocus-3634	148	1	unmodified	unmodified	ADJ
finefocus-3634	148	2	petase	petase	NOUN
finefocus-3634	148	3	sequence	sequence	NOUN
finefocus-3634	148	4	without	without	ADP
finefocus-3634	148	5	a	a	DET
finefocus-3634	148	6	disulfide	disulfide	NOUN
finefocus-3634	148	7	bond	bond	NOUN
finefocus-3634	148	8	(	(	PUNCT
finefocus-3634	148	9	a1	a1	NOUN
finefocus-3634	148	10	)	)	PUNCT
finefocus-3634	148	11	.	.	PUNCT
finefocus-3634	149	1	with	with	ADP
finefocus-3634	149	2	a	a	DET
finefocus-3634	149	3	disulfide	disulfide	NOUN
finefocus-3634	149	4	bond	bond	NOUN
finefocus-3634	149	5	(	(	PUNCT
finefocus-3634	149	6	a2	a2	PROPN
finefocus-3634	149	7	)	)	PUNCT
finefocus-3634	149	8	.	.	PUNCT
finefocus-3634	150	1	as	as	ADP
finefocus-3634	150	2	elastase	elastase	VERB
finefocus-3634	150	3	that	that	PRON
finefocus-3634	150	4	degrade	degrade	VERB
finefocus-3634	150	5	petase	petase	ADV
finefocus-3634	150	6	.	.	PUNCT
finefocus-3634	151	1	a1	a1	NOUN
finefocus-3634	151	2	petase	petase	NOUN
finefocus-3634	151	3	is	be	AUX
finefocus-3634	151	4	less	less	ADV
finefocus-3634	151	5	stable	stable	ADJ
finefocus-3634	151	6	in	in	ADP
finefocus-3634	151	7	comparison	comparison	NOUN
finefocus-3634	151	8	to	to	ADP
finefocus-3634	151	9	the	the	DET
finefocus-3634	151	10	a2	a2	PROPN
finefocus-3634	151	11	due	due	ADP
finefocus-3634	151	12	to	to	ADP
finefocus-3634	151	13	its	its	PRON
finefocus-3634	151	14	lack	lack	NOUN
finefocus-3634	151	15	of	of	ADP
finefocus-3634	151	16	the	the	DET
finefocus-3634	151	17	disulfide	disulfide	NOUN
finefocus-3634	151	18	bond	bond	NOUN
finefocus-3634	151	19	.	.	PUNCT
finefocus-3634	152	1	the	the	DET
finefocus-3634	152	2	disulfide	disulfide	NOUN
finefocus-3634	152	3	bond	bond	NOUN
finefocus-3634	152	4	makes	make	VERB
finefocus-3634	152	5	proteins	protein	NOUN
finefocus-3634	152	6	more	more	ADJ
finefocus-3634	152	7	globular	globular	ADJ
finefocus-3634	152	8	,	,	PUNCT
finefocus-3634	152	9	less	less	ADV
finefocus-3634	152	10	likely	likely	ADJ
finefocus-3634	152	11	to	to	PART
finefocus-3634	152	12	denature	denature	VERB
finefocus-3634	152	13	,	,	PUNCT
finefocus-3634	152	14	and	and	CCONJ
finefocus-3634	152	15	increases	increase	VERB
finefocus-3634	152	16	protein	protein	NOUN
finefocus-3634	152	17	durability	durability	NOUN
finefocus-3634	152	18	.	.	PUNCT
finefocus-3634	153	1	removal	removal	NOUN
finefocus-3634	153	2	of	of	ADP
finefocus-3634	153	3	this	this	DET
finefocus-3634	153	4	disulfide	disulfide	NOUN
finefocus-3634	153	5	bond	bond	NOUN
finefocus-3634	153	6	from	from	ADP
finefocus-3634	153	7	a1	a1	NOUN
finefocus-3634	153	8	made	make	VERB
finefocus-3634	153	9	petase	petase	ADV
finefocus-3634	153	10	more	more	ADV
finefocus-3634	153	11	susceptible	susceptible	ADJ
finefocus-3634	153	12	to	to	ADP
finefocus-3634	153	13	degradation	degradation	NOUN
finefocus-3634	153	14	by	by	ADP
finefocus-3634	153	15	protease	protease	NOUN
finefocus-3634	153	16	inhibitors	inhibitor	NOUN
finefocus-3634	153	17	,	,	PUNCT
finefocus-3634	153	18	and	and	CCONJ
finefocus-3634	153	19	the	the	DET
finefocus-3634	153	20	addition	addition	NOUN
finefocus-3634	153	21	of	of	ADP
finefocus-3634	153	22	pmsf	pmsf	NOUN
finefocus-3634	153	23	blocked	block	VERB
finefocus-3634	153	24	proteases	protease	NOUN
finefocus-3634	153	25	from	from	ADP
finefocus-3634	153	26	degrading	degrade	VERB
finefocus-3634	153	27	a1	a1	NOUN
finefocus-3634	153	28	.	.	PUNCT
finefocus-3634	153	29	total	total	ADJ
finefocus-3634	153	30	protein	protein	NOUN
finefocus-3634	153	31	concentration	concentration	NOUN
finefocus-3634	153	32	of	of	ADP
finefocus-3634	153	33	a1	a1	NOUN
finefocus-3634	153	34	petase	petase	NOUN
finefocus-3634	153	35	increases	increase	NOUN
finefocus-3634	153	36	in	in	ADP
finefocus-3634	153	37	the	the	DET
finefocus-3634	153	38	presence	presence	NOUN
finefocus-3634	153	39	of	of	ADP
finefocus-3634	153	40	pmsf	pmsf	NOUN
finefocus-3634	153	41	.	.	PUNCT
finefocus-3634	154	1	a2	a2	PROPN
finefocus-3634	154	2	is	be	AUX
finefocus-3634	154	3	more	more	ADV
finefocus-3634	154	4	stable	stable	ADJ
finefocus-3634	154	5	due	due	ADP
finefocus-3634	154	6	to	to	ADP
finefocus-3634	154	7	its	its	PRON
finefocus-3634	154	8	disulfide	disulfide	NOUN
finefocus-3634	154	9	bond	bond	NOUN
finefocus-3634	154	10	,	,	PUNCT
finefocus-3634	154	11	so	so	SCONJ
finefocus-3634	154	12	it	it	PRON
finefocus-3634	154	13	was	be	AUX
finefocus-3634	154	14	not	not	PART
finefocus-3634	154	15	impacted	impact	VERB
finefocus-3634	154	16	by	by	ADP
finefocus-3634	154	17	proteases	protease	NOUN
finefocus-3634	154	18	to	to	ADP
finefocus-3634	154	19	the	the	DET
finefocus-3634	154	20	same	same	ADJ
finefocus-3634	154	21	extent	extent	NOUN
finefocus-3634	154	22	as	as	ADP
finefocus-3634	154	23	a1	a1	NOUN
finefocus-3634	154	24	,	,	PUNCT
finefocus-3634	154	25	and	and	CCONJ
finefocus-3634	154	26	the	the	DET
finefocus-3634	154	27	addition	addition	NOUN
finefocus-3634	154	28	of	of	ADP
finefocus-3634	154	29	pmsf	pmsf	NOUN
finefocus-3634	154	30	did	do	AUX
finefocus-3634	154	31	not	not	PART
finefocus-3634	154	32	create	create	VERB
finefocus-3634	154	33	a	a	DET
finefocus-3634	154	34	significant	significant	ADJ
finefocus-3634	154	35	difference	difference	NOUN
finefocus-3634	154	36	in	in	ADP
finefocus-3634	154	37	protein	protein	NOUN
finefocus-3634	154	38	concentration	concentration	NOUN
finefocus-3634	154	39	in	in	ADP
finefocus-3634	154	40	it	it	PRON
finefocus-3634	154	41	.	.	PUNCT
finefocus-3634	155	1	bca	bca	PROPN
finefocus-3634	155	2	assay	assay	PROPN
finefocus-3634	155	3	of	of	ADP
finefocus-3634	155	4	a	a	DET
finefocus-3634	155	5	control	control	NOUN
finefocus-3634	155	6	experiment	experiment	NOUN
finefocus-3634	155	7	without	without	ADP
finefocus-3634	155	8	addition	addition	NOUN
finefocus-3634	155	9	of	of	ADP
finefocus-3634	155	10	petase	petase	NOUN
finefocus-3634	155	11	shows	show	VERB
finefocus-3634	155	12	no	no	DET
finefocus-3634	155	13	protein	protein	NOUN
finefocus-3634	155	14	.	.	PUNCT
finefocus-3634	156	1	bhet	bhet	ADJ
finefocus-3634	156	2	degradation	degradation	NOUN
finefocus-3634	156	3	by	by	ADP
finefocus-3634	156	4	a1	a1	NOUN
finefocus-3634	156	5	and	and	CCONJ
finefocus-3634	156	6	a2	a2	PROPN
finefocus-3634	156	7	petase	petase	NOUN
finefocus-3634	156	8	demonstrate	demonstrate	VERB
finefocus-3634	156	9	that	that	SCONJ
finefocus-3634	156	10	both	both	PRON
finefocus-3634	156	11	can	can	AUX
finefocus-3634	156	12	efficiently	efficiently	ADV
finefocus-3634	156	13	degrade	degrade	VERB
finefocus-3634	156	14	bhet	bhet	NOUN
finefocus-3634	156	15	to	to	ADP
finefocus-3634	156	16	eg	eg	NOUN
finefocus-3634	156	17	and	and	CCONJ
finefocus-3634	156	18	tpa	tpa	NOUN
finefocus-3634	156	19	within	within	ADP
finefocus-3634	156	20	72	72	NUM
finefocus-3634	156	21	hours	hour	NOUN
finefocus-3634	156	22	(	(	PUNCT
finefocus-3634	156	23	figure	figure	NOUN
finefocus-3634	156	24	3	3	NUM
finefocus-3634	156	25	)	)	PUNCT
finefocus-3634	156	26	.	.	PUNCT
finefocus-3634	157	1	a	a	DET
finefocus-3634	157	2	control	control	NOUN
finefocus-3634	157	3	experiment	experiment	NOUN
finefocus-3634	157	4	containing	contain	VERB
finefocus-3634	157	5	only	only	ADJ
finefocus-3634	157	6	buffer	buffer	NOUN
finefocus-3634	157	7	solution	solution	NOUN
finefocus-3634	157	8	showed	show	VERB
finefocus-3634	157	9	no	no	DET
finefocus-3634	157	10	bhet	bhet	ADJ
finefocus-3634	157	11	degradation	degradation	NOUN
finefocus-3634	157	12	in	in	ADP
finefocus-3634	157	13	terms	term	NOUN
finefocus-3634	157	14	of	of	ADP
finefocus-3634	157	15	the	the	DET
finefocus-3634	157	16	yield	yield	NOUN
finefocus-3634	157	17	of	of	ADP
finefocus-3634	157	18	eg	eg	NOUN
finefocus-3634	157	19	.	.	PUNCT
finefocus-3634	158	1	a1	a1	NOUN
finefocus-3634	158	2	and	and	CCONJ
finefocus-3634	158	3	a2	a2	PROPN
finefocus-3634	158	4	petase	petase	PROPN
finefocus-3634	158	5	produced	produce	VERB
finefocus-3634	158	6	similar	similar	ADJ
finefocus-3634	158	7	amount	amount	NOUN
finefocus-3634	158	8	of	of	ADP
finefocus-3634	158	9	eg	eg	NOUN
finefocus-3634	158	10	(	(	PUNCT
finefocus-3634	158	11	14	14	NUM
finefocus-3634	158	12	–	–	SYM
finefocus-3634	158	13	15	15	NUM
finefocus-3634	158	14	%	%	NOUN
finefocus-3634	158	15	)	)	PUNCT
finefocus-3634	158	16	.	.	PUNCT
finefocus-3634	159	1	the	the	DET
finefocus-3634	159	2	error	error	NOUN
finefocus-3634	159	3	bars	bar	NOUN
finefocus-3634	159	4	in	in	ADP
finefocus-3634	159	5	figure	figure	NOUN
finefocus-3634	159	6	3	3	NUM
finefocus-3634	159	7	represent	represent	VERB
finefocus-3634	159	8	standard	standard	ADJ
finefocus-3634	159	9	deviation	deviation	NOUN
finefocus-3634	159	10	from	from	ADP
finefocus-3634	159	11	5	5	NUM
finefocus-3634	159	12	replicates	replicate	NOUN
finefocus-3634	159	13	.	.	PUNCT
finefocus-3634	160	1	the	the	DET
finefocus-3634	160	2	presence	presence	NOUN
finefocus-3634	160	3	of	of	ADP
finefocus-3634	160	4	pmsf	pmsf	NOUN
finefocus-3634	160	5	with	with	ADP
finefocus-3634	160	6	a1	a1	NOUN
finefocus-3634	160	7	or	or	CCONJ
finefocus-3634	160	8	a2	a2	PROPN
finefocus-3634	160	9	petase	petase	NOUN
finefocus-3634	160	10	showed	show	VERB
finefocus-3634	160	11	insignificant	insignificant	ADJ
finefocus-3634	160	12	changes	change	NOUN
finefocus-3634	160	13	in	in	ADP
finefocus-3634	160	14	the	the	DET
finefocus-3634	160	15	yield	yield	NOUN
finefocus-3634	160	16	of	of	ADP
finefocus-3634	160	17	eg	eg	NOUN
finefocus-3634	160	18	.	.	PUNCT
finefocus-3634	161	1	vol	vol	NOUN
finefocus-3634	161	2	8	8	NUM
finefocus-3634	162	1	i	i	NOUN
finefocus-3634	162	2	95	95	NUM
finefocus-3634	162	3	0	0	NUM
finefocus-3634	162	4	10	10	NUM
finefocus-3634	162	5	20	20	NUM
finefocus-3634	162	6	30	30	NUM
finefocus-3634	162	7	40	40	NUM
finefocus-3634	162	8	50	50	NUM
finefocus-3634	162	9	control	control	NOUN
finefocus-3634	162	10	a1	a1	PROPN
finefocus-3634	162	11	a1+pmsf	a1+pmsf	PROPN
finefocus-3634	162	12	a2	a2	PROPN
finefocus-3634	162	13	a2+pmsf	a2+pmsf	PROPN
finefocus-3634	162	14	pr	pr	NOUN
finefocus-3634	162	15	ot	ot	INTJ
finefocus-3634	162	16	ei	ei	ADP
finefocus-3634	162	17	n	n	PRON
finefocus-3634	162	18	c	c	PROPN
finefocus-3634	162	19	on	on	ADP
finefocus-3634	162	20	ce	ce	PROPN
finefocus-3634	162	21	nt	not	PART
finefocus-3634	162	22	ra	ra	PROPN
finefocus-3634	162	23	tio	tio	PROPN
finefocus-3634	162	24	n	n	PROPN
finefocus-3634	162	25	(	(	PUNCT
finefocus-3634	162	26	μ	μ	PROPN
finefocus-3634	162	27	g/	g/	NOUN
finefocus-3634	162	28	m	m	NOUN
finefocus-3634	162	29	l	l	NOUN
finefocus-3634	162	30	)	)	PUNCT
finefocus-3634	162	31	active	active	ADJ
finefocus-3634	162	32	site	site	NOUN
finefocus-3634	162	33	type	type	NOUN
finefocus-3634	162	34	figure	figure	NOUN
finefocus-3634	162	35	2	2	NUM
finefocus-3634	162	36	.	.	PUNCT
finefocus-3634	162	37	experimentally	experimentally	ADV
finefocus-3634	162	38	measured	measure	VERB
finefocus-3634	162	39	protein	protein	NOUN
finefocus-3634	162	40	concentration	concentration	NOUN
finefocus-3634	162	41	of	of	ADP
finefocus-3634	162	42	a1	a1	NOUN
finefocus-3634	162	43	and	and	CCONJ
finefocus-3634	162	44	a2	a2	PROPN
finefocus-3634	162	45	petase	petase	NOUN
finefocus-3634	162	46	in	in	ADP
finefocus-3634	162	47	the	the	DET
finefocus-3634	162	48	presence	presence	NOUN
finefocus-3634	162	49	and	and	CCONJ
finefocus-3634	162	50	absence	absence	NOUN
finefocus-3634	162	51	of	of	ADP
finefocus-3634	162	52	pmsf	pmsf	NOUN
finefocus-3634	162	53	.	.	PUNCT
finefocus-3634	163	1	figure	figure	VERB
finefocus-3634	163	2	4	4	NUM
finefocus-3634	163	3	shows	show	VERB
finefocus-3634	163	4	total	total	ADJ
finefocus-3634	163	5	amount	amount	NOUN
finefocus-3634	163	6	of	of	ADP
finefocus-3634	163	7	bhet	bhet	NOUN
finefocus-3634	163	8	degraded	degrade	VERB
finefocus-3634	163	9	in	in	ADP
finefocus-3634	163	10	72	72	NUM
finefocus-3634	163	11	hours	hour	NOUN
finefocus-3634	163	12	.	.	PUNCT
finefocus-3634	164	1	a1	a1	NOUN
finefocus-3634	164	2	and	and	CCONJ
finefocus-3634	164	3	a2	a2	PROPN
finefocus-3634	164	4	petase	petase	NOUN
finefocus-3634	164	5	resulted	result	VERB
finefocus-3634	164	6	in	in	ADP
finefocus-3634	164	7	332.05	332.05	NUM
finefocus-3634	164	8	±	±	NUM
finefocus-3634	164	9	14.44	14.44	NUM
finefocus-3634	164	10	g	g	NOUN
finefocus-3634	164	11	/	/	SYM
finefocus-3634	164	12	l	l	NOUN
finefocus-3634	164	13	and	and	CCONJ
finefocus-3634	164	14	320.85	320.85	NUM
finefocus-3634	164	15	±	±	NUM
finefocus-3634	164	16	12.58	12.58	NUM
finefocus-3634	164	17	g	g	NOUN
finefocus-3634	164	18	/	/	SYM
finefocus-3634	164	19	l	l	NOUN
finefocus-3634	164	20	bhet	bhet	PROPN
finefocus-3634	164	21	conversion	conversion	NOUN
finefocus-3634	164	22	,	,	PUNCT
finefocus-3634	164	23	respectively	respectively	ADV
finefocus-3634	164	24	,	,	PUNCT
finefocus-3634	164	25	in	in	ADP
finefocus-3634	164	26	the	the	DET
finefocus-3634	164	27	absence	absence	NOUN
finefocus-3634	164	28	of	of	ADP
finefocus-3634	164	29	pmsf	pmsf	NOUN
finefocus-3634	164	30	,	,	PUNCT
finefocus-3634	164	31	which	which	PRON
finefocus-3634	164	32	is	be	AUX
finefocus-3634	164	33	quite	quite	ADV
finefocus-3634	164	34	high	high	ADJ
finefocus-3634	164	35	.	.	PUNCT
finefocus-3634	165	1	bhet	bhet	ADJ
finefocus-3634	165	2	conversion	conversion	NOUN
finefocus-3634	165	3	by	by	ADP
finefocus-3634	165	4	a1	a1	NOUN
finefocus-3634	165	5	petase	petase	NOUN
finefocus-3634	165	6	is	be	AUX
finefocus-3634	165	7	a	a	DET
finefocus-3634	165	8	little	little	ADV
finefocus-3634	165	9	higher	high	ADJ
finefocus-3634	165	10	in	in	ADP
finefocus-3634	165	11	the	the	DET
finefocus-3634	165	12	presence	presence	NOUN
finefocus-3634	165	13	of	of	ADP
finefocus-3634	165	14	pmsf	pmsf	NOUN
finefocus-3634	165	15	,	,	PUNCT
finefocus-3634	165	16	which	which	PRON
finefocus-3634	165	17	is	be	AUX
finefocus-3634	165	18	likely	likely	ADJ
finefocus-3634	165	19	because	because	SCONJ
finefocus-3634	165	20	of	of	ADP
finefocus-3634	165	21	a	a	DET
finefocus-3634	165	22	slightly	slightly	ADV
finefocus-3634	165	23	higher	high	ADJ
finefocus-3634	165	24	amount	amount	NOUN
finefocus-3634	165	25	of	of	ADP
finefocus-3634	165	26	protein	protein	NOUN
finefocus-3634	165	27	in	in	ADP
finefocus-3634	165	28	the	the	DET
finefocus-3634	165	29	solution	solution	NOUN
finefocus-3634	165	30	as	as	SCONJ
finefocus-3634	165	31	seen	see	VERB
finefocus-3634	165	32	in	in	ADP
finefocus-3634	165	33	figure	figure	NOUN
finefocus-3634	165	34	2	2	NUM
finefocus-3634	165	35	.	.	PUNCT
finefocus-3634	166	1	the	the	DET
finefocus-3634	166	2	activity	activity	NOUN
finefocus-3634	166	3	of	of	ADP
finefocus-3634	166	4	both	both	DET
finefocus-3634	166	5	proteins	protein	NOUN
finefocus-3634	166	6	was	be	AUX
finefocus-3634	166	7	further	far	ADV
finefocus-3634	166	8	determined	determine	VERB
finefocus-3634	166	9	in	in	ADP
finefocus-3634	166	10	terms	term	NOUN
finefocus-3634	166	11	of	of	ADP
finefocus-3634	166	12	bhet	bhet	ADJ
finefocus-3634	166	13	degradation	degradation	NOUN
finefocus-3634	166	14	per	per	ADP
finefocus-3634	166	15	unit	unit	NOUN
finefocus-3634	166	16	(	(	PUNCT
finefocus-3634	166	17	microgram	microgram	NOUN
finefocus-3634	166	18	)	)	PUNCT
finefocus-3634	166	19	of	of	ADP
finefocus-3634	166	20	each	each	PRON
finefocus-3634	166	21	0	0	NUM
finefocus-3634	166	22	4	4	NUM
finefocus-3634	166	23	8	8	NUM
finefocus-3634	166	24	12	12	NUM
finefocus-3634	166	25	16	16	NUM
finefocus-3634	166	26	20	20	NUM
finefocus-3634	166	27	co	co	NOUN
finefocus-3634	166	28	ntr	ntr	VERB
finefocus-3634	166	29	ol	ol	ADJ
finefocus-3634	166	30	a1	a1	NOUN
finefocus-3634	166	31	a1	a1	NOUN
finefocus-3634	167	1	+	+	PROPN
finefocus-3634	167	2	p	p	PROPN
finefocus-3634	167	3	ms	ms	PROPN
finefocus-3634	167	4	f	f	PROPN
finefocus-3634	167	5	a2	a2	PROPN
finefocus-3634	167	6	a2	a2	PROPN
finefocus-3634	168	1	+	+	PROPN
finefocus-3634	168	2	p	p	PROPN
finefocus-3634	168	3	ms	ms	PROPN
finefocus-3634	168	4	f	f	PROPN
finefocus-3634	168	5	e	e	PROPN
finefocus-3634	168	6	g	g	PROPN
finefocus-3634	168	7	p	p	X
finefocus-3634	168	8	ro	ro	X
finefocus-3634	168	9	du	du	PROPN
finefocus-3634	168	10	ce	ce	PROPN
finefocus-3634	168	11	d	d	PROPN
finefocus-3634	168	12	(	(	PUNCT
finefocus-3634	168	13	%	%	NOUN
finefocus-3634	168	14	)	)	PUNCT
finefocus-3634	168	15	active	active	ADJ
finefocus-3634	168	16	site	site	NOUN
finefocus-3634	168	17	type	type	NOUN
finefocus-3634	168	18	0	0	NUM
finefocus-3634	168	19	100	100	NUM
finefocus-3634	168	20	200	200	NUM
finefocus-3634	168	21	300	300	NUM
finefocus-3634	168	22	400	400	NUM
finefocus-3634	168	23	co	co	NOUN
finefocus-3634	168	24	ntr	ntr	VERB
finefocus-3634	168	25	ol	ol	ADJ
finefocus-3634	168	26	a1	a1	NOUN
finefocus-3634	168	27	a1	a1	NOUN
finefocus-3634	169	1	+	+	PROPN
finefocus-3634	169	2	p	p	PROPN
finefocus-3634	169	3	ms	ms	PROPN
finefocus-3634	169	4	f	f	PROPN
finefocus-3634	169	5	a2	a2	PROPN
finefocus-3634	169	6	a2	a2	PROPN
finefocus-3634	170	1	+	+	PROPN
finefocus-3634	170	2	p	p	NOUN
finefocus-3634	170	3	ms	ms	NOUN
finefocus-3634	170	4	fb	fb	INTJ
finefocus-3634	170	5	h	h	NOUN
finefocus-3634	170	6	e	e	PROPN
finefocus-3634	170	7	t	t	PROPN
finefocus-3634	170	8	bi	bi	PROPN
finefocus-3634	170	9	od	od	PROPN
finefocus-3634	170	10	eg	eg	PROPN
finefocus-3634	170	11	ra	ra	PROPN
finefocus-3634	170	12	de	de	PROPN
finefocus-3634	170	13	d	d	PROPN
finefocus-3634	170	14	(	(	PUNCT
finefocus-3634	170	15	g	g	PROPN
finefocus-3634	170	16	/l	/l	PUNCT
finefocus-3634	170	17	)	)	PUNCT
finefocus-3634	170	18	active	active	ADJ
finefocus-3634	170	19	site	site	NOUN
finefocus-3634	170	20	type	type	NOUN
finefocus-3634	170	21	protein	protein	NOUN
finefocus-3634	170	22	(	(	PUNCT
finefocus-3634	170	23	figure	figure	NOUN
finefocus-3634	170	24	5	5	NUM
finefocus-3634	170	25	)	)	PUNCT
finefocus-3634	170	26	.	.	PUNCT
finefocus-3634	171	1	the	the	DET
finefocus-3634	171	2	error	error	NOUN
finefocus-3634	171	3	bars	bar	NOUN
finefocus-3634	171	4	in	in	ADP
finefocus-3634	171	5	figure	figure	NOUN
finefocus-3634	171	6	5	5	NUM
finefocus-3634	171	7	display	display	NOUN
finefocus-3634	171	8	standard	standard	ADJ
finefocus-3634	171	9	deviation	deviation	NOUN
finefocus-3634	171	10	from	from	ADP
finefocus-3634	171	11	5	5	NUM
finefocus-3634	171	12	replicates	replicate	NOUN
finefocus-3634	171	13	.	.	PUNCT
finefocus-3634	172	1	it	it	PRON
finefocus-3634	172	2	shows	show	VERB
finefocus-3634	172	3	that	that	SCONJ
finefocus-3634	172	4	the	the	DET
finefocus-3634	172	5	activity	activity	NOUN
finefocus-3634	172	6	of	of	ADP
finefocus-3634	172	7	a1	a1	NOUN
finefocus-3634	172	8	petase	petase	NOUN
finefocus-3634	172	9	(	(	PUNCT
finefocus-3634	172	10	0.1073	0.1073	NUM
finefocus-3634	172	11	±	±	NOUN
finefocus-3634	172	12	0.0168	0.0168	NUM
finefocus-3634	172	13	g	g	NOUN
finefocus-3634	172	14	/	/	SYM
finefocus-3634	172	15	μg	μg	NOUN
finefocus-3634	172	16	enzyme	enzyme	NOUN
finefocus-3634	172	17	)	)	PUNCT
finefocus-3634	172	18	is	be	AUX
finefocus-3634	172	19	slightly	slightly	ADV
finefocus-3634	172	20	higher	high	ADJ
finefocus-3634	172	21	than	than	ADP
finefocus-3634	172	22	that	that	PRON
finefocus-3634	172	23	of	of	ADP
finefocus-3634	172	24	a2	a2	PROPN
finefocus-3634	172	25	(	(	PUNCT
finefocus-3634	172	26	0.0962	0.0962	NUM
finefocus-3634	172	27	±	±	NOUN
finefocus-3634	172	28	0.0113	0.0113	NUM
finefocus-3634	172	29	g	g	PROPN
finefocus-3634	172	30	/	/	SYM
finefocus-3634	172	31	μg	μg	PROPN
finefocus-3634	172	32	)	)	PUNCT
finefocus-3634	172	33	.	.	PUNCT
finefocus-3634	173	1	the	the	DET
finefocus-3634	173	2	activity	activity	NOUN
finefocus-3634	173	3	of	of	ADP
finefocus-3634	173	4	a1	a1	NOUN
finefocus-3634	173	5	in	in	ADP
finefocus-3634	173	6	the	the	DET
finefocus-3634	173	7	presence	presence	NOUN
finefocus-3634	173	8	of	of	ADP
finefocus-3634	173	9	pmsf	pmsf	NOUN
finefocus-3634	173	10	is	be	AUX
finefocus-3634	173	11	slightly	slightly	ADV
finefocus-3634	173	12	lower	low	ADJ
finefocus-3634	173	13	(	(	PUNCT
finefocus-3634	173	14	0.0843	0.0843	NUM
finefocus-3634	173	15	±	±	NOUN
finefocus-3634	173	16	0.0191	0.0191	NUM
finefocus-3634	173	17	g	g	NOUN
finefocus-3634	173	18	/	/	SYM
finefocus-3634	173	19	μg	μg	NOUN
finefocus-3634	173	20	)	)	PUNCT
finefocus-3634	173	21	because	because	SCONJ
finefocus-3634	173	22	of	of	ADP
finefocus-3634	173	23	total	total	ADJ
finefocus-3634	173	24	measured	measure	VERB
finefocus-3634	173	25	protein	protein	NOUN
finefocus-3634	173	26	concentration	concentration	NOUN
finefocus-3634	173	27	in	in	ADP
finefocus-3634	173	28	the	the	DET
finefocus-3634	173	29	presence	presence	NOUN
finefocus-3634	173	30	of	of	ADP
finefocus-3634	173	31	pmsf	pmsf	NOUN
finefocus-3634	173	32	was	be	AUX
finefocus-3634	173	33	higher	high	ADJ
finefocus-3634	173	34	as	as	SCONJ
finefocus-3634	173	35	discussed	discuss	VERB
finefocus-3634	173	36	above	above	ADV
finefocus-3634	173	37	.	.	PUNCT
finefocus-3634	174	1	upon	upon	SCONJ
finefocus-3634	174	2	consideration	consideration	NOUN
finefocus-3634	174	3	of	of	ADP
finefocus-3634	174	4	standard	standard	ADJ
finefocus-3634	174	5	deviation	deviation	NOUN
finefocus-3634	174	6	,	,	PUNCT
finefocus-3634	174	7	the	the	DET
finefocus-3634	174	8	activity	activity	NOUN
finefocus-3634	174	9	of	of	ADP
finefocus-3634	174	10	a1	a1	NOUN
finefocus-3634	174	11	and	and	CCONJ
finefocus-3634	174	12	a2	a2	PROPN
finefocus-3634	174	13	petase	petase	NOUN
finefocus-3634	174	14	appears	appear	VERB
finefocus-3634	174	15	to	to	PART
finefocus-3634	174	16	be	be	AUX
finefocus-3634	174	17	similar	similar	ADJ
finefocus-3634	174	18	,	,	PUNCT
finefocus-3634	174	19	which	which	PRON
finefocus-3634	174	20	ranges	range	VERB
finefocus-3634	174	21	between	between	ADP
finefocus-3634	174	22	figure	figure	NOUN
finefocus-3634	174	23	3	3	NUM
finefocus-3634	174	24	.	.	NOUN
finefocus-3634	174	25	percentage	percentage	NOUN
finefocus-3634	174	26	of	of	ADP
finefocus-3634	174	27	ethylene	ethylene	NOUN
finefocus-3634	174	28	glycol	glycol	NOUN
finefocus-3634	174	29	produced	produce	VERB
finefocus-3634	174	30	by	by	ADP
finefocus-3634	174	31	a1	a1	NOUN
finefocus-3634	174	32	and	and	CCONJ
finefocus-3634	174	33	a2	a2	PROPN
finefocus-3634	174	34	petase	petase	NOUN
finefocus-3634	174	35	with	with	ADP
finefocus-3634	174	36	and	and	CCONJ
finefocus-3634	174	37	without	without	ADP
finefocus-3634	174	38	pmsf	pmsf	NOUN
finefocus-3634	174	39	in	in	ADP
finefocus-3634	174	40	72	72	NUM
finefocus-3634	174	41	hours	hour	NOUN
finefocus-3634	174	42	.	.	PUNCT
finefocus-3634	175	1	figure	figure	NOUN
finefocus-3634	175	2	4	4	NUM
finefocus-3634	175	3	.	.	PUNCT
finefocus-3634	175	4	total	total	ADJ
finefocus-3634	175	5	bhet	bhet	NOUN
finefocus-3634	175	6	degraded	degrade	VERB
finefocus-3634	175	7	by	by	ADP
finefocus-3634	175	8	a1	a1	NOUN
finefocus-3634	175	9	and	and	CCONJ
finefocus-3634	175	10	a2	a2	PROPN
finefocus-3634	175	11	petase	petase	NOUN
finefocus-3634	175	12	with	with	ADP
finefocus-3634	175	13	and	and	CCONJ
finefocus-3634	175	14	without	without	ADP
finefocus-3634	175	15	pmsf	pmsf	NOUN
finefocus-3634	175	16	in	in	ADP
finefocus-3634	175	17	72	72	NUM
finefocus-3634	175	18	hours	hour	NOUN
finefocus-3634	175	19	.	.	PUNCT
finefocus-3634	176	1	96	96	NUM
finefocus-3634	177	1	i	i	PRON
finefocus-3634	177	2	fine	fine	ADJ
finefocus-3634	177	3	focus	focus	VERB
finefocus-3634	177	4	0.08	0.08	NUM
finefocus-3634	177	5	-	-	SYM
finefocus-3634	177	6	0.1	0.1	NUM
finefocus-3634	177	7	g	g	NOUN
finefocus-3634	177	8	bhet	bhet	ADJ
finefocus-3634	177	9	degradation	degradation	NOUN
finefocus-3634	177	10	/	/	SYM
finefocus-3634	177	11	μg	μg	PROPN
finefocus-3634	177	12	of	of	ADP
finefocus-3634	177	13	protein	protein	NOUN
finefocus-3634	177	14	.	.	PUNCT
finefocus-3634	178	1	while	while	SCONJ
finefocus-3634	178	2	absence	absence	NOUN
finefocus-3634	178	3	of	of	ADP
finefocus-3634	178	4	the	the	DET
finefocus-3634	178	5	disulfide	disulfide	NOUN
finefocus-3634	178	6	bond	bond	NOUN
finefocus-3634	178	7	in	in	ADP
finefocus-3634	178	8	a1	a1	NOUN
finefocus-3634	178	9	structural	structural	ADJ
finefocus-3634	178	10	sequence	sequence	NOUN
finefocus-3634	178	11	makes	make	VERB
finefocus-3634	178	12	it	it	PRON
finefocus-3634	178	13	less	less	ADV
finefocus-3634	178	14	stable	stable	ADJ
finefocus-3634	178	15	,	,	PUNCT
finefocus-3634	178	16	owing	owe	VERB
finefocus-3634	178	17	to	to	ADP
finefocus-3634	178	18	the	the	DET
finefocus-3634	178	19	lack	lack	NOUN
finefocus-3634	178	20	of	of	ADP
finefocus-3634	178	21	globular	globular	ADJ
finefocus-3634	178	22	structure	structure	NOUN
finefocus-3634	178	23	,	,	PUNCT
finefocus-3634	178	24	and	and	CCONJ
finefocus-3634	178	25	its	its	PRON
finefocus-3634	178	26	activity	activity	NOUN
finefocus-3634	178	27	was	be	AUX
finefocus-3634	178	28	expected	expect	VERB
finefocus-3634	178	29	to	to	PART
finefocus-3634	178	30	be	be	AUX
finefocus-3634	178	31	lower	low	ADJ
finefocus-3634	178	32	with	with	ADP
finefocus-3634	178	33	reference	reference	NOUN
finefocus-3634	178	34	to	to	ADP
finefocus-3634	178	35	the	the	DET
finefocus-3634	178	36	activity	activity	NOUN
finefocus-3634	178	37	of	of	ADP
finefocus-3634	178	38	a2	a2	PROPN
finefocus-3634	178	39	,	,	PUNCT
finefocus-3634	178	40	the	the	DET
finefocus-3634	178	41	similar	similar	ADJ
finefocus-3634	178	42	activity	activity	NOUN
finefocus-3634	178	43	of	of	ADP
finefocus-3634	178	44	a1	a1	NOUN
finefocus-3634	178	45	and	and	CCONJ
finefocus-3634	178	46	a2	a2	PROPN
finefocus-3634	178	47	indicates	indicate	VERB
finefocus-3634	178	48	that	that	SCONJ
finefocus-3634	178	49	the	the	DET
finefocus-3634	178	50	active	active	ADJ
finefocus-3634	178	51	site	site	NOUN
finefocus-3634	178	52	disulfide	disulfide	NOUN
finefocus-3634	178	53	bond	bond	NOUN
finefocus-3634	178	54	does	do	AUX
finefocus-3634	178	55	not	not	PART
finefocus-3634	178	56	have	have	VERB
finefocus-3634	178	57	an	an	DET
finefocus-3634	178	58	impact	impact	NOUN
finefocus-3634	178	59	on	on	ADP
finefocus-3634	178	60	petase	petase	NOUN
finefocus-3634	178	61	’s	’s	PART
finefocus-3634	178	62	activity	activity	NOUN
finefocus-3634	178	63	.	.	PUNCT
finefocus-3634	179	1	the	the	DET
finefocus-3634	179	2	results	result	NOUN
finefocus-3634	179	3	shown	show	VERB
finefocus-3634	179	4	in	in	ADP
finefocus-3634	179	5	figure	figure	NOUN
finefocus-3634	179	6	5	5	NUM
finefocus-3634	179	7	demonstrate	demonstrate	VERB
finefocus-3634	179	8	that	that	SCONJ
finefocus-3634	179	9	the	the	DET
finefocus-3634	179	10	activity	activity	NOUN
finefocus-3634	179	11	of	of	ADP
finefocus-3634	179	12	a1	a1	NOUN
finefocus-3634	179	13	petase	petase	NOUN
finefocus-3634	179	14	is	be	AUX
finefocus-3634	179	15	significantly	significantly	ADV
finefocus-3634	179	16	affected	affect	VERB
finefocus-3634	179	17	by	by	ADP
finefocus-3634	179	18	the	the	DET
finefocus-3634	179	19	presence	presence	NOUN
finefocus-3634	179	20	of	of	ADP
finefocus-3634	179	21	pmsf	pmsf	NOUN
finefocus-3634	179	22	.	.	PUNCT
finefocus-3634	180	1	it	it	PRON
finefocus-3634	180	2	indicates	indicate	VERB
finefocus-3634	180	3	that	that	SCONJ
finefocus-3634	180	4	the	the	DET
finefocus-3634	180	5	short	short	ADJ
finefocus-3634	180	6	structure	structure	NOUN
finefocus-3634	180	7	of	of	ADP
finefocus-3634	180	8	a1	a1	NOUN
finefocus-3634	180	9	is	be	AUX
finefocus-3634	180	10	unstable	unstable	ADJ
finefocus-3634	180	11	in	in	ADP
finefocus-3634	180	12	the	the	DET
finefocus-3634	180	13	presence	presence	NOUN
finefocus-3634	180	14	of	of	ADP
finefocus-3634	180	15	pmsf	pmsf	NOUN
finefocus-3634	180	16	as	as	SCONJ
finefocus-3634	180	17	the	the	DET
finefocus-3634	180	18	serine	serine	NOUN
finefocus-3634	180	19	is	be	AUX
finefocus-3634	180	20	blocked	block	VERB
finefocus-3634	180	21	in	in	ADP
finefocus-3634	180	22	the	the	DET
finefocus-3634	180	23	catalytic	catalytic	ADJ
finefocus-3634	180	24	triad	triad	NOUN
finefocus-3634	180	25	.	.	PUNCT
finefocus-3634	181	1	in	in	ADP
finefocus-3634	181	2	contrast	contrast	NOUN
finefocus-3634	181	3	,	,	PUNCT
finefocus-3634	181	4	a2	a2	PROPN
finefocus-3634	181	5	exhibits	exhibit	VERB
finefocus-3634	181	6	a	a	DET
finefocus-3634	181	7	slight	slight	ADJ
finefocus-3634	181	8	increase	increase	NOUN
finefocus-3634	181	9	in	in	ADP
finefocus-3634	181	10	activity	activity	NOUN
finefocus-3634	181	11	upon	upon	SCONJ
finefocus-3634	181	12	the	the	DET
finefocus-3634	181	13	addition	addition	NOUN
finefocus-3634	181	14	of	of	ADP
finefocus-3634	181	15	pmsf	pmsf	NOUN
finefocus-3634	181	16	because	because	SCONJ
finefocus-3634	181	17	of	of	ADP
finefocus-3634	181	18	the	the	DET
finefocus-3634	181	19	higher	high	ADJ
finefocus-3634	181	20	stability	stability	NOUN
finefocus-3634	181	21	given	give	VERB
finefocus-3634	181	22	by	by	ADP
finefocus-3634	181	23	the	the	DET
finefocus-3634	181	24	disulfide	disulfide	NOUN
finefocus-3634	181	25	bond	bond	NOUN
finefocus-3634	181	26	,	,	PUNCT
finefocus-3634	181	27	but	but	CCONJ
finefocus-3634	181	28	it	it	PRON
finefocus-3634	181	29	could	could	AUX
finefocus-3634	181	30	be	be	AUX
finefocus-3634	181	31	within	within	ADP
finefocus-3634	181	32	the	the	DET
finefocus-3634	181	33	experimental	experimental	ADJ
finefocus-3634	181	34	uncertainty	uncertainty	NOUN
finefocus-3634	181	35	.	.	PUNCT
finefocus-3634	182	1	thus	thus	ADV
finefocus-3634	182	2	,	,	PUNCT
finefocus-3634	182	3	pmsf	pmsf	NOUN
finefocus-3634	182	4	did	do	AUX
finefocus-3634	182	5	not	not	PART
finefocus-3634	182	6	inhibit	inhibit	VERB
finefocus-3634	182	7	the	the	DET
finefocus-3634	182	8	activity	activity	NOUN
finefocus-3634	182	9	of	of	ADP
finefocus-3634	182	10	a2	a2	PROPN
finefocus-3634	182	11	petase	petase	PROPN
finefocus-3634	182	12	’s	’s	PART
finefocus-3634	182	13	active	active	ADJ
finefocus-3634	182	14	site	site	NOUN
finefocus-3634	182	15	as	as	SCONJ
finefocus-3634	182	16	hypothesized	hypothesize	VERB
finefocus-3634	182	17	from	from	ADP
finefocus-3634	182	18	the	the	DET
finefocus-3634	182	19	fact	fact	NOUN
finefocus-3634	182	20	that	that	SCONJ
finefocus-3634	182	21	pmsf	pmsf	NOUN
finefocus-3634	182	22	would	would	AUX
finefocus-3634	182	23	block	block	VERB
finefocus-3634	182	24	the	the	DET
finefocus-3634	182	25	serine	serine	NOUN
finefocus-3634	182	26	at	at	ADP
finefocus-3634	182	27	the	the	DET
finefocus-3634	182	28	catalytic	catalytic	ADJ
finefocus-3634	182	29	triad	triad	ADJ
finefocus-3634	182	30	and	and	CCONJ
finefocus-3634	182	31	disrupt	disrupt	VERB
finefocus-3634	182	32	enzyme	enzyme	NOUN
finefocus-3634	182	33	activity	activity	NOUN
finefocus-3634	182	34	.	.	PUNCT
finefocus-3634	183	1	the	the	DET
finefocus-3634	183	2	addition	addition	NOUN
finefocus-3634	183	3	of	of	ADP
finefocus-3634	183	4	pmsf	pmsf	NOUN
finefocus-3634	183	5	prevents	prevent	VERB
finefocus-3634	183	6	protease	protease	NOUN
finefocus-3634	183	7	activity	activity	NOUN
finefocus-3634	183	8	throughout	throughout	ADP
finefocus-3634	183	9	the	the	DET
finefocus-3634	183	10	reaction	reaction	NOUN
finefocus-3634	183	11	,	,	PUNCT
finefocus-3634	183	12	resulting	result	VERB
finefocus-3634	183	13	in	in	ADP
finefocus-3634	183	14	preserving	preserve	VERB
finefocus-3634	183	15	the	the	DET
finefocus-3634	183	16	activity	activity	NOUN
finefocus-3634	183	17	of	of	ADP
finefocus-3634	183	18	enzyme	enzyme	NOUN
finefocus-3634	183	19	a2	a2	NOUN
finefocus-3634	183	20	.	.	PUNCT
finefocus-3634	184	1	this	this	DET
finefocus-3634	184	2	work	work	NOUN
finefocus-3634	184	3	advances	advance	VERB
finefocus-3634	184	4	the	the	DET
finefocus-3634	184	5	understanding	understanding	NOUN
finefocus-3634	184	6	on	on	ADP
finefocus-3634	184	7	the	the	DET
finefocus-3634	184	8	role	role	NOUN
finefocus-3634	184	9	of	of	ADP
finefocus-3634	184	10	the	the	DET
finefocus-3634	184	11	disulfide	disulfide	NOUN
finefocus-3634	184	12	bond	bond	NOUN
finefocus-3634	184	13	of	of	ADP
finefocus-3634	184	14	petase	petase	NOUN
finefocus-3634	184	15	in	in	ADP
finefocus-3634	184	16	the	the	DET
finefocus-3634	184	17	degradation	degradation	NOUN
finefocus-3634	184	18	of	of	ADP
finefocus-3634	184	19	bhet	bhet	NOUN
finefocus-3634	184	20	as	as	ADP
finefocus-3634	184	21	a	a	DET
finefocus-3634	184	22	model	model	NOUN
finefocus-3634	184	23	compound	compound	NOUN
finefocus-3634	184	24	,	,	PUNCT
finefocus-3634	184	25	which	which	PRON
finefocus-3634	184	26	will	will	AUX
finefocus-3634	184	27	enable	enable	VERB
finefocus-3634	184	28	future	future	ADJ
finefocus-3634	184	29	development	development	NOUN
finefocus-3634	184	30	of	of	ADP
finefocus-3634	184	31	more	more	ADV
finefocus-3634	184	32	active	active	ADJ
finefocus-3634	184	33	petase	petase	NOUN
finefocus-3634	184	34	without	without	ADP
finefocus-3634	184	35	this	this	DET
finefocus-3634	184	36	bond	bond	NOUN
finefocus-3634	184	37	for	for	ADP
finefocus-3634	184	38	degradation	degradation	NOUN
finefocus-3634	184	39	of	of	ADP
finefocus-3634	184	40	pet	pet	NOUN
finefocus-3634	184	41	to	to	ADP
finefocus-3634	184	42	eg	eg	NOUN
finefocus-3634	184	43	and	and	CCONJ
finefocus-3634	184	44	tpa	tpa	PROPN
finefocus-3634	184	45	.	.	PUNCT
finefocus-3634	185	1	conclusions	conclusion	NOUN
finefocus-3634	185	2	this	this	DET
finefocus-3634	185	3	work	work	NOUN
finefocus-3634	185	4	described	describe	VERB
finefocus-3634	185	5	the	the	DET
finefocus-3634	185	6	cleavage	cleavage	NOUN
finefocus-3634	185	7	of	of	ADP
finefocus-3634	185	8	ester	ester	NOUN
finefocus-3634	185	9	linkages	linkage	NOUN
finefocus-3634	185	10	,	,	PUNCT
finefocus-3634	185	11	present	present	ADJ
finefocus-3634	185	12	in	in	ADP
finefocus-3634	185	13	pet	pet	ADJ
finefocus-3634	185	14	plastic	plastic	NOUN
finefocus-3634	185	15	,	,	PUNCT
finefocus-3634	185	16	with	with	ADP
finefocus-3634	185	17	petase	petase	NOUN
finefocus-3634	185	18	enzymes	enzyme	NOUN
finefocus-3634	185	19	in	in	ADP
finefocus-3634	185	20	the	the	DET
finefocus-3634	185	21	presence	presence	NOUN
finefocus-3634	185	22	and	and	CCONJ
finefocus-3634	185	23	absence	absence	NOUN
finefocus-3634	185	24	of	of	ADP
finefocus-3634	185	25	a	a	DET
finefocus-3634	185	26	disulfide	disulfide	NOUN
finefocus-3634	185	27	bond	bond	NOUN
finefocus-3634	185	28	to	to	PART
finefocus-3634	185	29	elucidate	elucidate	VERB
finefocus-3634	185	30	the	the	DET
finefocus-3634	185	31	role	role	NOUN
finefocus-3634	185	32	of	of	ADP
finefocus-3634	185	33	the	the	DET
finefocus-3634	185	34	disulfide	disulfide	NOUN
finefocus-3634	185	35	bond	bond	NOUN
finefocus-3634	185	36	on	on	ADP
finefocus-3634	185	37	the	the	DET
finefocus-3634	185	38	enzyme	enzyme	NOUN
finefocus-3634	185	39	’s	’s	PART
finefocus-3634	185	40	activity	activity	NOUN
finefocus-3634	185	41	.	.	PUNCT
finefocus-3634	186	1	a	a	DET
finefocus-3634	186	2	modified	modify	VERB
finefocus-3634	186	3	petase	petase	NOUN
finefocus-3634	186	4	enzyme	enzyme	NOUN
finefocus-3634	186	5	without	without	ADP
finefocus-3634	186	6	disulfide	disulfide	NOUN
finefocus-3634	186	7	bond	bond	NOUN
finefocus-3634	186	8	sequence	sequence	NOUN
finefocus-3634	186	9	was	be	AUX
finefocus-3634	186	10	first	first	ADV
finefocus-3634	186	11	modeled	model	VERB
finefocus-3634	186	12	and	and	CCONJ
finefocus-3634	186	13	synthesized	synthesize	VERB
finefocus-3634	186	14	.	.	PUNCT
finefocus-3634	187	1	then	then	ADV
finefocus-3634	187	2	,	,	PUNCT
finefocus-3634	187	3	petase	petase	ADP
finefocus-3634	187	4	enzymes	enzyme	NOUN
finefocus-3634	187	5	with	with	ADP
finefocus-3634	187	6	and	and	CCONJ
finefocus-3634	187	7	without	without	ADP
finefocus-3634	187	8	the	the	DET
finefocus-3634	187	9	disulfide	disulfide	NOUN
finefocus-3634	187	10	bond	bond	NOUN
finefocus-3634	187	11	were	be	AUX
finefocus-3634	187	12	cultured	cultured	ADJ
finefocus-3634	187	13	,	,	PUNCT
finefocus-3634	187	14	purified	purified	ADJ
finefocus-3634	187	15	,	,	PUNCT
finefocus-3634	187	16	assayed	assayed	ADJ
finefocus-3634	187	17	,	,	PUNCT
finefocus-3634	187	18	and	and	CCONJ
finefocus-3634	187	19	used	use	VERB
finefocus-3634	187	20	for	for	ADP
finefocus-3634	187	21	cleavage	cleavage	NOUN
finefocus-3634	187	22	of	of	ADP
finefocus-3634	187	23	ester	ester	NOUN
finefocus-3634	187	24	linkages	linkage	NOUN
finefocus-3634	187	25	of	of	ADP
finefocus-3634	187	26	a	a	DET
finefocus-3634	187	27	pet	pet	ADJ
finefocus-3634	187	28	surrogate	surrogate	ADJ
finefocus-3634	187	29	substrate	substrate	NOUN
finefocus-3634	187	30	,	,	PUNCT
finefocus-3634	187	31	bhet	bhet	NOUN
finefocus-3634	187	32	.	.	PUNCT
finefocus-3634	188	1	typically	typically	ADV
finefocus-3634	188	2	the	the	DET
finefocus-3634	188	3	reaction	reaction	NOUN
finefocus-3634	188	4	between	between	ADP
finefocus-3634	188	5	pet	pet	NOUN
finefocus-3634	188	6	and	and	CCONJ
finefocus-3634	188	7	petase	petase	NOUN
finefocus-3634	188	8	must	must	AUX
finefocus-3634	188	9	be	be	AUX
finefocus-3634	188	10	run	run	VERB
finefocus-3634	188	11	for	for	ADP
finefocus-3634	188	12	several	several	ADJ
finefocus-3634	188	13	days	day	NOUN
finefocus-3634	188	14	,	,	PUNCT
finefocus-3634	188	15	and	and	CCONJ
finefocus-3634	188	16	the	the	DET
finefocus-3634	188	17	results	result	NOUN
finefocus-3634	188	18	are	be	AUX
finefocus-3634	188	19	analyzed	analyze	VERB
finefocus-3634	188	20	with	with	ADP
finefocus-3634	188	21	cumbersome	cumbersome	ADJ
finefocus-3634	188	22	microscopic	microscopic	ADJ
finefocus-3634	188	23	techniques	technique	NOUN
finefocus-3634	188	24	to	to	PART
finefocus-3634	188	25	measure	measure	VERB
finefocus-3634	188	26	crystallinity	crystallinity	NOUN
finefocus-3634	188	27	loss	loss	NOUN
finefocus-3634	188	28	of	of	ADP
finefocus-3634	188	29	pet	pet	NOUN
finefocus-3634	188	30	,	,	PUNCT
finefocus-3634	188	31	which	which	PRON
finefocus-3634	188	32	does	do	AUX
finefocus-3634	188	33	not	not	PART
finefocus-3634	188	34	give	give	VERB
finefocus-3634	188	35	a	a	DET
finefocus-3634	188	36	direct	direct	ADJ
finefocus-3634	188	37	measurement	measurement	NOUN
finefocus-3634	188	38	of	of	ADP
finefocus-3634	188	39	ester	ester	NOUN
finefocus-3634	188	40	linkage	linkage	NOUN
finefocus-3634	188	41	cleavage	cleavage	NOUN
finefocus-3634	188	42	.	.	PUNCT
finefocus-3634	189	1	in	in	ADP
finefocus-3634	189	2	contrast	contrast	NOUN
finefocus-3634	189	3	,	,	PUNCT
finefocus-3634	189	4	bhet	bhet	ADJ
finefocus-3634	189	5	degradation	degradation	NOUN
finefocus-3634	189	6	forms	form	NOUN
finefocus-3634	189	7	eg	eg	NOUN
finefocus-3634	189	8	and	and	CCONJ
finefocus-3634	189	9	tpa	tpa	NOUN
finefocus-3634	189	10	monomers	monomer	NOUN
finefocus-3634	189	11	to	to	PART
finefocus-3634	189	12	quantitively	quantitively	ADV
finefocus-3634	189	13	measure	measure	VERB
finefocus-3634	189	14	the	the	DET
finefocus-3634	189	15	degree	degree	NOUN
finefocus-3634	189	16	of	of	ADP
finefocus-3634	189	17	ester	ester	NOUN
finefocus-3634	189	18	linkage	linkage	NOUN
finefocus-3634	189	19	degradation	degradation	NOUN
finefocus-3634	189	20	and	and	CCONJ
finefocus-3634	189	21	allows	allow	VERB
finefocus-3634	189	22	evaluation	evaluation	NOUN
finefocus-3634	189	23	of	of	ADP
finefocus-3634	189	24	enzyme	enzyme	NOUN
finefocus-3634	189	25	’s	’s	PART
finefocus-3634	189	26	activity	activity	NOUN
finefocus-3634	189	27	more	more	ADV
finefocus-3634	189	28	effectively	effectively	ADV
finefocus-3634	189	29	.	.	PUNCT
finefocus-3634	190	1	controlled	control	VERB
finefocus-3634	190	2	experiments	experiment	NOUN
finefocus-3634	190	3	were	be	AUX
finefocus-3634	190	4	also	also	ADV
finefocus-3634	190	5	conducted	conduct	VERB
finefocus-3634	190	6	in	in	ADP
finefocus-3634	190	7	the	the	DET
finefocus-3634	190	8	presence	presence	NOUN
finefocus-3634	190	9	and	and	CCONJ
finefocus-3634	190	10	absence	absence	NOUN
finefocus-3634	190	11	of	of	ADP
finefocus-3634	190	12	pmsf	pmsf	NOUN
finefocus-3634	190	13	as	as	ADV
finefocus-3634	190	14	well	well	ADV
finefocus-3634	190	15	as	as	ADP
finefocus-3634	190	16	without	without	ADP
finefocus-3634	190	17	an	an	DET
finefocus-3634	190	18	enzyme	enzyme	NOUN
finefocus-3634	190	19	.	.	PUNCT
finefocus-3634	191	1	the	the	DET
finefocus-3634	191	2	results	result	NOUN
finefocus-3634	191	3	showed	show	VERB
finefocus-3634	191	4	that	that	SCONJ
finefocus-3634	191	5	the	the	DET
finefocus-3634	191	6	total	total	ADJ
finefocus-3634	191	7	bhet	bhet	ADJ
finefocus-3634	191	8	degradation	degradation	NOUN
finefocus-3634	191	9	to	to	ADP
finefocus-3634	191	10	eg	eg	NOUN
finefocus-3634	191	11	and	and	CCONJ
finefocus-3634	191	12	tpa	tpa	NOUN
finefocus-3634	191	13	was	be	AUX
finefocus-3634	191	14	not	not	PART
finefocus-3634	191	15	significantly	significantly	ADV
finefocus-3634	191	16	influenced	influence	VERB
finefocus-3634	191	17	by	by	ADP
finefocus-3634	191	18	the	the	DET
finefocus-3634	191	19	disulfide	disulfide	NOUN
finefocus-3634	191	20	bond	bond	NOUN
finefocus-3634	191	21	of	of	ADP
finefocus-3634	191	22	petase	petase	NOUN
finefocus-3634	191	23	,	,	PUNCT
finefocus-3634	191	24	which	which	PRON
finefocus-3634	191	25	strongly	strongly	ADV
finefocus-3634	191	26	conflicted	conflict	VERB
finefocus-3634	191	27	prior	prior	ADJ
finefocus-3634	191	28	works	work	NOUN
finefocus-3634	191	29	that	that	PRON
finefocus-3634	191	30	predicted	predict	VERB
finefocus-3634	191	31	the	the	DET
finefocus-3634	191	32	disulfide	disulfide	NOUN
finefocus-3634	191	33	bond	bond	NOUN
finefocus-3634	191	34	increased	increase	VERB
finefocus-3634	191	35	protein	protein	NOUN
finefocus-3634	191	36	activity	activity	NOUN
finefocus-3634	191	37	.	.	PUNCT
finefocus-3634	192	1	0	0	NUM
finefocus-3634	192	2	0.03	0.03	NUM
finefocus-3634	192	3	0.06	0.06	NUM
finefocus-3634	192	4	0.09	0.09	NUM
finefocus-3634	192	5	0.12	0.12	NUM
finefocus-3634	192	6	0.15	0.15	NUM
finefocus-3634	192	7	control	control	NOUN
finefocus-3634	192	8	a1	a1	NOUN
finefocus-3634	192	9	a1	a1	NOUN
finefocus-3634	192	10	+	+	NOUN
finefocus-3634	192	11	pmsf	pmsf	NOUN
finefocus-3634	192	12	a2	a2	PROPN
finefocus-3634	192	13	a2+pmsf	a2+pmsf	PROPN
finefocus-3634	192	14	b	b	PROPN
finefocus-3634	192	15	h	h	NOUN
finefocus-3634	192	16	e	e	NOUN
finefocus-3634	192	17	t	t	NOUN
finefocus-3634	192	18	/µµ	/µµ	PUNCT
finefocus-3634	193	1	g	g	NOUN
finefocus-3634	193	2	pr	pr	NOUN
finefocus-3634	193	3	ot	ot	INTJ
finefocus-3634	193	4	ei	ei	NOUN
finefocus-3634	193	5	n	n	PROPN
finefocus-3634	193	6	(	(	PUNCT
finefocus-3634	193	7	g	g	NOUN
finefocus-3634	193	8	/μ	/μ	SYM
finefocus-3634	193	9	g	g	NOUN
finefocus-3634	193	10	)	)	PUNCT
finefocus-3634	193	11	active	active	ADJ
finefocus-3634	193	12	site	site	NOUN
finefocus-3634	193	13	type	type	NOUN
finefocus-3634	193	14	figure	figure	NOUN
finefocus-3634	193	15	5	5	NUM
finefocus-3634	193	16	.	.	PUNCT
finefocus-3634	193	17	comparison	comparison	NOUN
finefocus-3634	193	18	of	of	ADP
finefocus-3634	193	19	bhet	bhet	ADJ
finefocus-3634	193	20	degradation	degradation	NOUN
finefocus-3634	193	21	per	per	ADP
finefocus-3634	193	22	microgram	microgram	NOUN
finefocus-3634	193	23	of	of	ADP
finefocus-3634	193	24	enzymes	enzyme	NOUN
finefocus-3634	193	25	in	in	ADP
finefocus-3634	193	26	the	the	DET
finefocus-3634	193	27	presence	presence	NOUN
finefocus-3634	193	28	and	and	CCONJ
finefocus-3634	193	29	absence	absence	NOUN
finefocus-3634	193	30	of	of	ADP
finefocus-3634	193	31	pmsf	pmsf	NOUN
finefocus-3634	193	32	.	.	PUNCT
finefocus-3634	194	1	control	control	NOUN
finefocus-3634	194	2	experiment	experiment	NOUN
finefocus-3634	194	3	showed	show	VERB
finefocus-3634	194	4	no	no	DET
finefocus-3634	194	5	degradation	degradation	NOUN
finefocus-3634	194	6	of	of	ADP
finefocus-3634	194	7	bhet	bhet	NOUN
finefocus-3634	194	8	.	.	PUNCT
finefocus-3634	195	1	vol	vol	NOUN
finefocus-3634	195	2	8	8	NUM
finefocus-3634	195	3	i	i	PRON
finefocus-3634	195	4	97	97	NUM
finefocus-3634	195	5	further	further	ADJ
finefocus-3634	195	6	research	research	NOUN
finefocus-3634	195	7	is	be	AUX
finefocus-3634	195	8	necessary	necessary	ADJ
finefocus-3634	195	9	to	to	PART
finefocus-3634	195	10	determine	determine	VERB
finefocus-3634	195	11	the	the	DET
finefocus-3634	195	12	cause	cause	NOUN
finefocus-3634	195	13	of	of	ADP
finefocus-3634	195	14	this	this	DET
finefocus-3634	195	15	phenomenon	phenomenon	NOUN
finefocus-3634	195	16	.	.	PUNCT
finefocus-3634	196	1	it	it	PRON
finefocus-3634	196	2	is	be	AUX
finefocus-3634	196	3	likely	likely	ADJ
finefocus-3634	196	4	that	that	SCONJ
finefocus-3634	196	5	a1	a1	PROPN
finefocus-3634	196	6	’s	’s	PART
finefocus-3634	196	7	short	short	ADJ
finefocus-3634	196	8	structure	structure	NOUN
finefocus-3634	196	9	facilitates	facilitate	VERB
finefocus-3634	196	10	easy	easy	ADJ
finefocus-3634	196	11	accessibility	accessibility	NOUN
finefocus-3634	196	12	of	of	ADP
finefocus-3634	196	13	its	its	PRON
finefocus-3634	196	14	active	active	ADJ
finefocus-3634	196	15	site	site	NOUN
finefocus-3634	196	16	to	to	PART
finefocus-3634	196	17	bhet	bhet	NOUN
finefocus-3634	196	18	in	in	ADP
finefocus-3634	196	19	the	the	DET
finefocus-3634	196	20	degradation	degradation	NOUN
finefocus-3634	196	21	process	process	NOUN
finefocus-3634	196	22	.	.	PUNCT
finefocus-3634	197	1	although	although	SCONJ
finefocus-3634	197	2	a2	a2	PROPN
finefocus-3634	197	3	may	may	AUX
finefocus-3634	197	4	be	be	AUX
finefocus-3634	197	5	more	more	ADV
finefocus-3634	197	6	stable	stable	ADJ
finefocus-3634	197	7	,	,	PUNCT
finefocus-3634	197	8	a1	a1	NOUN
finefocus-3634	197	9	has	have	VERB
finefocus-3634	197	10	the	the	DET
finefocus-3634	197	11	ability	ability	NOUN
finefocus-3634	197	12	to	to	PART
finefocus-3634	197	13	degrade	degrade	VERB
finefocus-3634	197	14	a	a	DET
finefocus-3634	197	15	greater	great	ADJ
finefocus-3634	197	16	amount	amount	NOUN
finefocus-3634	197	17	of	of	ADP
finefocus-3634	197	18	bhet	bhet	NOUN
finefocus-3634	197	19	in	in	ADP
finefocus-3634	197	20	the	the	DET
finefocus-3634	197	21	same	same	ADJ
finefocus-3634	197	22	time	time	NOUN
finefocus-3634	197	23	period	period	NOUN
finefocus-3634	197	24	.	.	PUNCT
finefocus-3634	198	1	the	the	DET
finefocus-3634	198	2	finding	finding	NOUN
finefocus-3634	198	3	of	of	ADP
finefocus-3634	198	4	this	this	DET
finefocus-3634	198	5	work	work	NOUN
finefocus-3634	198	6	that	that	PRON
finefocus-3634	198	7	removal	removal	NOUN
finefocus-3634	198	8	of	of	ADP
finefocus-3634	198	9	the	the	DET
finefocus-3634	198	10	active	active	ADJ
finefocus-3634	198	11	site	site	NOUN
finefocus-3634	198	12	disulfide	disulfide	NOUN
finefocus-3634	198	13	bond	bond	NOUN
finefocus-3634	198	14	in	in	ADP
finefocus-3634	198	15	petase	petase	NOUN
finefocus-3634	198	16	does	do	AUX
finefocus-3634	198	17	not	not	PART
finefocus-3634	198	18	have	have	AUX
finefocus-3634	198	19	an	an	DET
finefocus-3634	198	20	impact	impact	NOUN
finefocus-3634	198	21	on	on	ADP
finefocus-3634	198	22	its	its	PRON
finefocus-3634	198	23	activity	activity	NOUN
finefocus-3634	198	24	is	be	AUX
finefocus-3634	198	25	a	a	DET
finefocus-3634	198	26	stepping	stepping	ADJ
finefocus-3634	198	27	stone	stone	NOUN
finefocus-3634	198	28	in	in	ADP
finefocus-3634	198	29	designing	design	VERB
finefocus-3634	198	30	a	a	DET
finefocus-3634	198	31	more	more	ADV
finefocus-3634	198	32	effective	effective	ADJ
finefocus-3634	198	33	version	version	NOUN
finefocus-3634	198	34	of	of	ADP
finefocus-3634	198	35	the	the	DET
finefocus-3634	198	36	petase	petase	ADJ
finefocus-3634	198	37	enzyme	enzyme	NOUN
finefocus-3634	198	38	.	.	PUNCT
finefocus-3634	199	1	acknowledgements	acknowledgement	NOUN
finefocus-3634	199	2	k.s	k.s	PROPN
finefocus-3634	199	3	.	.	PUNCT
finefocus-3634	199	4	greatly	greatly	ADV
finefocus-3634	199	5	acknowledge	acknowledge	VERB
finefocus-3634	199	6	dr	dr	PROPN
finefocus-3634	199	7	.	.	PROPN
finefocus-3634	199	8	clark	clark	PROPN
finefocus-3634	199	9	gedney	gedney	NOUN
finefocus-3634	199	10	for	for	ADP
finefocus-3634	199	11	allowing	allow	VERB
finefocus-3634	199	12	to	to	PART
finefocus-3634	199	13	conduct	conduct	VERB
finefocus-3634	199	14	this	this	DET
finefocus-3634	199	15	project	project	NOUN
finefocus-3634	199	16	in	in	ADP
finefocus-3634	199	17	his	his	PRON
finefocus-3634	199	18	laboratory	laboratory	NOUN
finefocus-3634	199	19	,	,	PUNCT
finefocus-3634	199	20	acting	act	VERB
finefocus-3634	199	21	as	as	ADP
finefocus-3634	199	22	a	a	DET
finefocus-3634	199	23	mentor	mentor	NOUN
finefocus-3634	199	24	,	,	PUNCT
finefocus-3634	199	25	and	and	CCONJ
finefocus-3634	199	26	providing	provide	VERB
finefocus-3634	199	27	necessary	necessary	ADJ
finefocus-3634	199	28	resources	resource	NOUN
finefocus-3634	199	29	.	.	PUNCT
finefocus-3634	200	1	dr	dr	PROPN
finefocus-3634	200	2	.	.	PROPN
finefocus-3634	200	3	lavanya	lavanya	PROPN
finefocus-3634	200	4	reddivari	reddivari	PROPN
finefocus-3634	200	5	at	at	ADP
finefocus-3634	200	6	purdue	purdue	PROPN
finefocus-3634	200	7	university	university	PROPN
finefocus-3634	200	8	is	be	AUX
finefocus-3634	200	9	acknowledged	acknowledge	VERB
finefocus-3634	200	10	for	for	ADP
finefocus-3634	200	11	giving	give	VERB
finefocus-3634	200	12	access	access	NOUN
finefocus-3634	200	13	to	to	ADP
finefocus-3634	200	14	her	her	PRON
finefocus-3634	200	15	uplc	uplc	ADJ
finefocus-3634	200	16	instrumentation	instrumentation	NOUN
finefocus-3634	200	17	facility	facility	NOUN
finefocus-3634	200	18	for	for	ADP
finefocus-3634	200	19	the	the	DET
finefocus-3634	200	20	purpose	purpose	NOUN
finefocus-3634	200	21	of	of	ADP
finefocus-3634	200	22	analyzing	analyze	VERB
finefocus-3634	200	23	samples	sample	NOUN
finefocus-3634	200	24	.	.	PUNCT
finefocus-3634	201	1	ms	ms	PROPN
finefocus-3634	201	2	.	.	PROPN
finefocus-3634	201	3	brittany	brittany	PROPN
finefocus-3634	201	4	croy	croy	PROPN
finefocus-3634	201	5	at	at	ADP
finefocus-3634	201	6	west	west	PROPN
finefocus-3634	201	7	lafayette	lafayette	PROPN
finefocus-3634	201	8	jr	jr	PROPN
finefocus-3634	201	9	/	/	SYM
finefocus-3634	201	10	sr	sr	PROPN
finefocus-3634	201	11	.	.	PUNCT
finefocus-3634	202	1	high	high	ADJ
finefocus-3634	202	2	school	school	NOUN
finefocus-3634	202	3	is	be	AUX
finefocus-3634	202	4	acknowledged	acknowledge	VERB
finefocus-3634	202	5	for	for	ADP
finefocus-3634	202	6	acting	act	VERB
finefocus-3634	202	7	as	as	ADP
finefocus-3634	202	8	a	a	DET
finefocus-3634	202	9	mentor	mentor	NOUN
finefocus-3634	202	10	of	of	ADP
finefocus-3634	202	11	k.s	k.s	PROPN
finefocus-3634	202	12	.	.	PROPN
finefocus-3634	202	13	in	in	ADP
finefocus-3634	202	14	this	this	DET
finefocus-3634	202	15	project	project	NOUN
finefocus-3634	202	16	,	,	PUNCT
finefocus-3634	202	17	which	which	PRON
finefocus-3634	202	18	was	be	AUX
finefocus-3634	202	19	submitted	submit	VERB
finefocus-3634	202	20	to	to	ADP
finefocus-3634	202	21	the	the	DET
finefocus-3634	202	22	international	international	ADJ
finefocus-3634	202	23	science	science	NOUN
finefocus-3634	202	24	and	and	CCONJ
finefocus-3634	202	25	engineering	engineering	NOUN
finefocus-3634	202	26	fair	fair	ADJ
finefocus-3634	202	27	(	(	PUNCT
finefocus-3634	202	28	isef	isef	NOUN
finefocus-3634	202	29	)	)	PUNCT
finefocus-3634	202	30	.	.	PUNCT
finefocus-3634	203	1	98	98	NUM
finefocus-3634	204	1	i	i	PRON
finefocus-3634	204	2	fine	fine	ADJ
finefocus-3634	204	3	focus	focus	NOUN
finefocus-3634	204	4	references	reference	NOUN
finefocus-3634	204	5	1	1	NUM
finefocus-3634	204	6	.	.	PUNCT
finefocus-3634	205	1	austin	austin	PROPN
finefocus-3634	205	2	,	,	PUNCT
finefocus-3634	205	3	h.	h.	PROPN
finefocus-3634	205	4	p.	p.	PROPN
finefocus-3634	205	5	,	,	PUNCT
finefocus-3634	205	6	allen	allen	PROPN
finefocus-3634	205	7	,	,	PUNCT
finefocus-3634	205	8	m.	m.	PROPN
finefocus-3634	205	9	d.	d.	PROPN
finefocus-3634	205	10	,	,	PUNCT
finefocus-3634	205	11	donohoe	donohoe	PROPN
finefocus-3634	205	12	,	,	PUNCT
finefocus-3634	205	13	b.	b.	PROPN
finefocus-3634	205	14	s.	s.	PROPN
finefocus-3634	205	15	,	,	PUNCT
finefocus-3634	205	16	rorrer	rorrer	NOUN
finefocus-3634	205	17	,	,	PUNCT
finefocus-3634	205	18	n.	n.	PROPN
finefocus-3634	205	19	a.	a.	PROPN
finefocus-3634	205	20	,	,	PUNCT
finefocus-3634	205	21	kearns	kearns	PROPN
finefocus-3634	205	22	,	,	PUNCT
finefocus-3634	205	23	f.	f.	PROPN
finefocus-3634	205	24	l.	l.	PROPN
finefocus-3634	205	25	,	,	PUNCT
finefocus-3634	205	26	silveira	silveira	PROPN
finefocus-3634	205	27	,	,	PUNCT
finefocus-3634	205	28	r.	r.	PROPN
finefocus-3634	205	29	l.	l.	PROPN
finefocus-3634	205	30	,	,	PUNCT
finefocus-3634	205	31	pollard	pollard	PROPN
finefocus-3634	205	32	,	,	PUNCT
finefocus-3634	205	33	b.	b.	PROPN
finefocus-3634	205	34	c.	c.	PROPN
finefocus-3634	205	35	,	,	PUNCT
finefocus-3634	205	36	dominick	dominick	PROPN
finefocus-3634	205	37	,	,	PUNCT
finefocus-3634	205	38	g.	g.	PROPN
finefocus-3634	205	39	,	,	PUNCT
finefocus-3634	205	40	duman	duman	PROPN
finefocus-3634	205	41	,	,	PUNCT
finefocus-3634	205	42	r.	r.	PROPN
finefocus-3634	205	43	,	,	PUNCT
finefocus-3634	205	44	&	&	CCONJ
finefocus-3634	205	45	el	el	PROPN
finefocus-3634	205	46	omari	omari	PROPN
finefocus-3634	205	47	,	,	PUNCT
finefocus-3634	205	48	k.	k.	PROPN
finefocus-3634	205	49	(	(	PUNCT
finefocus-3634	205	50	2018	2018	NUM
finefocus-3634	205	51	)	)	PUNCT
finefocus-3634	205	52	.	.	PUNCT
finefocus-3634	206	1	characterization	characterization	NOUN
finefocus-3634	206	2	and	and	CCONJ
finefocus-3634	206	3	engineering	engineering	NOUN
finefocus-3634	206	4	of	of	ADP
finefocus-3634	206	5	a	a	DET
finefocus-3634	206	6	plastic	plastic	NOUN
finefocus-3634	206	7	-	-	PUNCT
finefocus-3634	206	8	degrading	degrade	VERB
finefocus-3634	206	9	aromatic	aromatic	ADJ
finefocus-3634	206	10	polyesterase	polyesterase	NOUN
finefocus-3634	206	11	.	.	PUNCT
finefocus-3634	207	1	proceedings	proceeding	NOUN
finefocus-3634	207	2	of	of	ADP
finefocus-3634	207	3	the	the	DET
finefocus-3634	207	4	national	national	PROPN
finefocus-3634	207	5	academy	academy	PROPN
finefocus-3634	207	6	of	of	ADP
finefocus-3634	207	7	sciences	sciences	PROPN
finefocus-3634	207	8	,	,	PUNCT
finefocus-3634	207	9	115(19	115(19	NUM
finefocus-3634	207	10	)	)	PUNCT
finefocus-3634	207	11	,	,	PUNCT
finefocus-3634	207	12	e4350	e4350	PROPN
finefocus-3634	207	13	-	-	PUNCT
finefocus-3634	207	14	e4357	e4357	PROPN
finefocus-3634	207	15	.	.	PUNCT
finefocus-3634	208	1	2	2	X
finefocus-3634	208	2	.	.	X
finefocus-3634	208	3	chen	chen	PROPN
finefocus-3634	208	4	,	,	PUNCT
finefocus-3634	208	5	c.	c.	PROPN
finefocus-3634	208	6	c.	c.	PROPN
finefocus-3634	208	7	,	,	PUNCT
finefocus-3634	208	8	han	han	PROPN
finefocus-3634	208	9	,	,	PUNCT
finefocus-3634	208	10	x.	x.	PROPN
finefocus-3634	208	11	,	,	PUNCT
finefocus-3634	208	12	ko	ko	PROPN
finefocus-3634	208	13	,	,	PUNCT
finefocus-3634	208	14	t.	t.	PROPN
finefocus-3634	208	15	p.	p.	PROPN
finefocus-3634	208	16	,	,	PUNCT
finefocus-3634	208	17	liu	liu	PROPN
finefocus-3634	208	18	,	,	PUNCT
finefocus-3634	208	19	w.	w.	PROPN
finefocus-3634	208	20	,	,	PUNCT
finefocus-3634	208	21	&	&	CCONJ
finefocus-3634	208	22	guo	guo	PROPN
finefocus-3634	208	23	,	,	PUNCT
finefocus-3634	208	24	r.	r.	PROPN
finefocus-3634	208	25	t.	t.	PROPN
finefocus-3634	208	26	(	(	PUNCT
finefocus-3634	208	27	2018	2018	NUM
finefocus-3634	208	28	)	)	PUNCT
finefocus-3634	208	29	.	.	PUNCT
finefocus-3634	209	1	structural	structural	ADJ
finefocus-3634	209	2	studies	study	NOUN
finefocus-3634	209	3	reveal	reveal	VERB
finefocus-3634	209	4	the	the	DET
finefocus-3634	209	5	molecular	molecular	ADJ
finefocus-3634	209	6	mechanism	mechanism	NOUN
finefocus-3634	209	7	of	of	ADP
finefocus-3634	209	8	petase	petase	NOUN
finefocus-3634	209	9	.	.	PUNCT
finefocus-3634	210	1	the	the	DET
finefocus-3634	210	2	febs	febs	NOUN
finefocus-3634	210	3	journal	journal	NOUN
finefocus-3634	210	4	,	,	PUNCT
finefocus-3634	210	5	285(20	285(20	NUM
finefocus-3634	210	6	)	)	PUNCT
finefocus-3634	210	7	,	,	PUNCT
finefocus-3634	210	8	3717	3717	NUM
finefocus-3634	210	9	-	-	SYM
finefocus-3634	210	10	3723	3723	NUM
finefocus-3634	210	11	.	.	PUNCT
finefocus-3634	211	1	3	3	X
finefocus-3634	211	2	.	.	X
finefocus-3634	211	3	fecker	fecker	NOUN
finefocus-3634	211	4	,	,	PUNCT
finefocus-3634	211	5	t.	t.	PROPN
finefocus-3634	211	6	,	,	PUNCT
finefocus-3634	211	7	galaz	galaz	NOUN
finefocus-3634	211	8	-	-	PUNCT
finefocus-3634	211	9	davison	davison	PROPN
finefocus-3634	211	10	,	,	PUNCT
finefocus-3634	211	11	p.	p.	NOUN
finefocus-3634	211	12	,	,	PUNCT
finefocus-3634	211	13	engelberger	engelberger	NOUN
finefocus-3634	211	14	,	,	PUNCT
finefocus-3634	211	15	f.	f.	PROPN
finefocus-3634	211	16	,	,	PUNCT
finefocus-3634	211	17	narui	narui	PROPN
finefocus-3634	211	18	,	,	PUNCT
finefocus-3634	211	19	y.	y.	PROPN
finefocus-3634	211	20	,	,	PUNCT
finefocus-3634	211	21	sotomayor	sotomayor	PROPN
finefocus-3634	211	22	,	,	PUNCT
finefocus-3634	211	23	m.	m.	NOUN
finefocus-3634	211	24	,	,	PUNCT
finefocus-3634	211	25	parra	parra	PROPN
finefocus-3634	211	26	,	,	PUNCT
finefocus-3634	211	27	l.	l.	PROPN
finefocus-3634	211	28	p.	p.	PROPN
finefocus-3634	211	29	,	,	PUNCT
finefocus-3634	211	30	&	&	CCONJ
finefocus-3634	211	31	ramírez	ramírez	PROPN
finefocus-3634	211	32	-	-	PUNCT
finefocus-3634	211	33	sarmiento	sarmiento	NOUN
finefocus-3634	211	34	,	,	PUNCT
finefocus-3634	211	35	c.	c.	PROPN
finefocus-3634	211	36	a.	a.	PROPN
finefocus-3634	211	37	(	(	PUNCT
finefocus-3634	211	38	2018	2018	NUM
finefocus-3634	211	39	)	)	PUNCT
finefocus-3634	211	40	.	.	PUNCT
finefocus-3634	212	1	active	active	ADJ
finefocus-3634	212	2	site	site	NOUN
finefocus-3634	212	3	flexibility	flexibility	NOUN
finefocus-3634	212	4	as	as	ADP
finefocus-3634	212	5	a	a	DET
finefocus-3634	212	6	hallmark	hallmark	NOUN
finefocus-3634	212	7	for	for	ADP
finefocus-3634	212	8	efficient	efficient	ADJ
finefocus-3634	212	9	pet	pet	NOUN
finefocus-3634	212	10	degradation	degradation	NOUN
finefocus-3634	212	11	by	by	ADP
finefocus-3634	212	12	i.	i.	NOUN
finefocus-3634	212	13	sakaiensis	sakaiensis	NOUN
finefocus-3634	212	14	petase	petase	ADV
finefocus-3634	212	15	.	.	PUNCT
finefocus-3634	213	1	biophysical	biophysical	ADJ
finefocus-3634	213	2	journal	journal	NOUN
finefocus-3634	213	3	,	,	PUNCT
finefocus-3634	213	4	114(6	114(6	NUM
finefocus-3634	213	5	)	)	PUNCT
finefocus-3634	213	6	,	,	PUNCT
finefocus-3634	213	7	1302	1302	NUM
finefocus-3634	213	8	-	-	SYM
finefocus-3634	213	9	1312	1312	NUM
finefocus-3634	213	10	.	.	PUNCT
finefocus-3634	214	1	4	4	NUM
finefocus-3634	214	2	.	.	X
finefocus-3634	214	3	furukawa	furukawa	PROPN
finefocus-3634	214	4	,	,	PUNCT
finefocus-3634	214	5	m.	m.	NOUN
finefocus-3634	214	6	,	,	PUNCT
finefocus-3634	214	7	kawakami	kawakami	PROPN
finefocus-3634	214	8	,	,	PUNCT
finefocus-3634	214	9	n.	n.	PROPN
finefocus-3634	214	10	,	,	PUNCT
finefocus-3634	214	11	tomizawa	tomizawa	PROPN
finefocus-3634	214	12	,	,	PUNCT
finefocus-3634	214	13	a.	a.	NOUN
finefocus-3634	214	14	,	,	PUNCT
finefocus-3634	214	15	&	&	CCONJ
finefocus-3634	214	16	miyamoto	miyamoto	PROPN
finefocus-3634	214	17	,	,	PUNCT
finefocus-3634	214	18	k.	k.	PROPN
finefocus-3634	214	19	(	(	PUNCT
finefocus-3634	214	20	2019	2019	NUM
finefocus-3634	214	21	)	)	PUNCT
finefocus-3634	214	22	.	.	PUNCT
finefocus-3634	215	1	efficient	efficient	ADJ
finefocus-3634	215	2	degradation	degradation	NOUN
finefocus-3634	215	3	of	of	ADP
finefocus-3634	215	4	poly	poly	ADJ
finefocus-3634	215	5	(	(	PUNCT
finefocus-3634	215	6	ethylene	ethylene	NOUN
finefocus-3634	215	7	terephthalate	terephthalate	NOUN
finefocus-3634	215	8	)	)	PUNCT
finefocus-3634	215	9	with	with	ADP
finefocus-3634	215	10	thermobifida	thermobifida	PROPN
finefocus-3634	215	11	fusca	fusca	ADJ
finefocus-3634	215	12	cutinase	cutinase	NOUN
finefocus-3634	215	13	exhibiting	exhibit	VERB
finefocus-3634	215	14	improved	improved	ADJ
finefocus-3634	215	15	catalytic	catalytic	ADJ
finefocus-3634	215	16	activity	activity	NOUN
finefocus-3634	215	17	generated	generate	VERB
finefocus-3634	215	18	using	use	VERB
finefocus-3634	215	19	mutagenesis	mutagenesis	NOUN
finefocus-3634	215	20	and	and	CCONJ
finefocus-3634	215	21	additive	additive	NOUN
finefocus-3634	215	22	-	-	PUNCT
finefocus-3634	215	23	based	base	VERB
finefocus-3634	215	24	approaches	approach	NOUN
finefocus-3634	215	25	.	.	PUNCT
finefocus-3634	216	1	scientific	scientific	ADJ
finefocus-3634	216	2	reports	report	NOUN
finefocus-3634	216	3	,	,	PUNCT
finefocus-3634	216	4	9(1	9(1	NUM
finefocus-3634	216	5	)	)	PUNCT
finefocus-3634	216	6	,	,	PUNCT
finefocus-3634	216	7	1	1	NUM
finefocus-3634	216	8	-	-	SYM
finefocus-3634	216	9	9	9	NUM
finefocus-3634	216	10	.	.	NOUN
finefocus-3634	216	11	5	5	NUM
finefocus-3634	216	12	.	.	X
finefocus-3634	216	13	herrero	herrero	PROPN
finefocus-3634	216	14	acero	acero	PROPN
finefocus-3634	216	15	,	,	PUNCT
finefocus-3634	216	16	e.	e.	PROPN
finefocus-3634	216	17	,	,	PUNCT
finefocus-3634	216	18	ribitsch	ribitsch	PROPN
finefocus-3634	216	19	,	,	PUNCT
finefocus-3634	216	20	d.	d.	PROPN
finefocus-3634	216	21	,	,	PUNCT
finefocus-3634	216	22	steinkellner	steinkellner	NOUN
finefocus-3634	216	23	,	,	PUNCT
finefocus-3634	216	24	g.	g.	PROPN
finefocus-3634	216	25	,	,	PUNCT
finefocus-3634	216	26	gruber	gruber	PROPN
finefocus-3634	216	27	,	,	PUNCT
finefocus-3634	216	28	k.	k.	PROPN
finefocus-3634	216	29	,	,	PUNCT
finefocus-3634	216	30	greimel	greimel	PROPN
finefocus-3634	216	31	,	,	PUNCT
finefocus-3634	216	32	k.	k.	PROPN
finefocus-3634	216	33	,	,	PUNCT
finefocus-3634	216	34	eiteljoerg	eiteljoerg	PROPN
finefocus-3634	216	35	,	,	PUNCT
finefocus-3634	216	36	i.	i.	PROPN
finefocus-3634	216	37	,	,	PUNCT
finefocus-3634	216	38	trotscha	trotscha	ADV
finefocus-3634	216	39	,	,	PUNCT
finefocus-3634	216	40	e.	e.	PROPN
finefocus-3634	216	41	,	,	PUNCT
finefocus-3634	216	42	wei	wei	PROPN
finefocus-3634	216	43	,	,	PUNCT
finefocus-3634	216	44	r.	r.	PROPN
finefocus-3634	216	45	,	,	PUNCT
finefocus-3634	216	46	zimmermann	zimmermann	PROPN
finefocus-3634	216	47	,	,	PUNCT
finefocus-3634	216	48	w.	w.	PROPN
finefocus-3634	216	49	,	,	PUNCT
finefocus-3634	216	50	&	&	CCONJ
finefocus-3634	216	51	zinn	zinn	PROPN
finefocus-3634	216	52	,	,	PUNCT
finefocus-3634	216	53	m.	m.	NOUN
finefocus-3634	216	54	(	(	PUNCT
finefocus-3634	216	55	2011	2011	NUM
finefocus-3634	216	56	)	)	PUNCT
finefocus-3634	216	57	.	.	PUNCT
finefocus-3634	217	1	enzymatic	enzymatic	ADJ
finefocus-3634	217	2	surface	surface	NOUN
finefocus-3634	217	3	hydrolysis	hydrolysis	NOUN
finefocus-3634	217	4	of	of	ADP
finefocus-3634	217	5	pet	pet	NOUN
finefocus-3634	217	6	:	:	PUNCT
finefocus-3634	217	7	effect	effect	NOUN
finefocus-3634	217	8	of	of	ADP
finefocus-3634	217	9	structural	structural	ADJ
finefocus-3634	217	10	diversity	diversity	NOUN
finefocus-3634	217	11	on	on	ADP
finefocus-3634	217	12	kinetic	kinetic	ADJ
finefocus-3634	217	13	properties	property	NOUN
finefocus-3634	217	14	of	of	ADP
finefocus-3634	217	15	cutinases	cutinase	NOUN
finefocus-3634	217	16	from	from	ADP
finefocus-3634	217	17	thermobifida	thermobifida	NOUN
finefocus-3634	217	18	.	.	PUNCT
finefocus-3634	218	1	macromolecules	macromolecule	NOUN
finefocus-3634	218	2	,	,	PUNCT
finefocus-3634	218	3	44(12	44(12	NUM
finefocus-3634	218	4	)	)	PUNCT
finefocus-3634	218	5	,	,	PUNCT
finefocus-3634	218	6	4632	4632	NUM
finefocus-3634	218	7	-	-	SYM
finefocus-3634	218	8	4640	4640	NUM
finefocus-3634	218	9	.	.	PUNCT
finefocus-3634	219	1	6	6	NUM
finefocus-3634	219	2	.	.	X
finefocus-3634	219	3	hu	hu	PROPN
finefocus-3634	219	4	,	,	PUNCT
finefocus-3634	219	5	x.	x.	NOUN
finefocus-3634	219	6	,	,	PUNCT
finefocus-3634	219	7	osaki	osaki	PROPN
finefocus-3634	219	8	,	,	PUNCT
finefocus-3634	219	9	s.	s.	PROPN
finefocus-3634	219	10	,	,	PUNCT
finefocus-3634	219	11	hayashi	hayashi	PROPN
finefocus-3634	219	12	,	,	PUNCT
finefocus-3634	219	13	m.	m.	NOUN
finefocus-3634	219	14	,	,	PUNCT
finefocus-3634	219	15	kaku	kaku	PROPN
finefocus-3634	219	16	,	,	PUNCT
finefocus-3634	219	17	m.	m.	NOUN
finefocus-3634	219	18	,	,	PUNCT
finefocus-3634	219	19	katuen	katuen	PROPN
finefocus-3634	219	20	,	,	PUNCT
finefocus-3634	219	21	s.	s.	PROPN
finefocus-3634	219	22	,	,	PUNCT
finefocus-3634	219	23	kobayashi	kobayashi	PROPN
finefocus-3634	219	24	,	,	PUNCT
finefocus-3634	219	25	h.	h.	PROPN
finefocus-3634	219	26	,	,	PUNCT
finefocus-3634	219	27	&	&	CCONJ
finefocus-3634	219	28	kawai	kawai	PROPN
finefocus-3634	219	29	,	,	PUNCT
finefocus-3634	219	30	f.	f.	PROPN
finefocus-3634	219	31	(	(	PUNCT
finefocus-3634	219	32	2008	2008	NUM
finefocus-3634	219	33	)	)	PUNCT
finefocus-3634	219	34	.	.	PUNCT
finefocus-3634	220	1	degradation	degradation	NOUN
finefocus-3634	220	2	of	of	ADP
finefocus-3634	220	3	a	a	DET
finefocus-3634	220	4	terephthalate	terephthalate	NOUN
finefocus-3634	220	5	-	-	PUNCT
finefocus-3634	220	6	containing	contain	VERB
finefocus-3634	220	7	polyester	polyester	NOUN
finefocus-3634	220	8	by	by	ADP
finefocus-3634	220	9	thermophilic	thermophilic	ADJ
finefocus-3634	220	10	actinomycetes	actinomycete	NOUN
finefocus-3634	220	11	and	and	CCONJ
finefocus-3634	220	12	bacillus	bacillus	NOUN
finefocus-3634	220	13	species	specie	NOUN
finefocus-3634	220	14	derived	derive	VERB
finefocus-3634	220	15	from	from	ADP
finefocus-3634	220	16	composts	compost	NOUN
finefocus-3634	220	17	.	.	PUNCT
finefocus-3634	221	1	journal	journal	NOUN
finefocus-3634	221	2	of	of	ADP
finefocus-3634	221	3	polymers	polymer	NOUN
finefocus-3634	221	4	and	and	CCONJ
finefocus-3634	221	5	the	the	DET
finefocus-3634	221	6	environment	environment	NOUN
finefocus-3634	221	7	,	,	PUNCT
finefocus-3634	221	8	16(2	16(2	NUM
finefocus-3634	221	9	)	)	PUNCT
finefocus-3634	221	10	,	,	PUNCT
finefocus-3634	221	11	103	103	NUM
finefocus-3634	221	12	-	-	SYM
finefocus-3634	221	13	108	108	NUM
finefocus-3634	221	14	.	.	PUNCT
finefocus-3634	222	1	7	7	NUM
finefocus-3634	222	2	.	.	X
finefocus-3634	222	3	jones	jones	PROPN
finefocus-3634	222	4	,	,	PUNCT
finefocus-3634	222	5	s.	s.	PROPN
finefocus-3634	222	6	m.	m.	PROPN
finefocus-3634	222	7	,	,	PUNCT
finefocus-3634	222	8	&	&	CCONJ
finefocus-3634	222	9	solomon	solomon	PROPN
finefocus-3634	222	10	,	,	PUNCT
finefocus-3634	222	11	e.	e.	PROPN
finefocus-3634	222	12	i.	i.	PROPN
finefocus-3634	222	13	(	(	PUNCT
finefocus-3634	222	14	2015	2015	NUM
finefocus-3634	222	15	)	)	PUNCT
finefocus-3634	222	16	.	.	PUNCT
finefocus-3634	223	1	electron	electron	NOUN
finefocus-3634	223	2	transfer	transfer	NOUN
finefocus-3634	223	3	and	and	CCONJ
finefocus-3634	223	4	reaction	reaction	NOUN
finefocus-3634	223	5	mechanism	mechanism	NOUN
finefocus-3634	223	6	of	of	ADP
finefocus-3634	223	7	laccases	laccase	NOUN
finefocus-3634	223	8	.	.	PUNCT
finefocus-3634	224	1	cellular	cellular	ADJ
finefocus-3634	224	2	and	and	CCONJ
finefocus-3634	224	3	molecular	molecular	ADJ
finefocus-3634	224	4	life	life	NOUN
finefocus-3634	224	5	sciences	science	NOUN
finefocus-3634	224	6	,	,	PUNCT
finefocus-3634	224	7	72(5	72(5	NOUN
finefocus-3634	224	8	)	)	PUNCT
finefocus-3634	224	9	,	,	PUNCT
finefocus-3634	224	10	869	869	NUM
finefocus-3634	224	11	-	-	SYM
finefocus-3634	224	12	883	883	NUM
finefocus-3634	224	13	.	.	NOUN
finefocus-3634	224	14	8	8	NUM
finefocus-3634	224	15	.	.	PUNCT
finefocus-3634	224	16	kawai	kawai	PROPN
finefocus-3634	224	17	,	,	PUNCT
finefocus-3634	224	18	f.	f.	PROPN
finefocus-3634	224	19	,	,	PUNCT
finefocus-3634	224	20	kawabata	kawabata	PROPN
finefocus-3634	224	21	,	,	PUNCT
finefocus-3634	224	22	t.	t.	PROPN
finefocus-3634	224	23	,	,	PUNCT
finefocus-3634	224	24	&	&	CCONJ
finefocus-3634	224	25	oda	oda	PROPN
finefocus-3634	224	26	,	,	PUNCT
finefocus-3634	224	27	m.	m.	NOUN
finefocus-3634	224	28	(	(	PUNCT
finefocus-3634	224	29	2019	2019	NUM
finefocus-3634	224	30	)	)	PUNCT
finefocus-3634	224	31	.	.	PUNCT
finefocus-3634	225	1	current	current	ADJ
finefocus-3634	225	2	knowledge	knowledge	NOUN
finefocus-3634	225	3	on	on	ADP
finefocus-3634	225	4	enzymatic	enzymatic	ADJ
finefocus-3634	225	5	pet	pet	ADJ
finefocus-3634	225	6	degradation	degradation	NOUN
finefocus-3634	225	7	and	and	CCONJ
finefocus-3634	225	8	its	its	PRON
finefocus-3634	225	9	possible	possible	ADJ
finefocus-3634	225	10	application	application	NOUN
finefocus-3634	225	11	to	to	PART
finefocus-3634	225	12	waste	waste	VERB
finefocus-3634	225	13	stream	stream	NOUN
finefocus-3634	225	14	management	management	NOUN
finefocus-3634	225	15	and	and	CCONJ
finefocus-3634	225	16	other	other	ADJ
finefocus-3634	225	17	fields	field	NOUN
finefocus-3634	225	18	.	.	PUNCT
finefocus-3634	226	1	applied	apply	VERB
finefocus-3634	226	2	microbiology	microbiology	NOUN
finefocus-3634	226	3	and	and	CCONJ
finefocus-3634	226	4	biotechnology	biotechnology	NOUN
finefocus-3634	226	5	,	,	PUNCT
finefocus-3634	226	6	103(11	103(11	NUM
finefocus-3634	226	7	)	)	PUNCT
finefocus-3634	226	8	,	,	PUNCT
finefocus-3634	226	9	4253	4253	NUM
finefocus-3634	226	10	-	-	SYM
finefocus-3634	226	11	4268	4268	NUM
finefocus-3634	226	12	.	.	PUNCT
finefocus-3634	227	1	9	9	X
finefocus-3634	227	2	.	.	X
finefocus-3634	227	3	kawai	kawai	PROPN
finefocus-3634	227	4	,	,	PUNCT
finefocus-3634	227	5	f.	f.	PROPN
finefocus-3634	227	6	,	,	PUNCT
finefocus-3634	227	7	kawabata	kawabata	PROPN
finefocus-3634	227	8	,	,	PUNCT
finefocus-3634	227	9	t.	t.	PROPN
finefocus-3634	227	10	,	,	PUNCT
finefocus-3634	227	11	&	&	CCONJ
finefocus-3634	227	12	oda	oda	PROPN
finefocus-3634	227	13	,	,	PUNCT
finefocus-3634	227	14	m.	m.	NOUN
finefocus-3634	227	15	(	(	PUNCT
finefocus-3634	227	16	2020	2020	NUM
finefocus-3634	227	17	)	)	PUNCT
finefocus-3634	227	18	.	.	PUNCT
finefocus-3634	228	1	current	current	ADJ
finefocus-3634	228	2	state	state	NOUN
finefocus-3634	228	3	and	and	CCONJ
finefocus-3634	228	4	perspectives	perspective	NOUN
finefocus-3634	228	5	related	relate	VERB
finefocus-3634	228	6	to	to	ADP
finefocus-3634	228	7	the	the	DET
finefocus-3634	228	8	polyethylene	polyethylene	NOUN
finefocus-3634	228	9	terephthalate	terephthalate	NOUN
finefocus-3634	228	10	hydrolases	hydrolase	NOUN
finefocus-3634	228	11	available	available	ADJ
finefocus-3634	228	12	for	for	ADP
finefocus-3634	228	13	biorecycling	biorecycle	VERB
finefocus-3634	228	14	.	.	PUNCT
finefocus-3634	229	1	acs	acs	PROPN
finefocus-3634	229	2	sustainable	sustainable	ADJ
finefocus-3634	229	3	chemistry	chemistry	NOUN
finefocus-3634	229	4	&	&	CCONJ
finefocus-3634	229	5	engineering	engineering	PROPN
finefocus-3634	229	6	,	,	PUNCT
finefocus-3634	229	7	8(24	8(24	NUM
finefocus-3634	229	8	)	)	PUNCT
finefocus-3634	229	9	,	,	PUNCT
finefocus-3634	229	10	88948908	88948908	NUM
finefocus-3634	229	11	.	.	PUNCT
finefocus-3634	230	1	https://doi.org/10.1021/acssuschemeng.0c01638	https://doi.org/10.1021/acssuschemeng.0c01638	PROPN
finefocus-3634	230	2	10	10	NUM
finefocus-3634	230	3	.	.	PUNCT
finefocus-3634	231	1	khoonkari	khoonkari	PROPN
finefocus-3634	231	2	,	,	PUNCT
finefocus-3634	231	3	m.	m.	NOUN
finefocus-3634	231	4	,	,	PUNCT
finefocus-3634	231	5	haghighi	haghighi	PROPN
finefocus-3634	231	6	,	,	PUNCT
finefocus-3634	231	7	a.	a.	PROPN
finefocus-3634	231	8	h.	h.	PROPN
finefocus-3634	231	9	,	,	PUNCT
finefocus-3634	231	10	sefidbakht	sefidbakht	NOUN
finefocus-3634	231	11	,	,	PUNCT
finefocus-3634	231	12	y.	y.	PROPN
finefocus-3634	231	13	,	,	PUNCT
finefocus-3634	231	14	shekoohi	shekoohi	PROPN
finefocus-3634	231	15	,	,	PUNCT
finefocus-3634	231	16	k.	k.	PROPN
finefocus-3634	231	17	,	,	PUNCT
finefocus-3634	231	18	&	&	CCONJ
finefocus-3634	231	19	ghaderian	ghaderian	PROPN
finefocus-3634	231	20	,	,	PUNCT
finefocus-3634	231	21	a.	a.	NOUN
finefocus-3634	231	22	(	(	PUNCT
finefocus-3634	231	23	2015	2015	NUM
finefocus-3634	231	24	)	)	PUNCT
finefocus-3634	231	25	.	.	PUNCT
finefocus-3634	232	1	chemical	chemical	NOUN
finefocus-3634	232	2	recycling	recycling	NOUN
finefocus-3634	232	3	of	of	ADP
finefocus-3634	232	4	pet	pet	ADJ
finefocus-3634	232	5	wastes	waste	NOUN
finefocus-3634	232	6	with	with	ADP
finefocus-3634	232	7	different	different	ADJ
finefocus-3634	232	8	catalysts	catalyst	NOUN
finefocus-3634	232	9	.	.	PUNCT
finefocus-3634	233	1	international	international	ADJ
finefocus-3634	233	2	journal	journal	NOUN
finefocus-3634	233	3	of	of	ADP
finefocus-3634	233	4	polymer	polymer	NOUN
finefocus-3634	233	5	science	science	NOUN
finefocus-3634	233	6	,	,	PUNCT
finefocus-3634	233	7	2015	2015	NUM
finefocus-3634	233	8	.	.	PUNCT
finefocus-3634	234	1	11	11	NUM
finefocus-3634	234	2	.	.	X
finefocus-3634	235	1	ma	ma	PROPN
finefocus-3634	235	2	,	,	PUNCT
finefocus-3634	235	3	y.	y.	PROPN
finefocus-3634	235	4	,	,	PUNCT
finefocus-3634	235	5	yao	yao	PROPN
finefocus-3634	235	6	,	,	PUNCT
finefocus-3634	235	7	m.	m.	NOUN
finefocus-3634	235	8	,	,	PUNCT
finefocus-3634	235	9	li	li	PROPN
finefocus-3634	235	10	,	,	PUNCT
finefocus-3634	235	11	b.	b.	PROPN
finefocus-3634	235	12	,	,	PUNCT
finefocus-3634	235	13	ding	ding	NOUN
finefocus-3634	235	14	,	,	PUNCT
finefocus-3634	235	15	m.	m.	NOUN
finefocus-3634	235	16	,	,	PUNCT
finefocus-3634	235	17	he	he	PRON
finefocus-3634	235	18	,	,	PUNCT
finefocus-3634	235	19	b.	b.	PROPN
finefocus-3634	235	20	,	,	PUNCT
finefocus-3634	235	21	chen	chen	PROPN
finefocus-3634	235	22	,	,	PUNCT
finefocus-3634	235	23	s.	s.	PROPN
finefocus-3634	235	24	,	,	PUNCT
finefocus-3634	235	25	zhou	zhou	PROPN
finefocus-3634	235	26	,	,	PUNCT
finefocus-3634	235	27	x.	x.	NOUN
finefocus-3634	235	28	,	,	PUNCT
finefocus-3634	235	29	&	&	CCONJ
finefocus-3634	235	30	yuan	yuan	PROPN
finefocus-3634	235	31	,	,	PUNCT
finefocus-3634	235	32	y.	y.	PROPN
finefocus-3634	235	33	(	(	PUNCT
finefocus-3634	235	34	2018	2018	NUM
finefocus-3634	235	35	)	)	PUNCT
finefocus-3634	235	36	.	.	PUNCT
finefocus-3634	236	1	enhanced	enhance	VERB
finefocus-3634	236	2	poly	poly	ADJ
finefocus-3634	236	3	(	(	PUNCT
finefocus-3634	236	4	ethylene	ethylene	NOUN
finefocus-3634	236	5	terephthalate	terephthalate	NOUN
finefocus-3634	236	6	)	)	PUNCT
finefocus-3634	236	7	hydrolase	hydrolase	NOUN
finefocus-3634	236	8	activity	activity	NOUN
finefocus-3634	236	9	by	by	ADP
finefocus-3634	236	10	protein	protein	NOUN
finefocus-3634	236	11	engineering	engineering	NOUN
finefocus-3634	236	12	.	.	PUNCT
finefocus-3634	237	1	engineering	engineering	NOUN
finefocus-3634	237	2	,	,	PUNCT
finefocus-3634	237	3	4(6	4(6	NUM
finefocus-3634	237	4	)	)	PUNCT
finefocus-3634	237	5	,	,	PUNCT
finefocus-3634	237	6	888	888	NUM
finefocus-3634	237	7	-	-	SYM
finefocus-3634	237	8	893	893	NUM
finefocus-3634	237	9	.	.	PUNCT
finefocus-3634	238	1	12	12	NUM
finefocus-3634	238	2	.	.	PUNCT
finefocus-3634	239	1	müller	müller	PROPN
finefocus-3634	239	2	,	,	PUNCT
finefocus-3634	239	3	r.	r.	PROPN
finefocus-3634	239	4	j.	j.	PROPN
finefocus-3634	239	5	,	,	PUNCT
finefocus-3634	239	6	schrader	schrader	PROPN
finefocus-3634	239	7	,	,	PUNCT
finefocus-3634	239	8	h.	h.	PROPN
finefocus-3634	239	9	,	,	PUNCT
finefocus-3634	239	10	profe	profe	PROPN
finefocus-3634	239	11	,	,	PUNCT
finefocus-3634	239	12	j.	j.	PROPN
finefocus-3634	239	13	,	,	PUNCT
finefocus-3634	239	14	dresler	dresler	NOUN
finefocus-3634	239	15	,	,	PUNCT
finefocus-3634	239	16	k.	k.	PROPN
finefocus-3634	239	17	,	,	PUNCT
finefocus-3634	239	18	&	&	CCONJ
finefocus-3634	239	19	deckwer	deckwer	PROPN
finefocus-3634	239	20	,	,	PUNCT
finefocus-3634	239	21	w.	w.	PROPN
finefocus-3634	239	22	d.	d.	PROPN
finefocus-3634	239	23	(	(	PUNCT
finefocus-3634	239	24	2005	2005	NUM
finefocus-3634	239	25	)	)	PUNCT
finefocus-3634	239	26	.	.	PUNCT
finefocus-3634	240	1	enzymatic	enzymatic	ADJ
finefocus-3634	240	2	degradation	degradation	NOUN
finefocus-3634	240	3	of	of	ADP
finefocus-3634	240	4	poly	poly	ADJ
finefocus-3634	240	5	(	(	PUNCT
finefocus-3634	240	6	ethylene	ethylene	NOUN
finefocus-3634	240	7	terephthalate	terephthalate	NOUN
finefocus-3634	240	8	):	):	PUNCT
finefocus-3634	240	9	rapid	rapid	ADJ
finefocus-3634	240	10	hydrolyse	hydrolyse	NOUN
finefocus-3634	240	11	using	use	VERB
finefocus-3634	240	12	a	a	DET
finefocus-3634	240	13	hydrolase	hydrolase	NOUN
finefocus-3634	240	14	from	from	ADP
finefocus-3634	240	15	t.	t.	PROPN
finefocus-3634	240	16	fusca	fusca	PROPN
finefocus-3634	240	17	.	.	PUNCT
finefocus-3634	241	1	macromolecular	macromolecular	PROPN
finefocus-3634	241	2	rapid	rapid	ADJ
finefocus-3634	241	3	communications	communication	NOUN
finefocus-3634	241	4	,	,	PUNCT
finefocus-3634	241	5	26(17	26(17	NUM
finefocus-3634	241	6	)	)	PUNCT
finefocus-3634	241	7	,	,	PUNCT
finefocus-3634	241	8	1400	1400	NUM
finefocus-3634	241	9	-	-	SYM
finefocus-3634	241	10	1405	1405	NUM
finefocus-3634	241	11	.	.	PUNCT
finefocus-3634	242	1	13	13	NUM
finefocus-3634	242	2	.	.	X
finefocus-3634	242	3	o'brien	o'brien	PROPN
finefocus-3634	242	4	,	,	PUNCT
finefocus-3634	242	5	k.	k.	PROPN
finefocus-3634	242	6	(	(	PUNCT
finefocus-3634	242	7	2019	2019	NUM
finefocus-3634	242	8	,	,	PUNCT
finefocus-3634	242	9	may	may	AUX
finefocus-3634	242	10	31	31	NUM
finefocus-3634	242	11	,	,	PUNCT
finefocus-3634	242	12	2019	2019	NUM
finefocus-3634	242	13	)	)	PUNCT
finefocus-3634	242	14	.	.	PUNCT
finefocus-3634	243	1	biodegradation	biodegradation	NOUN
finefocus-3634	243	2	of	of	ADP
finefocus-3634	243	3	plastic	plastic	ADJ
finefocus-3634	243	4	waste	waste	NOUN
finefocus-3634	243	5	.	.	PUNCT
finefocus-3634	243	6	https://www.advancedsciencenews.com/	https://www.advancedsciencenews.com/	PROPN
finefocus-3634	243	7	biodegradation	biodegradation	NOUN
finefocus-3634	243	8	-	-	PUNCT
finefocus-3634	243	9	of	of	ADP
finefocus-3634	243	10	-	-	PUNCT
finefocus-3634	243	11	plastic	plastic	NOUN
finefocus-3634	243	12	-	-	PUNCT
finefocus-3634	243	13	waste/.	waste/.	NOUN
finefocus-3634	243	14	advanced	advanced	ADJ
finefocus-3634	243	15	science	science	NOUN
finefocus-3634	243	16	news	news	NOUN
finefocus-3634	243	17	.	.	PUNCT
finefocus-3634	244	1	vol	vol	NOUN
finefocus-3634	244	2	8	8	NUM
finefocus-3634	244	3	i	i	PRON
finefocus-3634	244	4	99	99	NUM
finefocus-3634	244	5	14	14	NUM
finefocus-3634	244	6	.	.	PUNCT
finefocus-3634	245	1	paydar	paydar	PROPN
finefocus-3634	245	2	,	,	PUNCT
finefocus-3634	245	3	m.	m.	NOUN
finefocus-3634	245	4	m.	m.	NOUN
finefocus-3634	245	5	,	,	PUNCT
finefocus-3634	245	6	&	&	CCONJ
finefocus-3634	245	7	olfati	olfati	PROPN
finefocus-3634	245	8	,	,	PUNCT
finefocus-3634	245	9	m.	m.	NOUN
finefocus-3634	245	10	(	(	PUNCT
finefocus-3634	245	11	2018	2018	NUM
finefocus-3634	245	12	)	)	PUNCT
finefocus-3634	245	13	.	.	PUNCT
finefocus-3634	246	1	designing	design	VERB
finefocus-3634	246	2	and	and	CCONJ
finefocus-3634	246	3	solving	solve	VERB
finefocus-3634	246	4	a	a	DET
finefocus-3634	246	5	reverse	reverse	ADJ
finefocus-3634	246	6	logistics	logistic	NOUN
finefocus-3634	246	7	network	network	NOUN
finefocus-3634	246	8	for	for	ADP
finefocus-3634	246	9	polyethylene	polyethylene	NOUN
finefocus-3634	246	10	terephthalate	terephthalate	NOUN
finefocus-3634	246	11	bottles	bottle	NOUN
finefocus-3634	246	12	.	.	PUNCT
finefocus-3634	247	1	journal	journal	NOUN
finefocus-3634	247	2	of	of	ADP
finefocus-3634	247	3	cleaner	clean	ADJ
finefocus-3634	247	4	production	production	NOUN
finefocus-3634	247	5	,	,	PUNCT
finefocus-3634	247	6	195	195	NUM
finefocus-3634	247	7	,	,	PUNCT
finefocus-3634	247	8	605	605	NUM
finefocus-3634	247	9	-	-	SYM
finefocus-3634	247	10	617	617	NUM
finefocus-3634	247	11	.	.	NOUN
finefocus-3634	247	12	15	15	NUM
finefocus-3634	247	13	.	.	PUNCT
finefocus-3634	248	1	rauwerdink	rauwerdink	PROPN
finefocus-3634	248	2	,	,	PUNCT
finefocus-3634	248	3	a.	a.	PROPN
finefocus-3634	248	4	,	,	PUNCT
finefocus-3634	248	5	&	&	CCONJ
finefocus-3634	248	6	kazlauskas	kazlauskas	PROPN
finefocus-3634	248	7	,	,	PUNCT
finefocus-3634	248	8	r.	r.	PROPN
finefocus-3634	248	9	j.	j.	PROPN
finefocus-3634	248	10	(	(	PUNCT
finefocus-3634	248	11	2015	2015	NUM
finefocus-3634	248	12	)	)	PUNCT
finefocus-3634	248	13	.	.	PUNCT
finefocus-3634	249	1	how	how	SCONJ
finefocus-3634	249	2	the	the	DET
finefocus-3634	249	3	same	same	ADJ
finefocus-3634	249	4	core	core	NOUN
finefocus-3634	249	5	catalytic	catalytic	ADJ
finefocus-3634	249	6	machinery	machinery	NOUN
finefocus-3634	249	7	catalyzes	catalyze	VERB
finefocus-3634	249	8	17	17	NUM
finefocus-3634	249	9	different	different	ADJ
finefocus-3634	249	10	reactions	reaction	NOUN
finefocus-3634	249	11	:	:	PUNCT
finefocus-3634	249	12	the	the	DET
finefocus-3634	249	13	serine	serine	NOUN
finefocus-3634	249	14	-	-	PUNCT
finefocus-3634	249	15	histidine	histidine	NOUN
finefocus-3634	249	16	-	-	PUNCT
finefocus-3634	249	17	aspartate	aspartate	NOUN
finefocus-3634	249	18	catalytic	catalytic	ADJ
finefocus-3634	249	19	triad	triad	NOUN
finefocus-3634	249	20	of	of	ADP
finefocus-3634	249	21	α	α	PROPN
finefocus-3634	249	22	/	/	SYM
finefocus-3634	249	23	β	β	NOUN
finefocus-3634	249	24	-	-	PUNCT
finefocus-3634	249	25	hydrolase	hydrolase	ADJ
finefocus-3634	249	26	fold	fold	ADJ
finefocus-3634	249	27	enzymes	enzyme	NOUN
finefocus-3634	249	28	.	.	PUNCT
finefocus-3634	250	1	acs	acs	PROPN
finefocus-3634	250	2	catalysis	catalysis	NOUN
finefocus-3634	250	3	,	,	PUNCT
finefocus-3634	250	4	5(10	5(10	NUM
finefocus-3634	250	5	)	)	PUNCT
finefocus-3634	250	6	,	,	PUNCT
finefocus-3634	250	7	6153	6153	NUM
finefocus-3634	250	8	-	-	SYM
finefocus-3634	250	9	6176	6176	NUM
finefocus-3634	250	10	.	.	PUNCT
finefocus-3634	251	1	16	16	NUM
finefocus-3634	251	2	.	.	PUNCT
finefocus-3634	251	3	ribitsch	ribitsch	PROPN
finefocus-3634	251	4	,	,	PUNCT
finefocus-3634	251	5	d.	d.	PROPN
finefocus-3634	251	6	,	,	PUNCT
finefocus-3634	251	7	acero	acero	PROPN
finefocus-3634	251	8	,	,	PUNCT
finefocus-3634	251	9	e.	e.	PROPN
finefocus-3634	251	10	h.	h.	PROPN
finefocus-3634	251	11	,	,	PUNCT
finefocus-3634	251	12	greimel	greimel	PROPN
finefocus-3634	251	13	,	,	PUNCT
finefocus-3634	251	14	k.	k.	PROPN
finefocus-3634	251	15	,	,	PUNCT
finefocus-3634	251	16	eiteljoerg	eiteljoerg	PROPN
finefocus-3634	251	17	,	,	PUNCT
finefocus-3634	251	18	i.	i.	PROPN
finefocus-3634	251	19	,	,	PUNCT
finefocus-3634	251	20	trotscha	trotscha	ADV
finefocus-3634	251	21	,	,	PUNCT
finefocus-3634	251	22	e.	e.	PROPN
finefocus-3634	251	23	,	,	PUNCT
finefocus-3634	251	24	freddi	freddi	PROPN
finefocus-3634	251	25	,	,	PUNCT
finefocus-3634	251	26	g.	g.	PROPN
finefocus-3634	251	27	,	,	PUNCT
finefocus-3634	251	28	schwab	schwab	PROPN
finefocus-3634	251	29	,	,	PUNCT
finefocus-3634	251	30	h.	h.	PROPN
finefocus-3634	251	31	,	,	PUNCT
finefocus-3634	251	32	&	&	CCONJ
finefocus-3634	251	33	guebitz	guebitz	PROPN
finefocus-3634	251	34	,	,	PUNCT
finefocus-3634	251	35	g.	g.	PROPN
finefocus-3634	251	36	m.	m.	PROPN
finefocus-3634	251	37	(	(	PUNCT
finefocus-3634	251	38	2012	2012	NUM
finefocus-3634	251	39	)	)	PUNCT
finefocus-3634	251	40	.	.	PUNCT
finefocus-3634	252	1	characterization	characterization	NOUN
finefocus-3634	252	2	of	of	ADP
finefocus-3634	252	3	a	a	DET
finefocus-3634	252	4	new	new	ADJ
finefocus-3634	252	5	cutinase	cutinase	NOUN
finefocus-3634	252	6	from	from	ADP
finefocus-3634	252	7	thermobifida	thermobifida	PROPN
finefocus-3634	252	8	alba	alba	NOUN
finefocus-3634	252	9	for	for	ADP
finefocus-3634	252	10	pet	pet	ADJ
finefocus-3634	252	11	-	-	PUNCT
finefocus-3634	252	12	surface	surface	NOUN
finefocus-3634	252	13	hydrolysis	hydrolysis	NOUN
finefocus-3634	252	14	.	.	PUNCT
finefocus-3634	253	1	biocatalysis	biocatalysis	NOUN
finefocus-3634	253	2	and	and	CCONJ
finefocus-3634	253	3	biotransformation	biotransformation	NOUN
finefocus-3634	253	4	,	,	PUNCT
finefocus-3634	253	5	30(1	30(1	NUM
finefocus-3634	253	6	)	)	PUNCT
finefocus-3634	253	7	,	,	PUNCT
finefocus-3634	253	8	2	2	NUM
finefocus-3634	253	9	-	-	SYM
finefocus-3634	253	10	9	9	NUM
finefocus-3634	253	11	.	.	NUM
finefocus-3634	253	12	17	17	NUM
finefocus-3634	253	13	.	.	PUNCT
finefocus-3634	254	1	savojardo	savojardo	NOUN
finefocus-3634	254	2	,	,	PUNCT
finefocus-3634	254	3	c.	c.	PROPN
finefocus-3634	254	4	,	,	PUNCT
finefocus-3634	254	5	martelli	martelli	PROPN
finefocus-3634	254	6	,	,	PUNCT
finefocus-3634	254	7	p.	p.	PROPN
finefocus-3634	254	8	l.	l.	PROPN
finefocus-3634	254	9	,	,	PUNCT
finefocus-3634	254	10	fariselli	fariselli	PROPN
finefocus-3634	254	11	,	,	PUNCT
finefocus-3634	254	12	p.	p.	PROPN
finefocus-3634	254	13	,	,	PUNCT
finefocus-3634	254	14	profiti	profiti	PROPN
finefocus-3634	254	15	,	,	PUNCT
finefocus-3634	254	16	g.	g.	PROPN
finefocus-3634	254	17	,	,	PUNCT
finefocus-3634	254	18	&	&	CCONJ
finefocus-3634	254	19	casadio	casadio	PROPN
finefocus-3634	254	20	,	,	PUNCT
finefocus-3634	254	21	r.	r.	PROPN
finefocus-3634	254	22	(	(	PUNCT
finefocus-3634	254	23	2018	2018	NUM
finefocus-3634	254	24	)	)	PUNCT
finefocus-3634	254	25	.	.	PUNCT
finefocus-3634	255	1	busca	busca	PROPN
finefocus-3634	255	2	:	:	PUNCT
finefocus-3634	255	3	an	an	DET
finefocus-3634	255	4	integrative	integrative	ADJ
finefocus-3634	255	5	web	web	NOUN
finefocus-3634	255	6	server	server	NOUN
finefocus-3634	255	7	to	to	PART
finefocus-3634	255	8	predict	predict	VERB
finefocus-3634	255	9	subcellular	subcellular	ADJ
finefocus-3634	255	10	localization	localization	NOUN
finefocus-3634	255	11	of	of	ADP
finefocus-3634	255	12	proteins	protein	NOUN
finefocus-3634	255	13	.	.	PUNCT
finefocus-3634	256	1	nucleic	nucleic	ADJ
finefocus-3634	256	2	acids	acid	NOUN
finefocus-3634	256	3	research	research	NOUN
finefocus-3634	256	4	,	,	PUNCT
finefocus-3634	256	5	46(w1	46(w1	NUM
finefocus-3634	256	6	)	)	PUNCT
finefocus-3634	256	7	,	,	PUNCT
finefocus-3634	256	8	w459	w459	PROPN
finefocus-3634	256	9	-	-	PUNCT
finefocus-3634	256	10	w466	w466	PROPN
finefocus-3634	256	11	.	.	PROPN
finefocus-3634	256	12	18	18	NUM
finefocus-3634	256	13	.	.	PUNCT
finefocus-3634	257	1	seo	seo	PROPN
finefocus-3634	257	2	,	,	PUNCT
finefocus-3634	257	3	h.	h.	PROPN
finefocus-3634	257	4	,	,	PUNCT
finefocus-3634	257	5	kim	kim	PROPN
finefocus-3634	257	6	,	,	PUNCT
finefocus-3634	257	7	s.	s.	PROPN
finefocus-3634	257	8	,	,	PUNCT
finefocus-3634	257	9	son	son	NOUN
finefocus-3634	257	10	,	,	PUNCT
finefocus-3634	257	11	h.	h.	PROPN
finefocus-3634	257	12	f.	f.	PROPN
finefocus-3634	257	13	,	,	PUNCT
finefocus-3634	257	14	sagong	sagong	ADJ
finefocus-3634	257	15	,	,	PUNCT
finefocus-3634	257	16	h.-y	h.-y	NOUN
finefocus-3634	257	17	.	.	PUNCT
finefocus-3634	257	18	,	,	PUNCT
finefocus-3634	257	19	joo	joo	PROPN
finefocus-3634	257	20	,	,	PUNCT
finefocus-3634	257	21	s.	s.	PROPN
finefocus-3634	257	22	,	,	PUNCT
finefocus-3634	257	23	&	&	CCONJ
finefocus-3634	257	24	kim	kim	PROPN
finefocus-3634	257	25	,	,	PUNCT
finefocus-3634	257	26	k.-j	k.-j	PROPN
finefocus-3634	257	27	.	.	PUNCT
finefocus-3634	258	1	(	(	PUNCT
finefocus-3634	258	2	2019	2019	NUM
finefocus-3634	258	3	)	)	PUNCT
finefocus-3634	258	4	.	.	PUNCT
finefocus-3634	259	1	production	production	NOUN
finefocus-3634	259	2	of	of	ADP
finefocus-3634	259	3	extracellular	extracellular	ADJ
finefocus-3634	259	4	petase	petase	NOUN
finefocus-3634	259	5	from	from	ADP
finefocus-3634	259	6	ideonella	ideonella	NOUN
finefocus-3634	259	7	sakaiensis	sakaiensis	NOUN
finefocus-3634	259	8	using	use	VERB
finefocus-3634	259	9	sec	sec	PROPN
finefocus-3634	259	10	-	-	PUNCT
finefocus-3634	259	11	dependent	dependent	ADJ
finefocus-3634	259	12	signal	signal	NOUN
finefocus-3634	259	13	peptides	peptide	NOUN
finefocus-3634	259	14	in	in	ADP
finefocus-3634	259	15	e.	e.	PROPN
finefocus-3634	259	16	coli	coli	PROPN
finefocus-3634	259	17	.	.	PUNCT
finefocus-3634	260	1	biochemical	biochemical	ADJ
finefocus-3634	260	2	and	and	CCONJ
finefocus-3634	260	3	biophysical	biophysical	ADJ
finefocus-3634	260	4	research	research	NOUN
finefocus-3634	260	5	communications	communication	NOUN
finefocus-3634	260	6	,	,	PUNCT
finefocus-3634	260	7	508(1	508(1	NUM
finefocus-3634	260	8	)	)	PUNCT
finefocus-3634	260	9	,	,	PUNCT
finefocus-3634	260	10	250	250	NUM
finefocus-3634	260	11	-	-	SYM
finefocus-3634	260	12	255	255	NUM
finefocus-3634	260	13	.	.	PUNCT
finefocus-3634	261	1	19	19	NUM
finefocus-3634	261	2	.	.	X
finefocus-3634	261	3	shirke	shirke	PROPN
finefocus-3634	261	4	,	,	PUNCT
finefocus-3634	261	5	a.	a.	NOUN
finefocus-3634	261	6	n.	n.	PROPN
finefocus-3634	261	7	,	,	PUNCT
finefocus-3634	261	8	white	white	ADJ
finefocus-3634	261	9	,	,	PUNCT
finefocus-3634	261	10	c.	c.	NOUN
finefocus-3634	261	11	,	,	PUNCT
finefocus-3634	261	12	englaender	englaender	PROPN
finefocus-3634	261	13	,	,	PUNCT
finefocus-3634	261	14	j.	j.	PROPN
finefocus-3634	261	15	a.	a.	PROPN
finefocus-3634	261	16	,	,	PUNCT
finefocus-3634	261	17	zwarycz	zwarycz	PROPN
finefocus-3634	261	18	,	,	PUNCT
finefocus-3634	261	19	a.	a.	NOUN
finefocus-3634	261	20	,	,	PUNCT
finefocus-3634	261	21	butterfoss	butterfoss	NOUN
finefocus-3634	261	22	,	,	PUNCT
finefocus-3634	261	23	g.	g.	PROPN
finefocus-3634	261	24	l.	l.	PROPN
finefocus-3634	261	25	,	,	PUNCT
finefocus-3634	261	26	linhardt	linhardt	PROPN
finefocus-3634	261	27	,	,	PUNCT
finefocus-3634	261	28	r.	r.	PROPN
finefocus-3634	261	29	j.	j.	PROPN
finefocus-3634	261	30	,	,	PUNCT
finefocus-3634	261	31	&	&	CCONJ
finefocus-3634	261	32	gross	gross	PROPN
finefocus-3634	261	33	,	,	PUNCT
finefocus-3634	261	34	r.	r.	PROPN
finefocus-3634	261	35	a.	a.	PROPN
finefocus-3634	261	36	(	(	PUNCT
finefocus-3634	261	37	2018	2018	NUM
finefocus-3634	261	38	)	)	PUNCT
finefocus-3634	261	39	.	.	PUNCT
finefocus-3634	262	1	stabilizing	stabilize	VERB
finefocus-3634	262	2	leaf	leaf	NOUN
finefocus-3634	262	3	and	and	CCONJ
finefocus-3634	262	4	branch	branch	NOUN
finefocus-3634	262	5	compost	compost	NOUN
finefocus-3634	262	6	cutinase	cutinase	NOUN
finefocus-3634	262	7	(	(	PUNCT
finefocus-3634	262	8	lcc	lcc	PROPN
finefocus-3634	262	9	)	)	PUNCT
finefocus-3634	262	10	with	with	ADP
finefocus-3634	262	11	glycosylation	glycosylation	NOUN
finefocus-3634	262	12	:	:	PUNCT
finefocus-3634	262	13	mechanism	mechanism	NOUN
finefocus-3634	262	14	and	and	CCONJ
finefocus-3634	262	15	effect	effect	NOUN
finefocus-3634	262	16	on	on	ADP
finefocus-3634	262	17	pet	pet	ADJ
finefocus-3634	262	18	hydrolysis	hydrolysis	NOUN
finefocus-3634	262	19	.	.	PUNCT
finefocus-3634	263	1	biochemistry	biochemistry	NOUN
finefocus-3634	263	2	,	,	PUNCT
finefocus-3634	263	3	57(7	57(7	NUM
finefocus-3634	263	4	)	)	PUNCT
finefocus-3634	263	5	,	,	PUNCT
finefocus-3634	263	6	1190	1190	NUM
finefocus-3634	263	7	-	-	SYM
finefocus-3634	263	8	1200	1200	NUM
finefocus-3634	263	9	.	.	PUNCT
finefocus-3634	264	1	20	20	NUM
finefocus-3634	264	2	.	.	X
finefocus-3634	264	3	taniguchi	taniguchi	PROPN
finefocus-3634	264	4	,	,	PUNCT
finefocus-3634	264	5	i.	i.	PROPN
finefocus-3634	264	6	,	,	PUNCT
finefocus-3634	264	7	yoshida	yoshida	PROPN
finefocus-3634	264	8	,	,	PUNCT
finefocus-3634	264	9	s.	s.	PROPN
finefocus-3634	264	10	,	,	PUNCT
finefocus-3634	264	11	hiraga	hiraga	PROPN
finefocus-3634	264	12	,	,	PUNCT
finefocus-3634	264	13	k.	k.	PROPN
finefocus-3634	264	14	,	,	PUNCT
finefocus-3634	264	15	miyamoto	miyamoto	PROPN
finefocus-3634	264	16	,	,	PUNCT
finefocus-3634	264	17	k.	k.	PROPN
finefocus-3634	264	18	,	,	PUNCT
finefocus-3634	264	19	kimura	kimura	PROPN
finefocus-3634	264	20	,	,	PUNCT
finefocus-3634	264	21	y.	y.	PROPN
finefocus-3634	264	22	,	,	PUNCT
finefocus-3634	264	23	&	&	CCONJ
finefocus-3634	264	24	oda	oda	PROPN
finefocus-3634	264	25	,	,	PUNCT
finefocus-3634	264	26	k.	k.	PROPN
finefocus-3634	264	27	(	(	PUNCT
finefocus-3634	264	28	2019	2019	NUM
finefocus-3634	264	29	)	)	PUNCT
finefocus-3634	264	30	.	.	PUNCT
finefocus-3634	265	1	biodegradation	biodegradation	NOUN
finefocus-3634	265	2	of	of	ADP
finefocus-3634	265	3	pet	pet	ADJ
finefocus-3634	265	4	:	:	PUNCT
finefocus-3634	265	5	current	current	ADJ
finefocus-3634	265	6	status	status	NOUN
finefocus-3634	265	7	and	and	CCONJ
finefocus-3634	265	8	application	application	NOUN
finefocus-3634	265	9	aspects	aspect	NOUN
finefocus-3634	265	10	.	.	PUNCT
finefocus-3634	266	1	acs	acs	PROPN
finefocus-3634	266	2	catalysis	catalysis	NOUN
finefocus-3634	266	3	,	,	PUNCT
finefocus-3634	266	4	9(5	9(5	NUM
finefocus-3634	266	5	)	)	PUNCT
finefocus-3634	266	6	,	,	PUNCT
finefocus-3634	266	7	4089	4089	NUM
finefocus-3634	266	8	-	-	SYM
finefocus-3634	266	9	4105	4105	NUM
finefocus-3634	266	10	.	.	PUNCT
finefocus-3634	267	1	21	21	NUM
finefocus-3634	267	2	.	.	X
finefocus-3634	267	3	thumarat	thumarat	PROPN
finefocus-3634	267	4	,	,	PUNCT
finefocus-3634	267	5	u.	u.	PROPN
finefocus-3634	267	6	,	,	PUNCT
finefocus-3634	267	7	kawabata	kawabata	PROPN
finefocus-3634	267	8	,	,	PUNCT
finefocus-3634	267	9	t.	t.	PROPN
finefocus-3634	267	10	,	,	PUNCT
finefocus-3634	267	11	nakajima	nakajima	PROPN
finefocus-3634	267	12	,	,	PUNCT
finefocus-3634	267	13	m.	m.	NOUN
finefocus-3634	267	14	,	,	PUNCT
finefocus-3634	267	15	nakajima	nakajima	PROPN
finefocus-3634	267	16	,	,	PUNCT
finefocus-3634	267	17	h.	h.	PROPN
finefocus-3634	267	18	,	,	PUNCT
finefocus-3634	267	19	sugiyama	sugiyama	NOUN
finefocus-3634	267	20	,	,	PUNCT
finefocus-3634	267	21	a.	a.	NOUN
finefocus-3634	267	22	,	,	PUNCT
finefocus-3634	267	23	yazaki	yazaki	PROPN
finefocus-3634	267	24	,	,	PUNCT
finefocus-3634	267	25	k.	k.	PROPN
finefocus-3634	267	26	,	,	PUNCT
finefocus-3634	267	27	tada	tada	PROPN
finefocus-3634	267	28	,	,	PUNCT
finefocus-3634	267	29	t.	t.	PROPN
finefocus-3634	267	30	,	,	PUNCT
finefocus-3634	267	31	waku	waku	PROPN
finefocus-3634	267	32	,	,	PUNCT
finefocus-3634	267	33	t.	t.	PROPN
finefocus-3634	267	34	,	,	PUNCT
finefocus-3634	267	35	tanaka	tanaka	PROPN
finefocus-3634	267	36	,	,	PUNCT
finefocus-3634	267	37	n.	n.	PROPN
finefocus-3634	267	38	,	,	PUNCT
finefocus-3634	267	39	&	&	CCONJ
finefocus-3634	267	40	kawai	kawai	PROPN
finefocus-3634	267	41	,	,	PUNCT
finefocus-3634	267	42	f.	f.	PROPN
finefocus-3634	267	43	(	(	PUNCT
finefocus-3634	267	44	2015	2015	NUM
finefocus-3634	267	45	)	)	PUNCT
finefocus-3634	267	46	.	.	PUNCT
finefocus-3634	268	1	comparison	comparison	NOUN
finefocus-3634	268	2	of	of	ADP
finefocus-3634	268	3	genetic	genetic	ADJ
finefocus-3634	268	4	structures	structure	NOUN
finefocus-3634	268	5	and	and	CCONJ
finefocus-3634	268	6	biochemical	biochemical	ADJ
finefocus-3634	268	7	properties	property	NOUN
finefocus-3634	268	8	of	of	ADP
finefocus-3634	268	9	tandem	tandem	NOUN
finefocus-3634	268	10	cutinase	cutinase	NOUN
finefocus-3634	268	11	-	-	PUNCT
finefocus-3634	268	12	type	type	NOUN
finefocus-3634	268	13	polyesterases	polyesterase	NOUN
finefocus-3634	268	14	from	from	ADP
finefocus-3634	268	15	thermobifida	thermobifida	PROPN
finefocus-3634	268	16	alba	alba	PROPN
finefocus-3634	268	17	ahk119	ahk119	PROPN
finefocus-3634	268	18	.	.	PROPN
finefocus-3634	268	19	journal	journal	PROPN
finefocus-3634	268	20	of	of	ADP
finefocus-3634	268	21	bioscience	bioscience	NOUN
finefocus-3634	268	22	and	and	CCONJ
finefocus-3634	268	23	bioengineering	bioengineering	NOUN
finefocus-3634	268	24	,	,	PUNCT
finefocus-3634	268	25	120(5	120(5	NUM
finefocus-3634	268	26	)	)	PUNCT
finefocus-3634	268	27	,	,	PUNCT
finefocus-3634	268	28	491	491	NUM
finefocus-3634	268	29	-	-	SYM
finefocus-3634	268	30	497	497	NUM
finefocus-3634	268	31	.	.	PUNCT
finefocus-3634	269	1	22	22	NUM
finefocus-3634	269	2	.	.	PUNCT
finefocus-3634	270	1	tullo	tullo	PROPN
finefocus-3634	270	2	,	,	PUNCT
finefocus-3634	270	3	a.	a.	NOUN
finefocus-3634	270	4	h.	h.	PROPN
finefocus-3634	270	5	(	(	PUNCT
finefocus-3634	270	6	2019	2019	NUM
finefocus-3634	270	7	,	,	PUNCT
finefocus-3634	270	8	october	october	PROPN
finefocus-3634	270	9	6	6	NUM
finefocus-3634	270	10	,	,	PUNCT
finefocus-3634	270	11	2019	2019	NUM
finefocus-3634	270	12	)	)	PUNCT
finefocus-3634	270	13	.	.	PUNCT
finefocus-3634	271	1	plastic	plastic	NOUN
finefocus-3634	271	2	has	have	VERB
finefocus-3634	271	3	a	a	DET
finefocus-3634	271	4	problem	problem	NOUN
finefocus-3634	271	5	;	;	PUNCT
finefocus-3634	271	6	is	be	AUX
finefocus-3634	271	7	chemical	chemical	NOUN
finefocus-3634	271	8	recycling	recycle	VERB
finefocus-3634	271	9	the	the	DET
finefocus-3634	271	10	solution	solution	NOUN
finefocus-3634	271	11	?	?	PUNCT
finefocus-3634	271	12	.	.	PUNCT
finefocus-3634	272	1	c&en	c&en	NOUN
finefocus-3634	272	2	,	,	PUNCT
finefocus-3634	272	3	97(39	97(39	NUM
finefocus-3634	272	4	)	)	PUNCT
finefocus-3634	272	5	.	.	PUNCT
finefocus-3634	273	1	23	23	NUM
finefocus-3634	273	2	.	.	PUNCT
finefocus-3634	274	1	yoshida	yoshida	PROPN
finefocus-3634	274	2	,	,	PUNCT
finefocus-3634	274	3	s.	s.	PROPN
finefocus-3634	274	4	,	,	PUNCT
finefocus-3634	274	5	hiraga	hiraga	PROPN
finefocus-3634	274	6	,	,	PUNCT
finefocus-3634	274	7	k.	k.	PROPN
finefocus-3634	274	8	,	,	PUNCT
finefocus-3634	274	9	takehana	takehana	PROPN
finefocus-3634	274	10	,	,	PUNCT
finefocus-3634	274	11	t.	t.	PROPN
finefocus-3634	274	12	,	,	PUNCT
finefocus-3634	274	13	taniguchi	taniguchi	PROPN
finefocus-3634	274	14	,	,	PUNCT
finefocus-3634	274	15	i.	i.	PROPN
finefocus-3634	274	16	,	,	PUNCT
finefocus-3634	274	17	yamaji	yamaji	PROPN
finefocus-3634	274	18	,	,	PUNCT
finefocus-3634	274	19	h.	h.	PROPN
finefocus-3634	274	20	,	,	PUNCT
finefocus-3634	274	21	maeda	maeda	PROPN
finefocus-3634	274	22	,	,	PUNCT
finefocus-3634	274	23	y.	y.	NOUN
finefocus-3634	274	24	,	,	PUNCT
finefocus-3634	274	25	toyohara	toyohara	PROPN
finefocus-3634	274	26	,	,	PUNCT
finefocus-3634	274	27	k.	k.	PROPN
finefocus-3634	274	28	,	,	PUNCT
finefocus-3634	274	29	miyamoto	miyamoto	PROPN
finefocus-3634	274	30	,	,	PUNCT
finefocus-3634	274	31	k.	k.	PROPN
finefocus-3634	274	32	,	,	PUNCT
finefocus-3634	274	33	kimura	kimura	PROPN
finefocus-3634	274	34	,	,	PUNCT
finefocus-3634	274	35	y.	y.	PROPN
finefocus-3634	274	36	,	,	PUNCT
finefocus-3634	274	37	&	&	CCONJ
finefocus-3634	274	38	oda	oda	PROPN
finefocus-3634	274	39	,	,	PUNCT
finefocus-3634	274	40	k.	k.	PROPN
finefocus-3634	274	41	(	(	PUNCT
finefocus-3634	274	42	2016	2016	NUM
finefocus-3634	274	43	)	)	PUNCT
finefocus-3634	274	44	.	.	PUNCT
finefocus-3634	275	1	a	a	DET
finefocus-3634	275	2	bacterium	bacterium	NOUN
finefocus-3634	275	3	that	that	PRON
finefocus-3634	275	4	degrades	degrade	VERB
finefocus-3634	275	5	and	and	CCONJ
finefocus-3634	275	6	assimilates	assimilate	VERB
finefocus-3634	275	7	poly	poly	ADJ
finefocus-3634	275	8	(	(	PUNCT
finefocus-3634	275	9	ethylene	ethylene	NOUN
finefocus-3634	275	10	terephthalate	terephthalate	NOUN
finefocus-3634	275	11	)	)	PUNCT
finefocus-3634	275	12	.	.	PUNCT
finefocus-3634	276	1	science	science	NOUN
finefocus-3634	276	2	,	,	PUNCT
finefocus-3634	276	3	351(6278	351(6278	NOUN
finefocus-3634	276	4	)	)	PUNCT
finefocus-3634	276	5	,	,	PUNCT
finefocus-3634	276	6	1196	1196	NUM
finefocus-3634	276	7	-	-	SYM
finefocus-3634	276	8	1199	1199	NUM
finefocus-3634	276	9	.	.	PUNCT