id	sid	tid	token	lemma	pos
bioscience-243	1	1	highlights	highlight	NOUN
bioscience-243	1	2	in	in	ADP
bioscience-243	1	3	bioscience	bioscience	PROPN
bioscience-243	1	4	issn:2682	issn:2682	PROPN
bioscience-243	1	5	-	-	PUNCT
bioscience-243	1	6	4043	4043	NUM
bioscience-243	1	7	doi:10.36462	doi:10.36462	NOUN
bioscience-243	1	8	/	/	SYM
bioscience-243	1	9	h.biosci.202501	h.biosci.202501	PROPN
bioscience-243	1	10	research	research	NOUN
bioscience-243	1	11	article	article	NOUN
bioscience-243	1	12	open	open	VERB
bioscience-243	1	13	access	access	NOUN
bioscience-243	1	14	1	1	NUM
bioscience-243	1	15	biology	biology	NOUN
bioscience-243	1	16	department	department	NOUN
bioscience-243	1	17	,	,	PUNCT
bioscience-243	1	18	faculty	faculty	NOUN
bioscience-243	1	19	of	of	ADP
bioscience-243	1	20	mathematics	mathematic	NOUN
bioscience-243	1	21	and	and	CCONJ
bioscience-243	1	22	natural	natural	ADJ
bioscience-243	1	23	sciences	science	NOUN
bioscience-243	1	24	,	,	PUNCT
bioscience-243	1	25	university	university	NOUN
bioscience-243	1	26	of	of	ADP
bioscience-243	1	27	jember	jember	PROPN
bioscience-243	1	28	,	,	PUNCT
bioscience-243	1	29	jember	jember	PROPN
bioscience-243	1	30	,	,	PUNCT
bioscience-243	1	31	east	east	PROPN
bioscience-243	1	32	java	java	PROPN
bioscience-243	1	33	,	,	PUNCT
bioscience-243	1	34	indonesia	indonesia	PROPN
bioscience-243	1	35	.	.	PUNCT
bioscience-243	2	1	*	*	PUNCT
bioscience-243	2	2	to	to	PART
bioscience-243	2	3	whom	whom	PRON
bioscience-243	2	4	correspondence	correspondence	NOUN
bioscience-243	2	5	should	should	AUX
bioscience-243	2	6	be	be	AUX
bioscience-243	2	7	addressed	address	VERB
bioscience-243	2	8	:	:	PUNCT
bioscience-243	2	9	senjarini@unej.ac.id	senjarini@unej.ac.id	ADJ
bioscience-243	2	10	editor	editor	NOUN
bioscience-243	2	11	:	:	PUNCT
bioscience-243	2	12	hatem	hatem	PROPN
bioscience-243	2	13	zayed	zayed	PROPN
bioscience-243	2	14	,	,	PUNCT
bioscience-243	2	15	department	department	NOUN
bioscience-243	2	16	of	of	ADP
bioscience-243	2	17	biomedical	biomedical	ADJ
bioscience-243	2	18	science	science	NOUN
bioscience-243	2	19	,	,	PUNCT
bioscience-243	2	20	college	college	NOUN
bioscience-243	2	21	of	of	ADP
bioscience-243	2	22	health	health	PROPN
bioscience-243	2	23	sciences	sciences	PROPN
bioscience-243	2	24	,	,	PUNCT
bioscience-243	2	25	qatar	qatar	PROPN
bioscience-243	2	26	university	university	PROPN
bioscience-243	2	27	,	,	PUNCT
bioscience-243	2	28	doha	doha	PROPN
bioscience-243	2	29	,	,	PUNCT
bioscience-243	2	30	qatar	qatar	PROPN
bioscience-243	2	31	.	.	PUNCT
bioscience-243	3	1	reviewer(s	reviewer(s	NOUN
bioscience-243	3	2	):	):	PUNCT
bioscience-243	3	3	laila	laila	PROPN
bioscience-243	3	4	dabab	dabab	PROPN
bioscience-243	3	5	nahas	nahas	PROPN
bioscience-243	3	6	,	,	PUNCT
bioscience-243	3	7	usher	usher	PROPN
bioscience-243	3	8	institute	institute	PROPN
bioscience-243	3	9	,	,	PUNCT
bioscience-243	3	10	university	university	PROPN
bioscience-243	3	11	of	of	ADP
bioscience-243	3	12	edinburgh	edinburgh	PROPN
bioscience-243	3	13	,	,	PUNCT
bioscience-243	3	14	scotland	scotland	PROPN
bioscience-243	3	15	,	,	PUNCT
bioscience-243	3	16	united	united	ADJ
bioscience-243	3	17	kingdom	kingdom	PROPN
bioscience-243	3	18	.	.	PUNCT
bioscience-243	4	1	hala	hala	PROPN
bioscience-243	4	2	abdelgaid	abdelgaid	PROPN
bioscience-243	4	3	,	,	PUNCT
bioscience-243	4	4	national	national	ADJ
bioscience-243	4	5	hepatology	hepatology	NOUN
bioscience-243	4	6	and	and	CCONJ
bioscience-243	4	7	tropical	tropical	ADJ
bioscience-243	4	8	medicine	medicine	PROPN
bioscience-243	4	9	research	research	PROPN
bioscience-243	4	10	institute	institute	PROPN
bioscience-243	4	11	(	(	PUNCT
bioscience-243	4	12	nhtmri	nhtmri	PROPN
bioscience-243	4	13	)	)	PUNCT
bioscience-243	4	14	corniche	corniche	PROPN
bioscience-243	4	15	el	el	PROPN
bioscience-243	4	16	nil	nil	PROPN
bioscience-243	4	17	,	,	PUNCT
bioscience-243	4	18	imbaba	imbaba	PROPN
bioscience-243	4	19	,	,	PUNCT
bioscience-243	4	20	giza	giza	PROPN
bioscience-243	4	21	12651	12651	NUM
bioscience-243	4	22	,	,	PUNCT
bioscience-243	4	23	egypt	egypt	PROPN
bioscience-243	4	24	.	.	PUNCT
bioscience-243	4	25	received	receive	VERB
bioscience-243	4	26	:	:	PUNCT
bioscience-243	4	27	december	december	PROPN
bioscience-243	4	28	20	20	NUM
bioscience-243	4	29	,	,	PUNCT
bioscience-243	4	30	2024	2024	NUM
bioscience-243	4	31	accepted	accept	VERB
bioscience-243	4	32	:	:	PUNCT
bioscience-243	4	33	april	april	PROPN
bioscience-243	4	34	25	25	NUM
bioscience-243	4	35	,	,	PUNCT
bioscience-243	4	36	2025	2025	NUM
bioscience-243	4	37	published	publish	VERB
bioscience-243	4	38	:	:	PUNCT
bioscience-243	4	39	may	may	AUX
bioscience-243	4	40	5	5	NUM
bioscience-243	4	41	,	,	PUNCT
bioscience-243	4	42	2025	2025	NUM
bioscience-243	4	43	citation	citation	NOUN
bioscience-243	4	44	:	:	PUNCT
bioscience-243	5	1	oktarianti	oktarianti	PROPN
bioscience-243	5	2	r	r	PROPN
bioscience-243	5	3	,	,	PUNCT
bioscience-243	5	4	nurdianti	nurdianti	PROPN
bioscience-243	5	5	f	f	NOUN
bioscience-243	5	6	,	,	PUNCT
bioscience-243	5	7	wathon	wathon	PROPN
bioscience-243	5	8	s	s	PROPN
bioscience-243	5	9	,	,	PUNCT
bioscience-243	5	10	senjarini	senjarini	PROPN
bioscience-243	5	11	k.	k.	PROPN
bioscience-243	5	12	in	in	ADP
bioscience-243	5	13	silico	silico	NOUN
bioscience-243	5	14	study	study	NOUN
bioscience-243	5	15	of	of	ADP
bioscience-243	5	16	the	the	DET
bioscience-243	5	17	interaction	interaction	NOUN
bioscience-243	5	18	between	between	ADP
bioscience-243	5	19	serotonin	serotonin	VERB
bioscience-243	5	20	and	and	CCONJ
bioscience-243	5	21	d7	d7	PROPN
bioscience-243	5	22	protein	protein	NOUN
bioscience-243	5	23	from	from	ADP
bioscience-243	5	24	the	the	DET
bioscience-243	5	25	salivary	salivary	ADJ
bioscience-243	5	26	gland	gland	NOUN
bioscience-243	5	27	of	of	ADP
bioscience-243	5	28	aedes	aedes	PROPN
bioscience-243	5	29	aegypti	aegypti	PROPN
bioscience-243	5	30	.	.	PUNCT
bioscience-243	6	1	2025	2025	NUM
bioscience-243	6	2	may	may	AUX
bioscience-243	6	3	5;8	5;8	NUM
bioscience-243	6	4	:	:	PUNCT
bioscience-243	6	5	bs202501	bs202501	ADJ
bioscience-243	6	6	copyright	copyright	NOUN
bioscience-243	6	7	:	:	PUNCT
bioscience-243	7	1	©	©	PROPN
bioscience-243	7	2	2025	2025	NUM
bioscience-243	7	3	oktarianti	oktarianti	NOUN
bioscience-243	7	4	r	r	NOUN
bioscience-243	7	5	et	et	NOUN
bioscience-243	7	6	al	al	PROPN
bioscience-243	7	7	..	..	PROPN
bioscience-243	8	1	this	this	PRON
bioscience-243	8	2	is	be	AUX
bioscience-243	8	3	an	an	DET
bioscience-243	8	4	open	open	ADJ
bioscience-243	8	5	access	access	NOUN
bioscience-243	8	6	article	article	NOUN
bioscience-243	8	7	distributed	distribute	VERB
bioscience-243	8	8	under	under	ADP
bioscience-243	8	9	the	the	DET
bioscience-243	8	10	terms	term	NOUN
bioscience-243	8	11	of	of	ADP
bioscience-243	8	12	the	the	DET
bioscience-243	8	13	creative	creative	ADJ
bioscience-243	8	14	commons	common	NOUN
bioscience-243	8	15	attribution	attribution	NOUN
bioscience-243	8	16	license	license	NOUN
bioscience-243	8	17	,	,	PUNCT
bioscience-243	8	18	which	which	PRON
bioscience-243	8	19	permits	permit	VERB
bioscience-243	8	20	unrestricted	unrestricted	ADJ
bioscience-243	8	21	use	use	NOUN
bioscience-243	8	22	,	,	PUNCT
bioscience-243	8	23	distribution	distribution	NOUN
bioscience-243	8	24	,	,	PUNCT
bioscience-243	8	25	and	and	CCONJ
bioscience-243	8	26	reproduction	reproduction	NOUN
bioscience-243	8	27	in	in	ADP
bioscience-243	8	28	any	any	DET
bioscience-243	8	29	medium	medium	NOUN
bioscience-243	8	30	,	,	PUNCT
bioscience-243	8	31	provided	provide	VERB
bioscience-243	8	32	the	the	DET
bioscience-243	8	33	original	original	ADJ
bioscience-243	8	34	author	author	NOUN
bioscience-243	8	35	and	and	CCONJ
bioscience-243	8	36	source	source	NOUN
bioscience-243	8	37	are	be	AUX
bioscience-243	8	38	credited	credit	VERB
bioscience-243	8	39	.	.	PUNCT
bioscience-243	9	1	data	datum	NOUN
bioscience-243	9	2	availability	availability	NOUN
bioscience-243	9	3	statement	statement	NOUN
bioscience-243	9	4	:	:	PUNCT
bioscience-243	9	5	all	all	DET
bioscience-243	9	6	relevant	relevant	ADJ
bioscience-243	9	7	data	datum	NOUN
bioscience-243	9	8	are	be	AUX
bioscience-243	9	9	within	within	ADP
bioscience-243	9	10	the	the	DET
bioscience-243	9	11	paper	paper	NOUN
bioscience-243	9	12	and	and	CCONJ
bioscience-243	9	13	supplementary	supplementary	ADJ
bioscience-243	9	14	materials	material	NOUN
bioscience-243	9	15	.	.	PUNCT
bioscience-243	10	1	funding	funding	NOUN
bioscience-243	10	2	:	:	PUNCT
bioscience-243	10	3	this	this	DET
bioscience-243	10	4	research	research	NOUN
bioscience-243	10	5	is	be	AUX
bioscience-243	10	6	supported	support	VERB
bioscience-243	10	7	by	by	ADP
bioscience-243	10	8	the	the	DET
bioscience-243	10	9	national	national	ADJ
bioscience-243	10	10	research	research	PROPN
bioscience-243	10	11	and	and	CCONJ
bioscience-243	10	12	innovation	innovation	NOUN
bioscience-243	10	13	agency	agency	NOUN
bioscience-243	10	14	(	(	PUNCT
bioscience-243	10	15	briin	briin	PROPN
bioscience-243	10	16	)	)	PUNCT
bioscience-243	10	17	through	through	ADP
bioscience-243	10	18	the	the	DET
bioscience-243	10	19	research	research	NOUN
bioscience-243	10	20	and	and	CCONJ
bioscience-243	10	21	innovation	innovation	NOUN
bioscience-243	10	22	program	program	NOUN
bioscience-243	10	23	for	for	ADP
bioscience-243	10	24	advanced	advanced	ADJ
bioscience-243	10	25	indonesia	indonesia	PROPN
bioscience-243	10	26	,	,	PUNCT
bioscience-243	10	27	batch	batch	VERB
bioscience-243	10	28	3	3	NUM
bioscience-243	10	29	,	,	PUNCT
bioscience-243	10	30	under	under	ADP
bioscience-243	10	31	reference	reference	NOUN
bioscience-243	10	32	number	number	NOUN
bioscience-243	10	33	12	12	NUM
bioscience-243	10	34	/	/	SYM
bioscience-243	10	35	ii.7	ii.7	NOUN
bioscience-243	10	36	/	/	SYM
bioscience-243	10	37	hk/2023	hk/2023	PROPN
bioscience-243	10	38	competing	compete	VERB
bioscience-243	10	39	interests	interest	NOUN
bioscience-243	10	40	:	:	PUNCT
bioscience-243	10	41	the	the	DET
bioscience-243	10	42	authors	author	NOUN
bioscience-243	10	43	declare	declare	VERB
bioscience-243	10	44	that	that	SCONJ
bioscience-243	10	45	they	they	PRON
bioscience-243	10	46	have	have	VERB
bioscience-243	10	47	no	no	DET
bioscience-243	10	48	competing	compete	VERB
bioscience-243	10	49	interests	interest	NOUN
bioscience-243	10	50	.	.	PUNCT
bioscience-243	11	1	in	in	ADP
bioscience-243	11	2	silico	silico	NOUN
bioscience-243	11	3	study	study	NOUN
bioscience-243	11	4	of	of	ADP
bioscience-243	11	5	the	the	DET
bioscience-243	11	6	interaction	interaction	NOUN
bioscience-243	11	7	between	between	ADP
bioscience-243	11	8	serotonin	serotonin	VERB
bioscience-243	11	9	and	and	CCONJ
bioscience-243	11	10	d7	d7	PROPN
bioscience-243	11	11	protein	protein	NOUN
bioscience-243	11	12	from	from	ADP
bioscience-243	11	13	the	the	DET
bioscience-243	11	14	salivary	salivary	ADJ
bioscience-243	11	15	gland	gland	NOUN
bioscience-243	11	16	of	of	ADP
bioscience-243	11	17	aedes	aedes	PROPN
bioscience-243	11	18	aegypti	aegypti	VERB
bioscience-243	11	19	rike	rike	VERB
bioscience-243	11	20	oktarianti1	oktarianti1	NOUN
bioscience-243	11	21	>	>	X
bioscience-243	11	22	<	<	X
bioscience-243	11	23	�	�	PROPN
bioscience-243	11	24	,	,	PUNCT
bioscience-243	11	25	faranisa	faranisa	NOUN
bioscience-243	11	26	nurdianti1	nurdianti1	NOUN
bioscience-243	11	27	>	>	X
bioscience-243	11	28	<	<	X
bioscience-243	11	29	,	,	PUNCT
bioscience-243	11	30	syubbanul	syubbanul	PROPN
bioscience-243	11	31	wathon1	wathon1	PROPN
bioscience-243	11	32	>	>	X
bioscience-243	11	33	<	<	X
bioscience-243	11	34	�	�	PROPN
bioscience-243	11	35	,	,	PUNCT
bioscience-243	11	36	kartika	kartika	PROPN
bioscience-243	11	37	senjarini1	senjarini1	PROPN
bioscience-243	12	1	>	>	PUNCT
bioscience-243	12	2	<	<	X
bioscience-243	12	3	�	�	PROPN
bioscience-243	12	4	abstract	abstract	ADJ
bioscience-243	12	5	protein	protein	NOUN
bioscience-243	12	6	components	component	NOUN
bioscience-243	12	7	of	of	ADP
bioscience-243	12	8	the	the	DET
bioscience-243	12	9	salivary	salivary	ADJ
bioscience-243	12	10	glands	gland	NOUN
bioscience-243	12	11	of	of	ADP
bioscience-243	12	12	disease	disease	NOUN
bioscience-243	12	13	vectors	vector	NOUN
bioscience-243	12	14	have	have	AUX
bioscience-243	12	15	been	be	AUX
bioscience-243	12	16	known	know	VERB
bioscience-243	12	17	to	to	PART
bioscience-243	12	18	facilitate	facilitate	VERB
bioscience-243	12	19	the	the	DET
bioscience-243	12	20	blood	blood	NOUN
bioscience-243	12	21	-	-	PUNCT
bioscience-243	12	22	feeding	feeding	NOUN
bioscience-243	12	23	process	process	NOUN
bioscience-243	12	24	in	in	ADP
bioscience-243	12	25	the	the	DET
bioscience-243	12	26	host	host	NOUN
bioscience-243	12	27	body	body	NOUN
bioscience-243	12	28	.	.	PUNCT
bioscience-243	13	1	the	the	DET
bioscience-243	13	2	main	main	ADJ
bioscience-243	13	3	component	component	NOUN
bioscience-243	13	4	of	of	ADP
bioscience-243	13	5	the	the	DET
bioscience-243	13	6	salivary	salivary	ADJ
bioscience-243	13	7	glands	gland	NOUN
bioscience-243	13	8	of	of	ADP
bioscience-243	13	9	aedes	aedes	PROPN
bioscience-243	13	10	aegypti	aegypti	VERB
bioscience-243	13	11	is	be	AUX
bioscience-243	13	12	the	the	DET
bioscience-243	13	13	immunogenic	immunogenic	ADJ
bioscience-243	13	14	d7	d7	PROPN
bioscience-243	13	15	protein	protein	NOUN
bioscience-243	13	16	.	.	PUNCT
bioscience-243	14	1	during	during	ADP
bioscience-243	14	2	the	the	DET
bioscience-243	14	3	blood	blood	NOUN
bioscience-243	14	4	-	-	PUNCT
bioscience-243	14	5	feeding	feeding	NOUN
bioscience-243	14	6	process	process	NOUN
bioscience-243	14	7	,	,	PUNCT
bioscience-243	14	8	the	the	DET
bioscience-243	14	9	d7	d7	PROPN
bioscience-243	14	10	protein	protein	NOUN
bioscience-243	14	11	can	can	AUX
bioscience-243	14	12	bind	bind	VERB
bioscience-243	14	13	to	to	ADP
bioscience-243	14	14	biogenic	biogenic	ADJ
bioscience-243	14	15	amine	amine	ADJ
bioscience-243	14	16	compounds	compound	NOUN
bioscience-243	14	17	,	,	PUNCT
bioscience-243	14	18	such	such	ADJ
bioscience-243	14	19	as	as	ADP
bioscience-243	14	20	serotonin	serotonin	NOUN
bioscience-243	14	21	,	,	PUNCT
bioscience-243	14	22	which	which	PRON
bioscience-243	14	23	is	be	AUX
bioscience-243	14	24	a	a	DET
bioscience-243	14	25	neurotransmitter	neurotransmitter	NOUN
bioscience-243	14	26	involved	involve	VERB
bioscience-243	14	27	in	in	ADP
bioscience-243	14	28	platelet	platelet	NOUN
bioscience-243	14	29	activation	activation	NOUN
bioscience-243	14	30	.	.	PUNCT
bioscience-243	15	1	this	this	DET
bioscience-243	15	2	ability	ability	NOUN
bioscience-243	15	3	indicates	indicate	VERB
bioscience-243	15	4	that	that	SCONJ
bioscience-243	15	5	the	the	DET
bioscience-243	15	6	d7	d7	PROPN
bioscience-243	15	7	protein	protein	NOUN
bioscience-243	15	8	can	can	AUX
bioscience-243	15	9	inhibit	inhibit	VERB
bioscience-243	15	10	the	the	DET
bioscience-243	15	11	platelet	platelet	NOUN
bioscience-243	15	12	aggregation	aggregation	NOUN
bioscience-243	15	13	process	process	NOUN
bioscience-243	15	14	.	.	PUNCT
bioscience-243	16	1	this	this	DET
bioscience-243	16	2	study	study	NOUN
bioscience-243	16	3	aims	aim	VERB
bioscience-243	16	4	to	to	PART
bioscience-243	16	5	explore	explore	VERB
bioscience-243	16	6	in	in	ADP
bioscience-243	16	7	silico	silico	NOUN
bioscience-243	16	8	the	the	DET
bioscience-243	16	9	interaction	interaction	NOUN
bioscience-243	16	10	between	between	ADP
bioscience-243	16	11	serotonin	serotonin	NOUN
bioscience-243	16	12	and	and	CCONJ
bioscience-243	16	13	the	the	DET
bioscience-243	16	14	d7	d7	PROPN
bioscience-243	16	15	protein	protein	NOUN
bioscience-243	16	16	from	from	ADP
bioscience-243	16	17	the	the	DET
bioscience-243	16	18	salivary	salivary	ADJ
bioscience-243	16	19	glands	gland	NOUN
bioscience-243	16	20	of	of	ADP
bioscience-243	16	21	ae	ae	PROPN
bioscience-243	16	22	.	.	PUNCT
bioscience-243	17	1	aegypti	aegypti	VERB
bioscience-243	17	2	using	use	VERB
bioscience-243	17	3	a	a	DET
bioscience-243	17	4	molecular	molecular	ADJ
bioscience-243	17	5	docking	docking	NOUN
bioscience-243	17	6	approach	approach	NOUN
bioscience-243	17	7	.	.	PUNCT
bioscience-243	18	1	the	the	DET
bioscience-243	18	2	methods	method	NOUN
bioscience-243	18	3	used	use	VERB
bioscience-243	18	4	in	in	ADP
bioscience-243	18	5	this	this	DET
bioscience-243	18	6	study	study	NOUN
bioscience-243	18	7	include	include	VERB
bioscience-243	18	8	the	the	DET
bioscience-243	18	9	selection	selection	NOUN
bioscience-243	18	10	of	of	ADP
bioscience-243	18	11	the	the	DET
bioscience-243	18	12	3d	3d	NUM
bioscience-243	18	13	structure	structure	NOUN
bioscience-243	18	14	of	of	ADP
bioscience-243	18	15	the	the	DET
bioscience-243	18	16	d7	d7	PROPN
bioscience-243	18	17	protein	protein	NOUN
bioscience-243	18	18	and	and	CCONJ
bioscience-243	18	19	serotonin	serotonin	VERB
bioscience-243	18	20	ligand	ligand	NOUN
bioscience-243	18	21	,	,	PUNCT
bioscience-243	18	22	preparation	preparation	NOUN
bioscience-243	18	23	of	of	ADP
bioscience-243	18	24	the	the	DET
bioscience-243	18	25	3d	3d	NUM
bioscience-243	18	26	structure	structure	NOUN
bioscience-243	18	27	of	of	ADP
bioscience-243	18	28	the	the	DET
bioscience-243	18	29	d7	d7	PROPN
bioscience-243	18	30	protein	protein	NOUN
bioscience-243	18	31	,	,	PUNCT
bioscience-243	18	32	native	native	ADJ
bioscience-243	18	33	ligands	ligand	NOUN
bioscience-243	18	34	,	,	PUNCT
bioscience-243	18	35	and	and	CCONJ
bioscience-243	18	36	test	test	NOUN
bioscience-243	18	37	ligands	ligand	NOUN
bioscience-243	18	38	,	,	PUNCT
bioscience-243	18	39	validation	validation	NOUN
bioscience-243	18	40	of	of	ADP
bioscience-243	18	41	the	the	DET
bioscience-243	18	42	molecular	molecular	ADJ
bioscience-243	18	43	docking	docking	NOUN
bioscience-243	18	44	method	method	NOUN
bioscience-243	18	45	,	,	PUNCT
bioscience-243	18	46	and	and	CCONJ
bioscience-243	18	47	analysis	analysis	NOUN
bioscience-243	18	48	and	and	CCONJ
bioscience-243	18	49	visualization	visualization	NOUN
bioscience-243	18	50	of	of	ADP
bioscience-243	18	51	the	the	DET
bioscience-243	18	52	molecular	molecular	ADJ
bioscience-243	18	53	docking	docking	NOUN
bioscience-243	18	54	results	result	NOUN
bioscience-243	18	55	.	.	PUNCT
bioscience-243	19	1	the	the	DET
bioscience-243	19	2	results	result	NOUN
bioscience-243	19	3	of	of	ADP
bioscience-243	19	4	molecular	molecular	ADJ
bioscience-243	19	5	docking	docking	NOUN
bioscience-243	19	6	between	between	ADP
bioscience-243	19	7	the	the	DET
bioscience-243	19	8	d7	d7	PROPN
bioscience-243	19	9	protein	protein	NOUN
bioscience-243	19	10	and	and	CCONJ
bioscience-243	19	11	the	the	DET
bioscience-243	19	12	serotonin	serotonin	NOUN
bioscience-243	19	13	ligand	ligand	NOUN
bioscience-243	19	14	showed	show	VERB
bioscience-243	19	15	a	a	DET
bioscience-243	19	16	∆g	∆g	PROPN
bioscience-243	19	17	value	value	NOUN
bioscience-243	19	18	for	for	ADP
bioscience-243	19	19	the	the	DET
bioscience-243	19	20	interaction	interaction	NOUN
bioscience-243	19	21	of	of	ADP
bioscience-243	19	22	−9.25	−9.25	PROPN
bioscience-243	19	23	kcal	kcal	PROPN
bioscience-243	19	24	/	/	SYM
bioscience-243	19	25	mol	mol	PROPN
bioscience-243	19	26	.	.	PUNCT
bioscience-243	20	1	the	the	DET
bioscience-243	20	2	serotonin	serotonin	NOUN
bioscience-243	20	3	ligand	ligand	NOUN
bioscience-243	20	4	binds	bind	VERB
bioscience-243	20	5	to	to	ADP
bioscience-243	20	6	the	the	DET
bioscience-243	20	7	active	active	ADJ
bioscience-243	20	8	site	site	NOUN
bioscience-243	20	9	of	of	ADP
bioscience-243	20	10	the	the	DET
bioscience-243	20	11	d7	d7	PROPN
bioscience-243	20	12	protein	protein	NOUN
bioscience-243	20	13	through	through	ADP
bioscience-243	20	14	several	several	ADJ
bioscience-243	20	15	amino	amino	NOUN
bioscience-243	20	16	acid	acid	NOUN
bioscience-243	20	17	residues	residue	NOUN
bioscience-243	20	18	,	,	PUNCT
bioscience-243	20	19	including	include	VERB
bioscience-243	20	20	glu	glu	NOUN
bioscience-243	20	21	158	158	NUM
bioscience-243	20	22	,	,	PUNCT
bioscience-243	20	23	ile	ile	PROPN
bioscience-243	20	24	175	175	NUM
bioscience-243	20	25	,	,	PUNCT
bioscience-243	20	26	arg	arg	NOUN
bioscience-243	20	27	176	176	NUM
bioscience-243	20	28	,	,	PUNCT
bioscience-243	20	29	tyr	tyr	PROPN
bioscience-243	20	30	178	178	NUM
bioscience-243	20	31	,	,	PUNCT
bioscience-243	20	32	tyr	tyr	PROPN
bioscience-243	20	33	248	248	NUM
bioscience-243	20	34	,	,	PUNCT
bioscience-243	20	35	asp	asp	NOUN
bioscience-243	20	36	265	265	NUM
bioscience-243	20	37	,	,	PUNCT
bioscience-243	20	38	and	and	CCONJ
bioscience-243	20	39	glu	glu	PROPN
bioscience-243	20	40	268	268	NUM
bioscience-243	20	41	.	.	PUNCT
bioscience-243	21	1	these	these	DET
bioscience-243	21	2	amino	amino	NOUN
bioscience-243	21	3	acid	acid	NOUN
bioscience-243	21	4	residues	residue	NOUN
bioscience-243	21	5	of	of	ADP
bioscience-243	21	6	the	the	DET
bioscience-243	21	7	d7	d7	PROPN
bioscience-243	21	8	protein	protein	NOUN
bioscience-243	21	9	bind	bind	VERB
bioscience-243	21	10	to	to	ADP
bioscience-243	21	11	atoms	atom	NOUN
bioscience-243	21	12	on	on	ADP
bioscience-243	21	13	the	the	DET
bioscience-243	21	14	serotonin	serotonin	NOUN
bioscience-243	21	15	ligand	ligand	NOUN
bioscience-243	21	16	through	through	ADP
bioscience-243	21	17	conventional	conventional	ADJ
bioscience-243	21	18	hydrogen	hydrogen	NOUN
bioscience-243	21	19	bonds	bond	NOUN
bioscience-243	21	20	,	,	PUNCT
bioscience-243	21	21	carbon	carbon	NOUN
bioscience-243	21	22	hydrogen	hydrogen	NOUN
bioscience-243	21	23	bonds	bond	NOUN
bioscience-243	21	24	,	,	PUNCT
bioscience-243	21	25	π	π	PROPN
bioscience-243	21	26	-	-	PUNCT
bioscience-243	21	27	σ	σ	NOUN
bioscience-243	21	28	bonds	bond	NOUN
bioscience-243	21	29	,	,	PUNCT
bioscience-243	21	30	π	π	PROPN
bioscience-243	21	31	-	-	PUNCT
bioscience-243	21	32	π	π	PROPN
bioscience-243	21	33	t	t	NOUN
bioscience-243	21	34	-	-	PUNCT
bioscience-243	21	35	shaped	shape	VERB
bioscience-243	21	36	bonds	bond	NOUN
bioscience-243	21	37	,	,	PUNCT
bioscience-243	21	38	and	and	CCONJ
bioscience-243	21	39	π	π	X
bioscience-243	21	40	-	-	ADJ
bioscience-243	21	41	alkyl	alkyl	ADJ
bioscience-243	21	42	bonds	bond	NOUN
bioscience-243	21	43	.	.	PUNCT
bioscience-243	22	1	based	base	VERB
bioscience-243	22	2	on	on	ADP
bioscience-243	22	3	the	the	PRON
bioscience-243	22	4	in	in	ADP
bioscience-243	22	5	silico	silico	NOUN
bioscience-243	22	6	data	datum	NOUN
bioscience-243	22	7	,	,	PUNCT
bioscience-243	22	8	it	it	PRON
bioscience-243	22	9	is	be	AUX
bioscience-243	22	10	shown	show	VERB
bioscience-243	22	11	that	that	SCONJ
bioscience-243	22	12	the	the	DET
bioscience-243	22	13	d7	d7	PROPN
bioscience-243	22	14	protein	protein	NOUN
bioscience-243	22	15	from	from	ADP
bioscience-243	22	16	the	the	DET
bioscience-243	22	17	salivary	salivary	ADJ
bioscience-243	22	18	glands	gland	NOUN
bioscience-243	22	19	of	of	ADP
bioscience-243	22	20	ae	ae	PROPN
bioscience-243	22	21	.	.	PUNCT
bioscience-243	23	1	aegypti	aegypti	PROPN
bioscience-243	23	2	can	can	AUX
bioscience-243	23	3	bind	bind	VERB
bioscience-243	23	4	stably	stably	ADV
bioscience-243	23	5	and	and	CCONJ
bioscience-243	23	6	spontaneously	spontaneously	ADV
bioscience-243	23	7	to	to	PART
bioscience-243	23	8	serotonin	serotonin	VERB
bioscience-243	23	9	ligands	ligand	NOUN
bioscience-243	23	10	.	.	PUNCT
bioscience-243	24	1	this	this	PRON
bioscience-243	24	2	indicates	indicate	VERB
bioscience-243	24	3	that	that	SCONJ
bioscience-243	24	4	the	the	DET
bioscience-243	24	5	d7	d7	PROPN
bioscience-243	24	6	protein	protein	NOUN
bioscience-243	24	7	has	have	VERB
bioscience-243	24	8	potential	potential	ADJ
bioscience-243	24	9	as	as	ADP
bioscience-243	24	10	a	a	DET
bioscience-243	24	11	platelet	platelet	NOUN
bioscience-243	24	12	aggregation	aggregation	NOUN
bioscience-243	24	13	inhibitor	inhibitor	NOUN
bioscience-243	24	14	agent	agent	NOUN
bioscience-243	24	15	for	for	ADP
bioscience-243	24	16	the	the	DET
bioscience-243	24	17	development	development	NOUN
bioscience-243	24	18	of	of	ADP
bioscience-243	24	19	drug	drug	NOUN
bioscience-243	24	20	discovery	discovery	NOUN
bioscience-243	24	21	in	in	ADP
bioscience-243	24	22	the	the	DET
bioscience-243	24	23	fields	field	NOUN
bioscience-243	24	24	of	of	ADP
bioscience-243	24	25	health	health	NOUN
bioscience-243	24	26	and	and	CCONJ
bioscience-243	24	27	pharmacy	pharmacy	NOUN
bioscience-243	24	28	.	.	PUNCT
bioscience-243	25	1	keywords	keyword	NOUN
bioscience-243	25	2	:	:	PUNCT
bioscience-243	25	3	aedes	aedes	PROPN
bioscience-243	25	4	aegypti	aegypti	PROPN
bioscience-243	25	5	,	,	PUNCT
bioscience-243	25	6	d7	d7	PROPN
bioscience-243	25	7	protein	protein	NOUN
bioscience-243	25	8	,	,	PUNCT
bioscience-243	25	9	molecular	molecular	ADJ
bioscience-243	25	10	docking	docking	NOUN
bioscience-243	25	11	,	,	PUNCT
bioscience-243	25	12	serotonin	serotonin	VERB
bioscience-243	25	13	,	,	PUNCT
bioscience-243	25	14	platelet	platelet	NOUN
bioscience-243	25	15	aggregation	aggregation	NOUN
bioscience-243	25	16	introduction	introduction	NOUN
bioscience-243	25	17	the	the	DET
bioscience-243	25	18	salivary	salivary	ADJ
bioscience-243	25	19	glands	gland	NOUN
bioscience-243	25	20	of	of	ADP
bioscience-243	25	21	disease	disease	NOUN
bioscience-243	25	22	vector	vector	NOUN
bioscience-243	25	23	arthropods	arthropod	NOUN
bioscience-243	25	24	are	be	AUX
bioscience-243	25	25	known	know	VERB
bioscience-243	25	26	to	to	PART
bioscience-243	25	27	be	be	AUX
bioscience-243	25	28	important	important	ADJ
bioscience-243	25	29	organs	organ	NOUN
bioscience-243	25	30	for	for	ADP
bioscience-243	25	31	the	the	DET
bioscience-243	25	32	success	success	NOUN
bioscience-243	25	33	of	of	ADP
bioscience-243	25	34	the	the	DET
bioscience-243	25	35	blood	blood	NOUN
bioscience-243	25	36	-	-	PUNCT
bioscience-243	25	37	feeding	feeding	NOUN
bioscience-243	25	38	process	process	NOUN
bioscience-243	25	39	in	in	ADP
bioscience-243	25	40	the	the	DET
bioscience-243	25	41	host	host	NOUN
bioscience-243	25	42	body	body	NOUN
bioscience-243	26	1	[	[	X
bioscience-243	26	2	1	1	NUM
bioscience-243	26	3	]	]	PUNCT
bioscience-243	26	4	.	.	PUNCT
bioscience-243	27	1	this	this	PRON
bioscience-243	27	2	is	be	AUX
bioscience-243	27	3	because	because	SCONJ
bioscience-243	27	4	the	the	DET
bioscience-243	27	5	salivary	salivary	ADJ
bioscience-243	27	6	glands	gland	NOUN
bioscience-243	27	7	contain	contain	VERB
bioscience-243	27	8	various	various	ADJ
bioscience-243	27	9	bioactive	bioactive	ADJ
bioscience-243	27	10	components	component	NOUN
bioscience-243	27	11	that	that	PRON
bioscience-243	27	12	can	can	AUX
bioscience-243	27	13	suppress	suppress	VERB
bioscience-243	27	14	the	the	DET
bioscience-243	27	15	host	host	NOUN
bioscience-243	27	16	’s	’s	PART
bioscience-243	27	17	immune	immune	ADJ
bioscience-243	27	18	response	response	NOUN
bioscience-243	27	19	.	.	PUNCT
bioscience-243	28	1	in	in	ADP
bioscience-243	28	2	general	general	ADJ
bioscience-243	28	3	,	,	PUNCT
bioscience-243	28	4	components	component	NOUN
bioscience-243	28	5	in	in	ADP
bioscience-243	28	6	the	the	DET
bioscience-243	28	7	salivary	salivary	ADJ
bioscience-243	28	8	glands	gland	NOUN
bioscience-243	28	9	of	of	ADP
bioscience-243	28	10	disease	disease	NOUN
bioscience-243	28	11	vectors	vector	NOUN
bioscience-243	28	12	act	act	VERB
bioscience-243	28	13	as	as	ADP
bioscience-243	28	14	vasodilator	vasodilator	NOUN
bioscience-243	28	15	and	and	CCONJ
bioscience-243	28	16	immunomodulatory	immunomodulatory	ADJ
bioscience-243	28	17	factors	factor	NOUN
bioscience-243	28	18	that	that	PRON
bioscience-243	28	19	can	can	AUX
bioscience-243	28	20	affect	affect	VERB
bioscience-243	28	21	the	the	DET
bioscience-243	28	22	host	host	NOUN
bioscience-243	28	23	’s	’s	PART
bioscience-243	28	24	hemostasis	hemostasis	NOUN
bioscience-243	29	1	[	[	X
bioscience-243	29	2	2	2	NUM
bioscience-243	29	3	]	]	PUNCT
bioscience-243	29	4	.	.	PUNCT
bioscience-243	30	1	several	several	ADJ
bioscience-243	30	2	previous	previous	ADJ
bioscience-243	30	3	studies	study	NOUN
bioscience-243	30	4	have	have	AUX
bioscience-243	30	5	identified	identify	VERB
bioscience-243	30	6	components	component	NOUN
bioscience-243	30	7	of	of	ADP
bioscience-243	30	8	the	the	DET
bioscience-243	30	9	salivary	salivary	ADJ
bioscience-243	30	10	glands	gland	NOUN
bioscience-243	30	11	of	of	ADP
bioscience-243	30	12	disease	disease	NOUN
bioscience-243	30	13	vectors	vector	NOUN
bioscience-243	30	14	that	that	PRON
bioscience-243	30	15	affect	affect	VERB
bioscience-243	30	16	the	the	DET
bioscience-243	30	17	host	host	NOUN
bioscience-243	30	18	’s	’s	PART
bioscience-243	30	19	immune	immune	ADJ
bioscience-243	30	20	response	response	NOUN
bioscience-243	30	21	,	,	PUNCT
bioscience-243	30	22	including	include	VERB
bioscience-243	30	23	bioactive	bioactive	ADJ
bioscience-243	30	24	components	component	NOUN
bioscience-243	30	25	in	in	ADP
bioscience-243	30	26	the	the	DET
bioscience-243	30	27	salivary	salivary	ADJ
bioscience-243	30	28	glands	gland	NOUN
bioscience-243	30	29	of	of	ADP
bioscience-243	30	30	aedes	aedes	PROPN
bioscience-243	30	31	aegypti	aegypti	VERB
bioscience-243	30	32	as	as	ADP
bioscience-243	30	33	a	a	DET
bioscience-243	30	34	vector	vector	NOUN
bioscience-243	30	35	of	of	ADP
bioscience-243	30	36	dengue	dengue	NOUN
bioscience-243	30	37	fever	fever	NOUN
bioscience-243	30	38	[	[	X
bioscience-243	30	39	3	3	NUM
bioscience-243	30	40	;	;	PUNCT
bioscience-243	30	41	4	4	NUM
bioscience-243	30	42	]	]	PUNCT
bioscience-243	30	43	.	.	PUNCT
bioscience-243	31	1	the	the	DET
bioscience-243	31	2	salivary	salivary	ADJ
bioscience-243	31	3	glands	gland	NOUN
bioscience-243	31	4	of	of	ADP
bioscience-243	31	5	ae	ae	PROPN
bioscience-243	31	6	.	.	PUNCT
bioscience-243	32	1	aegypti	aegypti	NOUN
bioscience-243	32	2	contain	contain	VERB
bioscience-243	32	3	various	various	ADJ
bioscience-243	32	4	types	type	NOUN
bioscience-243	32	5	of	of	ADP
bioscience-243	32	6	bioactive	bioactive	ADJ
bioscience-243	32	7	components	component	NOUN
bioscience-243	32	8	in	in	ADP
bioscience-243	32	9	the	the	DET
bioscience-243	32	10	form	form	NOUN
bioscience-243	32	11	of	of	ADP
bioscience-243	32	12	protein	protein	NOUN
bioscience-243	32	13	molecules	molecule	NOUN
bioscience-243	32	14	.	.	PUNCT
bioscience-243	33	1	the	the	DET
bioscience-243	33	2	protein	protein	NOUN
bioscience-243	33	3	components	component	NOUN
bioscience-243	33	4	of	of	ADP
bioscience-243	33	5	the	the	DET
bioscience-243	33	6	salivary	salivary	ADJ
bioscience-243	33	7	glands	gland	NOUN
bioscience-243	33	8	of	of	ADP
bioscience-243	33	9	ae	ae	PROPN
bioscience-243	33	10	.	.	PUNCT
bioscience-243	34	1	aegypti	aegypti	PROPN
bioscience-243	34	2	generally	generally	ADV
bioscience-243	34	3	include	include	VERB
bioscience-243	34	4	apyrase	apyrase	NOUN
bioscience-243	34	5	,	,	PUNCT
bioscience-243	34	6	aegyptin	aegyptin	PROPN
bioscience-243	34	7	,	,	PUNCT
bioscience-243	34	8	serpin	serpin	PROPN
bioscience-243	34	9	,	,	PUNCT
bioscience-243	34	10	and	and	CCONJ
bioscience-243	34	11	the	the	DET
bioscience-243	34	12	d7	d7	PROPN
bioscience-243	34	13	family	family	NOUN
bioscience-243	35	1	[	[	X
bioscience-243	35	2	5	5	NUM
bioscience-243	35	3	]	]	PUNCT
bioscience-243	35	4	.	.	PUNCT
bioscience-243	36	1	the	the	DET
bioscience-243	36	2	apyrase	apyrase	NOUN
bioscience-243	36	3	protein	protein	NOUN
bioscience-243	36	4	has	have	VERB
bioscience-243	36	5	the	the	DET
bioscience-243	36	6	activity	activity	NOUN
bioscience-243	36	7	to	to	PART
bioscience-243	36	8	hydrolyze	hydrolyze	VERB
bioscience-243	36	9	atp	atp	PROPN
bioscience-243	36	10	into	into	ADP
bioscience-243	36	11	adp	adp	PROPN
bioscience-243	36	12	and	and	CCONJ
bioscience-243	36	13	amp	amp	PROPN
bioscience-243	36	14	,	,	PUNCT
bioscience-243	36	15	which	which	PRON
bioscience-243	36	16	can	can	AUX
bioscience-243	36	17	inhibit	inhibit	VERB
bioscience-243	36	18	platelet	platelet	NOUN
bioscience-243	36	19	activation	activation	NOUN
bioscience-243	36	20	[	[	X
bioscience-243	36	21	6	6	NUM
bioscience-243	36	22	]	]	PUNCT
bioscience-243	36	23	.	.	PUNCT
bioscience-243	37	1	aegyptin	aegyptin	PROPN
bioscience-243	37	2	is	be	AUX
bioscience-243	37	3	an	an	DET
bioscience-243	37	4	allergen	allergen	NOUN
bioscience-243	37	5	that	that	PRON
bioscience-243	37	6	can	can	AUX
bioscience-243	37	7	bind	bind	VERB
bioscience-243	37	8	to	to	ADP
bioscience-243	37	9	collagen	collagen	NOUN
bioscience-243	37	10	and	and	CCONJ
bioscience-243	37	11	von	von	PROPN
bioscience-243	37	12	willebrand	willebrand	NOUN
bioscience-243	37	13	factor	factor	NOUN
bioscience-243	37	14	,	,	PUNCT
bioscience-243	37	15	reducing	reduce	VERB
bioscience-243	37	16	the	the	DET
bioscience-243	37	17	formation	formation	NOUN
bioscience-243	37	18	of	of	ADP
bioscience-243	37	19	blood	blood	NOUN
bioscience-243	37	20	clots	clot	NOUN
bioscience-243	37	21	[	[	X
bioscience-243	37	22	7	7	NUM
bioscience-243	37	23	]	]	PUNCT
bioscience-243	37	24	.	.	PUNCT
bioscience-243	38	1	serpin	serpin	PROPN
bioscience-243	38	2	is	be	AUX
bioscience-243	38	3	a	a	DET
bioscience-243	38	4	protease	protease	NOUN
bioscience-243	38	5	inhibitor	inhibitor	NOUN
bioscience-243	38	6	that	that	PRON
bioscience-243	38	7	inhibits	inhibit	VERB
bioscience-243	38	8	the	the	DET
bioscience-243	38	9	activity	activity	NOUN
bioscience-243	38	10	of	of	ADP
bioscience-243	38	11	serine	serine	NOUN
bioscience-243	38	12	proteases	protease	NOUN
bioscience-243	38	13	in	in	ADP
bioscience-243	38	14	various	various	ADJ
bioscience-243	38	15	host	host	NOUN
bioscience-243	38	16	hemostasis	hemostasis	NOUN
bioscience-243	38	17	reactions	reaction	NOUN
bioscience-243	38	18	[	[	X
bioscience-243	38	19	8	8	NUM
bioscience-243	38	20	]	]	PUNCT
bioscience-243	38	21	.	.	PUNCT
bioscience-243	39	1	the	the	DET
bioscience-243	39	2	d7	d7	PROPN
bioscience-243	39	3	protein	protein	NOUN
bioscience-243	39	4	is	be	AUX
bioscience-243	39	5	known	know	VERB
bioscience-243	39	6	to	to	PART
bioscience-243	39	7	be	be	AUX
bioscience-243	39	8	the	the	DET
bioscience-243	39	9	most	most	ADV
bioscience-243	39	10	abundant	abundant	ADJ
bioscience-243	39	11	component	component	NOUN
bioscience-243	39	12	in	in	ADP
bioscience-243	39	13	the	the	DET
bioscience-243	39	14	salivary	salivary	ADJ
bioscience-243	39	15	glands	gland	NOUN
bioscience-243	39	16	of	of	ADP
bioscience-243	39	17	ae	ae	PROPN
bioscience-243	39	18	.	.	PUNCT
bioscience-243	40	1	aegypti	aegypti	VERB
bioscience-243	40	2	[	[	PUNCT
bioscience-243	40	3	9	9	NUM
bioscience-243	40	4	]	]	PUNCT
bioscience-243	40	5	.	.	PUNCT
bioscience-243	41	1	ae	ae	PROPN
bioscience-243	41	2	.	.	PUNCT
bioscience-243	42	1	aegypti	aegypti	PROPN
bioscience-243	42	2	performs	perform	VERB
bioscience-243	42	3	the	the	DET
bioscience-243	42	4	blood	blood	NOUN
bioscience-243	42	5	-	-	PUNCT
bioscience-243	42	6	feeding	feeding	NOUN
bioscience-243	42	7	process	process	NOUN
bioscience-243	42	8	on	on	ADP
bioscience-243	42	9	the	the	DET
bioscience-243	42	10	host	host	NOUN
bioscience-243	42	11	’s	’s	PART
bioscience-243	42	12	body	body	NOUN
bioscience-243	42	13	by	by	ADP
bioscience-243	42	14	inserting	insert	VERB
bioscience-243	42	15	its	its	PRON
bioscience-243	42	16	proboscis	proboscis	NOUN
bioscience-243	42	17	into	into	ADP
bioscience-243	42	18	the	the	DET
bioscience-243	42	19	skin	skin	NOUN
bioscience-243	42	20	layer	layer	NOUN
bioscience-243	42	21	until	until	SCONJ
bioscience-243	42	22	it	it	PRON
bioscience-243	42	23	reaches	reach	VERB
bioscience-243	42	24	the	the	DET
bioscience-243	42	25	endothelium	endothelium	NOUN
bioscience-243	42	26	of	of	ADP
bioscience-243	42	27	the	the	DET
bioscience-243	42	28	blood	blood	NOUN
bioscience-243	42	29	vessels	vessel	NOUN
bioscience-243	42	30	.	.	PUNCT
bioscience-243	43	1	the	the	DET
bioscience-243	43	2	host	host	NOUN
bioscience-243	43	3	’s	’s	PART
bioscience-243	43	4	body	body	NOUN
bioscience-243	43	5	responds	respond	VERB
bioscience-243	43	6	to	to	ADP
bioscience-243	43	7	this	this	DET
bioscience-243	43	8	action	action	NOUN
bioscience-243	43	9	by	by	ADP
bioscience-243	43	10	releasing	release	VERB
bioscience-243	43	11	biogenic	biogenic	ADJ
bioscience-243	43	12	amine	amine	ADJ
bioscience-243	43	13	compounds	compound	NOUN
bioscience-243	43	14	to	to	PART
bioscience-243	43	15	stop	stop	VERB
bioscience-243	43	16	the	the	DET
bioscience-243	43	17	blood	blood	NOUN
bioscience-243	43	18	flow	flow	NOUN
bioscience-243	43	19	through	through	ADP
bioscience-243	43	20	the	the	DET
bioscience-243	43	21	mechanism	mechanism	NOUN
bioscience-243	43	22	of	of	ADP
bioscience-243	43	23	highlights	highlight	NOUN
bioscience-243	43	24	in	in	ADP
bioscience-243	43	25	bioscience	bioscience	NOUN
bioscience-243	43	26	page	page	NOUN
bioscience-243	43	27	1	1	NUM
bioscience-243	43	28	of	of	ADP
bioscience-243	43	29	9	9	NUM
bioscience-243	43	30	may	may	PROPN
bioscience-243	43	31	2025|volume	2025|volume	NUM
bioscience-243	43	32	8	8	NUM
bioscience-243	43	33	https://doi.org/10.36462/h.biosci.202501	https://doi.org/10.36462/h.biosci.202501	ADJ
bioscience-243	43	34	https://creativecommons.org/licenses/by/4.0/	https://creativecommons.org/licenses/by/4.0/	PROPN
bioscience-243	43	35	mailto:rike.fmipa@unej.ac.id	mailto:rike.fmipa@unej.ac.id	PROPN
bioscience-243	43	36	https://orcid.org/0000-0001-9402-7746	https://orcid.org/0000-0001-9402-7746	PROPN
bioscience-243	43	37	mailto:201810401060@mail.unej.ac.id	mailto:201810401060@mail.unej.ac.id	ADJ
bioscience-243	43	38	mailto:syubbanulwathon@unej.ac.id	mailto:syubbanulwathon@unej.ac.id	NOUN
bioscience-243	43	39	https://orcid.org/0000-0003-2935-7786	https://orcid.org/0000-0003-2935-7786	PROPN
bioscience-243	43	40	mailto:senjarini@unej.ac.id	mailto:senjarini@unej.ac.id	PROPN
bioscience-243	43	41	https://orcid.org/0000-0001-7041-1719	https://orcid.org/0000-0001-7041-1719	PROPN
bioscience-243	43	42	http://bioscience.highlightsin.org/	http://bioscience.highlightsin.org/	ADV
bioscience-243	44	1	oktarianti	oktarianti	INTJ
bioscience-243	45	1	r	r	NOUN
bioscience-243	45	2	et	et	NOUN
bioscience-243	45	3	al	al	PROPN
bioscience-243	45	4	.	.	PROPN
bioscience-243	45	5	,	,	PUNCT
bioscience-243	45	6	2025	2025	NUM
bioscience-243	45	7	in	in	ADP
bioscience-243	45	8	silico	silico	NOUN
bioscience-243	45	9	study	study	NOUN
bioscience-243	45	10	of	of	ADP
bioscience-243	45	11	the	the	DET
bioscience-243	45	12	interaction	interaction	NOUN
bioscience-243	45	13	between	between	ADP
bioscience-243	45	14	serotonin	serotonin	VERB
bioscience-243	45	15	and	and	CCONJ
bioscience-243	45	16	d7	d7	PROPN
bioscience-243	45	17	protein	protein	NOUN
bioscience-243	45	18	platelet	platelet	NOUN
bioscience-243	45	19	aggregation	aggregation	NOUN
bioscience-243	45	20	.	.	PUNCT
bioscience-243	46	1	during	during	ADP
bioscience-243	46	2	the	the	DET
bioscience-243	46	3	blood	blood	NOUN
bioscience-243	46	4	-	-	PUNCT
bioscience-243	46	5	feeding	feeding	NOUN
bioscience-243	46	6	process	process	NOUN
bioscience-243	46	7	,	,	PUNCT
bioscience-243	46	8	ae	ae	PROPN
bioscience-243	46	9	.	.	PUNCT
bioscience-243	46	10	aegypti	aegypti	VERB
bioscience-243	46	11	releases	release	VERB
bioscience-243	46	12	the	the	DET
bioscience-243	46	13	d7	d7	PROPN
bioscience-243	46	14	protein	protein	NOUN
bioscience-243	46	15	component	component	NOUN
bioscience-243	46	16	from	from	ADP
bioscience-243	46	17	its	its	PRON
bioscience-243	46	18	salivary	salivary	ADJ
bioscience-243	46	19	glands	gland	NOUN
bioscience-243	46	20	into	into	ADP
bioscience-243	46	21	the	the	DET
bioscience-243	46	22	host	host	NOUN
bioscience-243	46	23	’s	’s	PART
bioscience-243	46	24	body	body	NOUN
bioscience-243	46	25	.	.	PUNCT
bioscience-243	47	1	the	the	DET
bioscience-243	47	2	d7	d7	PROPN
bioscience-243	47	3	protein	protein	NOUN
bioscience-243	47	4	has	have	VERB
bioscience-243	47	5	a	a	DET
bioscience-243	47	6	high	high	ADJ
bioscience-243	47	7	affinity	affinity	NOUN
bioscience-243	47	8	for	for	ADP
bioscience-243	47	9	biogenic	biogenic	ADJ
bioscience-243	47	10	amine	amine	ADJ
bioscience-243	47	11	compounds	compound	NOUN
bioscience-243	47	12	,	,	PUNCT
bioscience-243	47	13	such	such	ADJ
bioscience-243	47	14	as	as	ADP
bioscience-243	47	15	norepinephrine	norepinephrine	NOUN
bioscience-243	47	16	,	,	PUNCT
bioscience-243	47	17	histamine	histamine	NOUN
bioscience-243	47	18	,	,	PUNCT
bioscience-243	47	19	and	and	CCONJ
bioscience-243	47	20	serotonin	serotonin	VERB
bioscience-243	47	21	[	[	NOUN
bioscience-243	47	22	10	10	NUM
bioscience-243	47	23	]	]	PUNCT
bioscience-243	47	24	.	.	PUNCT
bioscience-243	48	1	serotonin	serotonin	NOUN
bioscience-243	48	2	is	be	AUX
bioscience-243	48	3	a	a	DET
bioscience-243	48	4	type	type	NOUN
bioscience-243	48	5	of	of	ADP
bioscience-243	48	6	biogenic	biogenic	ADJ
bioscience-243	48	7	amine	amine	NOUN
bioscience-243	48	8	that	that	PRON
bioscience-243	48	9	plays	play	VERB
bioscience-243	48	10	an	an	DET
bioscience-243	48	11	important	important	ADJ
bioscience-243	48	12	role	role	NOUN
bioscience-243	48	13	in	in	ADP
bioscience-243	48	14	platelet	platelet	NOUN
bioscience-243	48	15	activation	activation	NOUN
bioscience-243	48	16	[	[	X
bioscience-243	48	17	11	11	NUM
bioscience-243	48	18	]	]	PUNCT
bioscience-243	48	19	.	.	PUNCT
bioscience-243	49	1	when	when	SCONJ
bioscience-243	49	2	the	the	DET
bioscience-243	49	3	d7	d7	PROPN
bioscience-243	49	4	protein	protein	NOUN
bioscience-243	49	5	from	from	ADP
bioscience-243	49	6	the	the	DET
bioscience-243	49	7	salivary	salivary	ADJ
bioscience-243	49	8	glands	gland	NOUN
bioscience-243	49	9	of	of	ADP
bioscience-243	49	10	ae	ae	PROPN
bioscience-243	49	11	.	.	PUNCT
bioscience-243	50	1	aegypti	aegypti	VERB
bioscience-243	50	2	binds	bind	VERB
bioscience-243	50	3	to	to	PART
bioscience-243	50	4	serotonin	serotonin	VERB
bioscience-243	50	5	,	,	PUNCT
bioscience-243	50	6	the	the	DET
bioscience-243	50	7	process	process	NOUN
bioscience-243	50	8	of	of	ADP
bioscience-243	50	9	platelet	platelet	NOUN
bioscience-243	50	10	aggregation	aggregation	NOUN
bioscience-243	50	11	around	around	ADP
bioscience-243	50	12	the	the	DET
bioscience-243	50	13	host	host	NOUN
bioscience-243	50	14	’s	’s	PART
bioscience-243	50	15	wound	wound	NOUN
bioscience-243	50	16	is	be	AUX
bioscience-243	50	17	inhibited	inhibit	VERB
bioscience-243	50	18	,	,	PUNCT
bioscience-243	50	19	allowing	allow	VERB
bioscience-243	50	20	the	the	DET
bioscience-243	50	21	blood	blood	NOUN
bioscience-243	50	22	-	-	PUNCT
bioscience-243	50	23	feeding	feed	VERB
bioscience-243	50	24	process	process	NOUN
bioscience-243	50	25	to	to	PART
bioscience-243	50	26	proceed	proceed	VERB
bioscience-243	50	27	smoothly	smoothly	ADV
bioscience-243	50	28	.	.	PUNCT
bioscience-243	51	1	this	this	DET
bioscience-243	51	2	activity	activity	NOUN
bioscience-243	51	3	indicates	indicate	VERB
bioscience-243	51	4	that	that	SCONJ
bioscience-243	51	5	the	the	DET
bioscience-243	51	6	d7	d7	PROPN
bioscience-243	51	7	protein	protein	NOUN
bioscience-243	51	8	can	can	AUX
bioscience-243	51	9	inhibit	inhibit	VERB
bioscience-243	51	10	the	the	DET
bioscience-243	51	11	platelet	platelet	NOUN
bioscience-243	51	12	aggregation	aggregation	NOUN
bioscience-243	51	13	process	process	NOUN
bioscience-243	51	14	in	in	ADP
bioscience-243	51	15	the	the	DET
bioscience-243	51	16	host	host	NOUN
bioscience-243	51	17	’s	’s	PART
bioscience-243	51	18	body	body	NOUN
bioscience-243	51	19	.	.	PUNCT
bioscience-243	52	1	d7	d7	PROPN
bioscience-243	52	2	has	have	VERB
bioscience-243	52	3	the	the	DET
bioscience-243	52	4	ability	ability	NOUN
bioscience-243	52	5	to	to	PART
bioscience-243	52	6	block	block	VERB
bioscience-243	52	7	platelet	platelet	NOUN
bioscience-243	52	8	aggregation	aggregation	NOUN
bioscience-243	52	9	,	,	PUNCT
bioscience-243	52	10	which	which	PRON
bioscience-243	52	11	makes	make	VERB
bioscience-243	52	12	it	it	PRON
bioscience-243	52	13	an	an	DET
bioscience-243	52	14	excellent	excellent	ADJ
bioscience-243	52	15	candidate	candidate	NOUN
bioscience-243	52	16	for	for	ADP
bioscience-243	52	17	an	an	DET
bioscience-243	52	18	anti	anti	ADJ
bioscience-243	52	19	-	-	ADJ
bioscience-243	52	20	platelet	platelet	ADJ
bioscience-243	52	21	medication	medication	NOUN
bioscience-243	52	22	.	.	PUNCT
bioscience-243	53	1	however	however	ADV
bioscience-243	53	2	,	,	PUNCT
bioscience-243	53	3	its	its	PRON
bioscience-243	53	4	effects	effect	NOUN
bioscience-243	53	5	on	on	ADP
bioscience-243	53	6	biogenic	biogenic	ADJ
bioscience-243	53	7	amines	amine	NOUN
bioscience-243	53	8	,	,	PUNCT
bioscience-243	53	9	including	include	VERB
bioscience-243	53	10	its	its	PRON
bioscience-243	53	11	interaction	interaction	NOUN
bioscience-243	53	12	with	with	ADP
bioscience-243	53	13	serotonin	serotonin	NOUN
bioscience-243	53	14	from	from	ADP
bioscience-243	53	15	the	the	DET
bioscience-243	53	16	salivary	salivary	ADJ
bioscience-243	53	17	glands	gland	NOUN
bioscience-243	53	18	of	of	ADP
bioscience-243	53	19	ae	ae	PROPN
bioscience-243	53	20	.	.	PUNCT
bioscience-243	54	1	aegypti	aegypti	PROPN
bioscience-243	54	2	,	,	PUNCT
bioscience-243	54	3	are	be	AUX
bioscience-243	54	4	not	not	PART
bioscience-243	54	5	well	well	ADV
bioscience-243	54	6	characterized	characterized	ADJ
bioscience-243	54	7	.	.	PUNCT
bioscience-243	55	1	one	one	NUM
bioscience-243	55	2	branch	branch	NOUN
bioscience-243	55	3	of	of	ADP
bioscience-243	55	4	biochemistry	biochemistry	NOUN
bioscience-243	55	5	involves	involve	VERB
bioscience-243	55	6	the	the	DET
bioscience-243	55	7	study	study	NOUN
bioscience-243	55	8	of	of	ADP
bioscience-243	55	9	proteinligand	proteinligand	ADJ
bioscience-243	55	10	interactions	interaction	NOUN
bioscience-243	55	11	,	,	PUNCT
bioscience-243	55	12	which	which	PRON
bioscience-243	55	13	can	can	AUX
bioscience-243	55	14	be	be	AUX
bioscience-243	55	15	explored	explore	VERB
bioscience-243	55	16	through	through	ADP
bioscience-243	55	17	in	in	ADP
bioscience-243	55	18	silico	silico	NOUN
bioscience-243	55	19	approaches	approach	NOUN
bioscience-243	55	20	that	that	PRON
bioscience-243	55	21	predict	predict	VERB
bioscience-243	55	22	molecular	molecular	ADJ
bioscience-243	55	23	interactions	interaction	NOUN
bioscience-243	55	24	using	use	VERB
bioscience-243	55	25	computer	computer	NOUN
bioscience-243	55	26	simulations	simulation	NOUN
bioscience-243	55	27	.	.	PUNCT
bioscience-243	56	1	for	for	ADP
bioscience-243	56	2	instance	instance	NOUN
bioscience-243	56	3	,	,	PUNCT
bioscience-243	56	4	molecular	molecular	ADJ
bioscience-243	56	5	docking	docking	NOUN
bioscience-243	56	6	analysis	analysis	NOUN
bioscience-243	56	7	enables	enable	VERB
bioscience-243	56	8	the	the	DET
bioscience-243	56	9	identification	identification	NOUN
bioscience-243	56	10	of	of	ADP
bioscience-243	56	11	specific	specific	ADJ
bioscience-243	56	12	binding	bind	VERB
bioscience-243	56	13	sites	site	NOUN
bioscience-243	56	14	on	on	ADP
bioscience-243	56	15	target	target	NOUN
bioscience-243	56	16	proteins	protein	NOUN
bioscience-243	56	17	for	for	ADP
bioscience-243	56	18	a	a	DET
bioscience-243	56	19	test	test	NOUN
bioscience-243	56	20	ligand	ligand	NOUN
bioscience-243	57	1	[	[	X
bioscience-243	57	2	12	12	NUM
bioscience-243	57	3	]	]	PUNCT
bioscience-243	57	4	.	.	PUNCT
bioscience-243	58	1	previous	previous	ADJ
bioscience-243	58	2	studies	study	NOUN
bioscience-243	58	3	have	have	AUX
bioscience-243	58	4	primarily	primarily	ADV
bioscience-243	58	5	focused	focus	VERB
bioscience-243	58	6	on	on	ADP
bioscience-243	58	7	the	the	DET
bioscience-243	58	8	interaction	interaction	NOUN
bioscience-243	58	9	between	between	ADP
bioscience-243	58	10	the	the	DET
bioscience-243	58	11	d7	d7	PROPN
bioscience-243	58	12	protein	protein	NOUN
bioscience-243	58	13	and	and	CCONJ
bioscience-243	58	14	leukotriene	leukotriene	NOUN
bioscience-243	58	15	a4	a4	PROPN
bioscience-243	58	16	,	,	PUNCT
bioscience-243	58	17	demonstrating	demonstrate	VERB
bioscience-243	58	18	the	the	DET
bioscience-243	58	19	formation	formation	NOUN
bioscience-243	58	20	of	of	ADP
bioscience-243	58	21	a	a	DET
bioscience-243	58	22	stable	stable	ADJ
bioscience-243	58	23	and	and	CCONJ
bioscience-243	58	24	natural	natural	ADJ
bioscience-243	58	25	complex	complex	NOUN
bioscience-243	59	1	[	[	X
bioscience-243	59	2	13	13	NUM
bioscience-243	59	3	]	]	PUNCT
bioscience-243	59	4	.	.	PUNCT
bioscience-243	60	1	however	however	ADV
bioscience-243	60	2	,	,	PUNCT
bioscience-243	60	3	no	no	DET
bioscience-243	60	4	prior	prior	ADJ
bioscience-243	60	5	research	research	NOUN
bioscience-243	60	6	has	have	AUX
bioscience-243	60	7	specifically	specifically	ADV
bioscience-243	60	8	examined	examine	VERB
bioscience-243	60	9	the	the	DET
bioscience-243	60	10	ability	ability	NOUN
bioscience-243	60	11	of	of	ADP
bioscience-243	60	12	d7	d7	PROPN
bioscience-243	60	13	from	from	ADP
bioscience-243	60	14	ae	ae	PROPN
bioscience-243	60	15	.	.	PUNCT
bioscience-243	61	1	aegypti	aegypti	VERB
bioscience-243	61	2	to	to	PART
bioscience-243	61	3	bind	bind	VERB
bioscience-243	61	4	serotonin	serotonin	NOUN
bioscience-243	61	5	,	,	PUNCT
bioscience-243	61	6	a	a	DET
bioscience-243	61	7	crucial	crucial	ADJ
bioscience-243	61	8	biogenic	biogenic	NOUN
bioscience-243	61	9	amine	amine	NOUN
bioscience-243	61	10	involved	involve	VERB
bioscience-243	61	11	in	in	ADP
bioscience-243	61	12	platelet	platelet	NOUN
bioscience-243	61	13	aggregation	aggregation	NOUN
bioscience-243	61	14	.	.	PUNCT
bioscience-243	62	1	this	this	DET
bioscience-243	62	2	study	study	NOUN
bioscience-243	62	3	addresses	address	VERB
bioscience-243	62	4	this	this	DET
bioscience-243	62	5	gap	gap	NOUN
bioscience-243	62	6	by	by	ADP
bioscience-243	62	7	utilizing	utilize	VERB
bioscience-243	62	8	in	in	ADP
bioscience-243	62	9	silico	silico	NOUN
bioscience-243	62	10	molecular	molecular	ADJ
bioscience-243	62	11	docking	docking	NOUN
bioscience-243	62	12	to	to	PART
bioscience-243	62	13	explore	explore	VERB
bioscience-243	62	14	the	the	DET
bioscience-243	62	15	potential	potential	ADJ
bioscience-243	62	16	interaction	interaction	NOUN
bioscience-243	62	17	between	between	ADP
bioscience-243	62	18	d7	d7	PROPN
bioscience-243	62	19	and	and	CCONJ
bioscience-243	62	20	serotonin	serotonin	VERB
bioscience-243	62	21	.	.	PUNCT
bioscience-243	63	1	by	by	ADP
bioscience-243	63	2	doing	do	VERB
bioscience-243	63	3	so	so	ADV
bioscience-243	63	4	,	,	PUNCT
bioscience-243	63	5	we	we	PRON
bioscience-243	63	6	aim	aim	VERB
bioscience-243	63	7	to	to	PART
bioscience-243	63	8	provide	provide	VERB
bioscience-243	63	9	new	new	ADJ
bioscience-243	63	10	insights	insight	NOUN
bioscience-243	63	11	into	into	ADP
bioscience-243	63	12	the	the	DET
bioscience-243	63	13	functional	functional	ADJ
bioscience-243	63	14	role	role	NOUN
bioscience-243	63	15	of	of	ADP
bioscience-243	63	16	d7	d7	PROPN
bioscience-243	63	17	and	and	CCONJ
bioscience-243	63	18	its	its	PRON
bioscience-243	63	19	potential	potential	NOUN
bioscience-243	63	20	as	as	ADP
bioscience-243	63	21	a	a	DET
bioscience-243	63	22	foundation	foundation	NOUN
bioscience-243	63	23	for	for	ADP
bioscience-243	63	24	developing	develop	VERB
bioscience-243	63	25	novel	novel	ADJ
bioscience-243	63	26	anti	anti	ADJ
bioscience-243	63	27	-	-	ADJ
bioscience-243	63	28	platelet	platelet	ADJ
bioscience-243	63	29	aggregation	aggregation	NOUN
bioscience-243	63	30	agents	agent	NOUN
bioscience-243	63	31	.	.	PUNCT
bioscience-243	64	1	materials	material	NOUN
bioscience-243	64	2	and	and	CCONJ
bioscience-243	64	3	methods	method	NOUN
bioscience-243	64	4	downloading	download	VERB
bioscience-243	64	5	3d	3d	NUM
bioscience-243	64	6	structure	structure	NOUN
bioscience-243	64	7	d7	d7	PROPN
bioscience-243	64	8	protein	protein	NOUN
bioscience-243	64	9	and	and	CCONJ
bioscience-243	64	10	ligand	ligand	VERB
bioscience-243	64	11	the	the	DET
bioscience-243	64	12	amino	amino	NOUN
bioscience-243	64	13	acid	acid	NOUN
bioscience-243	64	14	sequence	sequence	NOUN
bioscience-243	64	15	of	of	ADP
bioscience-243	64	16	the	the	DET
bioscience-243	64	17	d7	d7	PROPN
bioscience-243	64	18	protein	protein	NOUN
bioscience-243	64	19	from	from	ADP
bioscience-243	64	20	ae	ae	PROPN
bioscience-243	64	21	.	.	PUNCT
bioscience-243	65	1	aegypti	aegypti	NOUN
bioscience-243	65	2	was	be	AUX
bioscience-243	65	3	downloaded	download	VERB
bioscience-243	65	4	from	from	ADP
bioscience-243	65	5	the	the	DET
bioscience-243	65	6	uniprot	uniprot	ADJ
bioscience-243	65	7	database	database	NOUN
bioscience-243	65	8	with	with	ADP
bioscience-243	65	9	accession	accession	NOUN
bioscience-243	65	10	code	code	NOUN
bioscience-243	65	11	p18153	p18153	X
bioscience-243	66	1	[	[	X
bioscience-243	66	2	14	14	NUM
bioscience-243	66	3	]	]	PUNCT
bioscience-243	66	4	.	.	PUNCT
bioscience-243	67	1	the	the	DET
bioscience-243	67	2	three	three	NUM
bioscience-243	67	3	-	-	PUNCT
bioscience-243	67	4	dimensional	dimensional	ADJ
bioscience-243	67	5	(	(	PUNCT
bioscience-243	67	6	3d	3d	NOUN
bioscience-243	67	7	)	)	PUNCT
bioscience-243	67	8	structure	structure	NOUN
bioscience-243	67	9	of	of	ADP
bioscience-243	67	10	the	the	DET
bioscience-243	67	11	d7	d7	PROPN
bioscience-243	67	12	protein	protein	NOUN
bioscience-243	67	13	was	be	AUX
bioscience-243	67	14	obtained	obtain	VERB
bioscience-243	67	15	from	from	ADP
bioscience-243	67	16	the	the	DET
bioscience-243	67	17	swiss	swiss	ADJ
bioscience-243	67	18	-	-	PUNCT
bioscience-243	67	19	model	model	NOUN
bioscience-243	67	20	database	database	NOUN
bioscience-243	67	21	[	[	X
bioscience-243	67	22	15	15	NUM
bioscience-243	67	23	]	]	PUNCT
bioscience-243	67	24	.	.	PUNCT
bioscience-243	68	1	the	the	DET
bioscience-243	68	2	resulting	result	VERB
bioscience-243	68	3	model	model	NOUN
bioscience-243	68	4	was	be	AUX
bioscience-243	68	5	selected	select	VERB
bioscience-243	68	6	based	base	VERB
bioscience-243	68	7	on	on	ADP
bioscience-243	68	8	its	its	PRON
bioscience-243	68	9	best	good	ADJ
bioscience-243	68	10	quality	quality	NOUN
bioscience-243	68	11	and	and	CCONJ
bioscience-243	68	12	downloaded	download	VERB
bioscience-243	68	13	in	in	ADP
bioscience-243	68	14	.pdb	.pdb	PUNCT
bioscience-243	68	15	file	file	NOUN
bioscience-243	68	16	format	format	NOUN
bioscience-243	68	17	[	[	X
bioscience-243	68	18	16	16	NUM
bioscience-243	68	19	]	]	PUNCT
bioscience-243	68	20	.	.	PUNCT
bioscience-243	69	1	the	the	DET
bioscience-243	69	2	3d	3d	PROPN
bioscience-243	69	3	model	model	NOUN
bioscience-243	69	4	structure	structure	NOUN
bioscience-243	69	5	of	of	ADP
bioscience-243	69	6	the	the	DET
bioscience-243	69	7	d7	d7	PROPN
bioscience-243	69	8	protein	protein	NOUN
bioscience-243	69	9	uses	use	VERB
bioscience-243	69	10	the	the	DET
bioscience-243	69	11	d7	d7	PROPN
bioscience-243	69	12	protein	protein	NOUN
bioscience-243	69	13	with	with	ADP
bioscience-243	69	14	the	the	DET
bioscience-243	69	15	template	template	NOUN
bioscience-243	69	16	pdb	pdb	NOUN
bioscience-243	69	17	i	i	PROPN
bioscience-243	69	18	d	d	PROPN
bioscience-243	69	19	3dye.1	3dye.1	NUM
bioscience-243	69	20	.	.	PUNCT
bioscience-243	70	1	the	the	DET
bioscience-243	70	2	model	model	NOUN
bioscience-243	70	3	structure	structure	NOUN
bioscience-243	70	4	from	from	ADP
bioscience-243	70	5	this	this	DET
bioscience-243	70	6	template	template	NOUN
bioscience-243	70	7	includes	include	VERB
bioscience-243	70	8	a	a	DET
bioscience-243	70	9	native	native	ADJ
bioscience-243	70	10	ligand	ligand	NOUN
bioscience-243	70	11	,	,	PUNCT
bioscience-243	70	12	which	which	PRON
bioscience-243	70	13	is	be	AUX
bioscience-243	70	14	l	l	NOUN
bioscience-243	70	15	-	-	NOUN
bioscience-243	70	16	norepinephrine	norepinephrine	NOUN
bioscience-243	70	17	.	.	PUNCT
bioscience-243	71	1	in	in	ADP
bioscience-243	71	2	this	this	DET
bioscience-243	71	3	study	study	NOUN
bioscience-243	71	4	,	,	PUNCT
bioscience-243	71	5	a	a	DET
bioscience-243	71	6	test	test	NOUN
bioscience-243	71	7	ligand	ligand	NOUN
bioscience-243	71	8	was	be	AUX
bioscience-243	71	9	used	use	VERB
bioscience-243	71	10	to	to	PART
bioscience-243	71	11	observe	observe	VERB
bioscience-243	71	12	its	its	PRON
bioscience-243	71	13	interaction	interaction	NOUN
bioscience-243	71	14	with	with	ADP
bioscience-243	71	15	the	the	DET
bioscience-243	71	16	d7	d7	PROPN
bioscience-243	71	17	protein	protein	NOUN
bioscience-243	71	18	.	.	PUNCT
bioscience-243	72	1	the	the	DET
bioscience-243	72	2	test	test	NOUN
bioscience-243	72	3	ligand	ligand	NOUN
bioscience-243	72	4	selected	select	VERB
bioscience-243	72	5	was	be	AUX
bioscience-243	72	6	serotonin	serotonin	VERB
bioscience-243	72	7	.	.	PUNCT
bioscience-243	73	1	the	the	DET
bioscience-243	73	2	three	three	NUM
bioscience-243	73	3	-	-	PUNCT
bioscience-243	73	4	dimensional	dimensional	ADJ
bioscience-243	73	5	structure	structure	NOUN
bioscience-243	73	6	of	of	ADP
bioscience-243	73	7	serotonin	serotonin	NOUN
bioscience-243	73	8	was	be	AUX
bioscience-243	73	9	obtained	obtain	VERB
bioscience-243	73	10	from	from	ADP
bioscience-243	73	11	the	the	DET
bioscience-243	73	12	pubchem	pubchem	NOUN
bioscience-243	73	13	database	database	NOUN
bioscience-243	73	14	with	with	ADP
bioscience-243	73	15	accession	accession	NOUN
bioscience-243	73	16	code	code	NOUN
bioscience-243	73	17	5202	5202	NUM
bioscience-243	73	18	.	.	PUNCT
bioscience-243	74	1	this	this	DET
bioscience-243	74	2	serotonin	serotonin	NOUN
bioscience-243	74	3	entry	entry	NOUN
bioscience-243	74	4	originates	originate	NOUN
bioscience-243	74	5	from	from	ADP
bioscience-243	74	6	human	human	ADJ
bioscience-243	74	7	metabolism	metabolism	NOUN
bioscience-243	74	8	.	.	PUNCT
bioscience-243	75	1	the	the	DET
bioscience-243	75	2	serotonin	serotonin	NOUN
bioscience-243	75	3	molecule	molecule	NOUN
bioscience-243	75	4	was	be	AUX
bioscience-243	75	5	downloaded	download	VERB
bioscience-243	75	6	from	from	ADP
bioscience-243	75	7	the	the	DET
bioscience-243	75	8	pubchem	pubchem	NOUN
bioscience-243	75	9	database	database	NOUN
bioscience-243	75	10	in	in	ADP
bioscience-243	75	11	.sdf	.sdf	NOUN
bioscience-243	75	12	file	file	NOUN
bioscience-243	75	13	format	format	NOUN
bioscience-243	75	14	[	[	X
bioscience-243	75	15	17	17	NUM
bioscience-243	75	16	]	]	PUNCT
bioscience-243	75	17	.	.	PUNCT
bioscience-243	76	1	preparation	preparation	NOUN
bioscience-243	76	2	and	and	CCONJ
bioscience-243	76	3	optimization	optimization	NOUN
bioscience-243	76	4	of	of	ADP
bioscience-243	76	5	the	the	DET
bioscience-243	76	6	3d	3d	NUM
bioscience-243	76	7	structure	structure	NOUN
bioscience-243	76	8	of	of	ADP
bioscience-243	76	9	d7	d7	PROPN
bioscience-243	76	10	protein	protein	NOUN
bioscience-243	76	11	and	and	CCONJ
bioscience-243	76	12	the	the	DET
bioscience-243	76	13	native	native	ADJ
bioscience-243	76	14	ligand	ligand	PROPN
bioscience-243	76	15	l	l	NOUN
bioscience-243	76	16	-	-	NOUN
bioscience-243	76	17	norepinephrine	norepinephrine	VERB
bioscience-243	76	18	the	the	DET
bioscience-243	76	19	preparation	preparation	NOUN
bioscience-243	76	20	of	of	ADP
bioscience-243	76	21	the	the	DET
bioscience-243	76	22	3d	3d	NUM
bioscience-243	76	23	structure	structure	NOUN
bioscience-243	76	24	of	of	ADP
bioscience-243	76	25	the	the	DET
bioscience-243	76	26	d7	d7	PROPN
bioscience-243	76	27	protein	protein	NOUN
bioscience-243	76	28	involves	involve	VERB
bioscience-243	76	29	removing	remove	VERB
bioscience-243	76	30	the	the	DET
bioscience-243	76	31	native	native	ADJ
bioscience-243	76	32	ligand	ligand	NOUN
bioscience-243	76	33	,	,	PUNCT
bioscience-243	76	34	non	non	ADJ
bioscience-243	76	35	-	-	ADJ
bioscience-243	76	36	functional	functional	ADJ
bioscience-243	76	37	ligands	ligand	NOUN
bioscience-243	76	38	,	,	PUNCT
bioscience-243	76	39	and	and	CCONJ
bioscience-243	76	40	water	water	NOUN
bioscience-243	76	41	molecules	molecule	NOUN
bioscience-243	76	42	.	.	PUNCT
bioscience-243	77	1	this	this	DET
bioscience-243	77	2	preparation	preparation	NOUN
bioscience-243	77	3	is	be	AUX
bioscience-243	77	4	carried	carry	VERB
bioscience-243	77	5	out	out	ADP
bioscience-243	77	6	using	use	VERB
bioscience-243	77	7	autodock	autodock	NOUN
bioscience-243	77	8	tools	tool	NOUN
bioscience-243	77	9	software	software	NOUN
bioscience-243	77	10	[	[	X
bioscience-243	77	11	18	18	NUM
bioscience-243	77	12	]	]	PUNCT
bioscience-243	77	13	.	.	PUNCT
bioscience-243	78	1	the	the	DET
bioscience-243	78	2	first	first	ADJ
bioscience-243	78	3	step	step	NOUN
bioscience-243	78	4	in	in	ADP
bioscience-243	78	5	preparing	prepare	VERB
bioscience-243	78	6	the	the	DET
bioscience-243	78	7	d7	d7	PROPN
bioscience-243	78	8	protein	protein	NOUN
bioscience-243	78	9	structure	structure	NOUN
bioscience-243	78	10	is	be	AUX
bioscience-243	78	11	the	the	DET
bioscience-243	78	12	removal	removal	NOUN
bioscience-243	78	13	of	of	ADP
bioscience-243	78	14	all	all	DET
bioscience-243	78	15	water	water	NOUN
bioscience-243	78	16	molecules	molecule	NOUN
bioscience-243	78	17	and	and	CCONJ
bioscience-243	78	18	non	non	ADJ
bioscience-243	78	19	-	-	ADJ
bioscience-243	78	20	functional	functional	ADJ
bioscience-243	78	21	ligands	ligand	NOUN
bioscience-243	78	22	.	.	PUNCT
bioscience-243	79	1	the	the	DET
bioscience-243	79	2	d7	d7	PROPN
bioscience-243	79	3	protein	protein	NOUN
bioscience-243	79	4	is	be	AUX
bioscience-243	79	5	then	then	ADV
bioscience-243	79	6	separated	separate	VERB
bioscience-243	79	7	from	from	ADP
bioscience-243	79	8	its	its	PRON
bioscience-243	79	9	native	native	ADJ
bioscience-243	79	10	ligand	ligand	NOUN
bioscience-243	79	11	,	,	PUNCT
bioscience-243	79	12	l	l	NOUN
bioscience-243	79	13	-	-	NOUN
bioscience-243	79	14	norepinephrine	norepinephrine	NOUN
bioscience-243	79	15	.	.	PUNCT
bioscience-243	80	1	the	the	DET
bioscience-243	80	2	structure	structure	NOUN
bioscience-243	80	3	of	of	ADP
bioscience-243	80	4	the	the	DET
bioscience-243	80	5	d7	d7	PROPN
bioscience-243	80	6	protein	protein	NOUN
bioscience-243	80	7	is	be	AUX
bioscience-243	80	8	saved	save	VERB
bioscience-243	80	9	in	in	ADP
bioscience-243	80	10	.pdb	.pdb	PROPN
bioscience-243	80	11	format	format	NOUN
bioscience-243	80	12	,	,	PUNCT
bioscience-243	80	13	and	and	CCONJ
bioscience-243	80	14	the	the	DET
bioscience-243	80	15	structure	structure	NOUN
bioscience-243	80	16	of	of	ADP
bioscience-243	80	17	l	l	NOUN
bioscience-243	80	18	-	-	NOUN
bioscience-243	80	19	norepinephrine	norepinephrine	NOUN
bioscience-243	80	20	is	be	AUX
bioscience-243	80	21	also	also	ADV
bioscience-243	80	22	saved	save	VERB
bioscience-243	80	23	in	in	ADP
bioscience-243	80	24	.pdb	.pdb	PUNCT
bioscience-243	80	25	format	format	NOUN
bioscience-243	80	26	within	within	ADP
bioscience-243	80	27	the	the	DET
bioscience-243	80	28	same	same	ADJ
bioscience-243	80	29	folder	folder	NOUN
bioscience-243	80	30	.	.	PUNCT
bioscience-243	81	1	the	the	DET
bioscience-243	81	2	structure	structure	NOUN
bioscience-243	81	3	of	of	ADP
bioscience-243	81	4	the	the	DET
bioscience-243	81	5	d7	d7	PROPN
bioscience-243	81	6	protein	protein	NOUN
bioscience-243	81	7	is	be	AUX
bioscience-243	81	8	then	then	ADV
bioscience-243	81	9	optimized	optimize	VERB
bioscience-243	81	10	by	by	ADP
bioscience-243	81	11	adding	add	VERB
bioscience-243	81	12	polar	polar	ADJ
bioscience-243	81	13	hydrogen	hydrogen	NOUN
bioscience-243	81	14	atoms	atom	NOUN
bioscience-243	81	15	and	and	CCONJ
bioscience-243	81	16	checking	check	VERB
bioscience-243	81	17	for	for	ADP
bioscience-243	81	18	missing	miss	VERB
bioscience-243	81	19	atoms	atom	NOUN
bioscience-243	81	20	to	to	PART
bioscience-243	81	21	ensure	ensure	VERB
bioscience-243	81	22	the	the	DET
bioscience-243	81	23	integrity	integrity	NOUN
bioscience-243	81	24	of	of	ADP
bioscience-243	81	25	the	the	DET
bioscience-243	81	26	downloaded	download	VERB
bioscience-243	81	27	3d	3d	NUM
bioscience-243	81	28	structure	structure	NOUN
bioscience-243	81	29	.	.	PUNCT
bioscience-243	82	1	the	the	DET
bioscience-243	82	2	d7	d7	PROPN
bioscience-243	82	3	protein	protein	NOUN
bioscience-243	82	4	is	be	AUX
bioscience-243	82	5	subsequently	subsequently	ADV
bioscience-243	82	6	charged	charge	VERB
bioscience-243	82	7	using	use	VERB
bioscience-243	82	8	kollman	kollman	NOUN
bioscience-243	82	9	charges	charge	NOUN
bioscience-243	82	10	,	,	PUNCT
bioscience-243	82	11	resulting	result	VERB
bioscience-243	82	12	in	in	ADP
bioscience-243	82	13	charge	charge	NOUN
bioscience-243	82	14	neutralization	neutralization	NOUN
bioscience-243	82	15	.	.	PUNCT
bioscience-243	83	1	the	the	DET
bioscience-243	83	2	optimized	optimize	VERB
bioscience-243	83	3	structure	structure	NOUN
bioscience-243	83	4	is	be	AUX
bioscience-243	83	5	saved	save	VERB
bioscience-243	83	6	in	in	ADP
bioscience-243	83	7	.pdbqt	.pdbqt	NOUN
bioscience-243	83	8	format	format	NOUN
bioscience-243	83	9	[	[	X
bioscience-243	83	10	19	19	NUM
bioscience-243	83	11	]	]	PUNCT
bioscience-243	83	12	.	.	PUNCT
bioscience-243	84	1	further	further	ADJ
bioscience-243	84	2	optimization	optimization	NOUN
bioscience-243	84	3	is	be	AUX
bioscience-243	84	4	performed	perform	VERB
bioscience-243	84	5	on	on	ADP
bioscience-243	84	6	the	the	DET
bioscience-243	84	7	3d	3d	NUM
bioscience-243	84	8	structure	structure	NOUN
bioscience-243	84	9	of	of	ADP
bioscience-243	84	10	the	the	DET
bioscience-243	84	11	l	l	ADJ
bioscience-243	84	12	-	-	ADJ
bioscience-243	84	13	norepinephrine	norepinephrine	ADJ
bioscience-243	84	14	ligand	ligand	NOUN
bioscience-243	84	15	.	.	PUNCT
bioscience-243	85	1	the	the	DET
bioscience-243	85	2	ligand	ligand	NOUN
bioscience-243	85	3	is	be	AUX
bioscience-243	85	4	optimized	optimize	VERB
bioscience-243	85	5	by	by	ADP
bioscience-243	85	6	adding	add	VERB
bioscience-243	85	7	gasteiger	gasteiger	NOUN
bioscience-243	85	8	charges	charge	NOUN
bioscience-243	85	9	,	,	PUNCT
bioscience-243	85	10	followed	follow	VERB
bioscience-243	85	11	by	by	ADP
bioscience-243	85	12	a	a	DET
bioscience-243	85	13	non	non	ADJ
bioscience-243	85	14	-	-	ADJ
bioscience-243	85	15	polar	polar	ADJ
bioscience-243	85	16	merge	merge	NOUN
bioscience-243	85	17	,	,	PUNCT
bioscience-243	85	18	with	with	ADP
bioscience-243	85	19	the	the	DET
bioscience-243	85	20	expectation	expectation	NOUN
bioscience-243	85	21	that	that	PRON
bioscience-243	85	22	only	only	ADV
bioscience-243	85	23	hydrogen	hydrogen	NOUN
bioscience-243	85	24	atoms	atom	NOUN
bioscience-243	85	25	will	will	AUX
bioscience-243	85	26	be	be	AUX
bioscience-243	85	27	available	available	ADJ
bioscience-243	85	28	to	to	PART
bioscience-243	85	29	form	form	VERB
bioscience-243	85	30	bonds	bond	NOUN
bioscience-243	85	31	with	with	ADP
bioscience-243	85	32	the	the	DET
bioscience-243	85	33	target	target	NOUN
bioscience-243	85	34	protein	protein	NOUN
bioscience-243	85	35	residues	residue	NOUN
bioscience-243	85	36	(	(	PUNCT
bioscience-243	85	37	d7	d7	PROPN
bioscience-243	85	38	protein	protein	NOUN
bioscience-243	85	39	)	)	PUNCT
bioscience-243	86	1	[	[	X
bioscience-243	86	2	20	20	NUM
bioscience-243	86	3	]	]	PUNCT
bioscience-243	86	4	.	.	PUNCT
bioscience-243	87	1	the	the	DET
bioscience-243	87	2	native	native	ADJ
bioscience-243	87	3	ligand	ligand	NOUN
bioscience-243	87	4	is	be	AUX
bioscience-243	87	5	then	then	ADV
bioscience-243	87	6	prepared	prepare	VERB
bioscience-243	87	7	for	for	ADP
bioscience-243	87	8	docking	docking	NOUN
bioscience-243	87	9	by	by	ADP
bioscience-243	87	10	selecting	select	VERB
bioscience-243	87	11	rotation	rotation	NOUN
bioscience-243	87	12	points	point	NOUN
bioscience-243	87	13	using	use	VERB
bioscience-243	87	14	the	the	DET
bioscience-243	87	15	torsion	torsion	NOUN
bioscience-243	87	16	tree	tree	NOUN
bioscience-243	87	17	menu	menu	NOUN
bioscience-243	87	18	.	.	PUNCT
bioscience-243	88	1	this	this	DET
bioscience-243	88	2	process	process	NOUN
bioscience-243	88	3	identifies	identify	VERB
bioscience-243	88	4	and	and	CCONJ
bioscience-243	88	5	assigns	assign	VERB
bioscience-243	88	6	torsion	torsion	NOUN
bioscience-243	88	7	points	point	NOUN
bioscience-243	88	8	,	,	PUNCT
bioscience-243	88	9	improving	improve	VERB
bioscience-243	88	10	the	the	DET
bioscience-243	88	11	accuracy	accuracy	NOUN
bioscience-243	88	12	of	of	ADP
bioscience-243	88	13	ligand	ligand	ADJ
bioscience-243	88	14	positioning	positioning	NOUN
bioscience-243	88	15	predictions	prediction	NOUN
bioscience-243	88	16	.	.	PUNCT
bioscience-243	89	1	the	the	DET
bioscience-243	89	2	final	final	ADJ
bioscience-243	89	3	optimized	optimize	VERB
bioscience-243	89	4	structure	structure	NOUN
bioscience-243	89	5	of	of	ADP
bioscience-243	89	6	the	the	DET
bioscience-243	89	7	native	native	ADJ
bioscience-243	89	8	ligand	ligand	NOUN
bioscience-243	89	9	is	be	AUX
bioscience-243	89	10	saved	save	VERB
bioscience-243	89	11	in	in	ADP
bioscience-243	89	12	.pdbqt	.pdbqt	NOUN
bioscience-243	89	13	format	format	NOUN
bioscience-243	89	14	in	in	ADP
bioscience-243	89	15	the	the	DET
bioscience-243	89	16	same	same	ADJ
bioscience-243	89	17	folder	folder	NOUN
bioscience-243	89	18	as	as	ADP
bioscience-243	89	19	the	the	DET
bioscience-243	89	20	optimized	optimize	VERB
bioscience-243	89	21	d7	d7	PROPN
bioscience-243	89	22	protein	protein	NOUN
bioscience-243	89	23	structure	structure	NOUN
bioscience-243	89	24	[	[	X
bioscience-243	89	25	19	19	NUM
bioscience-243	89	26	]	]	PUNCT
bioscience-243	89	27	.	.	PUNCT
bioscience-243	90	1	preparation	preparation	NOUN
bioscience-243	90	2	and	and	CCONJ
bioscience-243	90	3	optimization	optimization	NOUN
bioscience-243	90	4	of	of	ADP
bioscience-243	90	5	the	the	DET
bioscience-243	90	6	native	native	ADJ
bioscience-243	90	7	ligands	ligand	NOUN
bioscience-243	90	8	3d	3d	NOUN
bioscience-243	90	9	structure	structure	NOUN
bioscience-243	90	10	were	be	AUX
bioscience-243	90	11	also	also	ADV
bioscience-243	90	12	performed	perform	VERB
bioscience-243	90	13	using	use	VERB
bioscience-243	90	14	autodock	autodock	NOUN
bioscience-243	90	15	tools	tool	NOUN
bioscience-243	90	16	software	software	NOUN
bioscience-243	90	17	.	.	PUNCT
bioscience-243	91	1	validation	validation	NOUN
bioscience-243	91	2	of	of	ADP
bioscience-243	91	3	the	the	DET
bioscience-243	91	4	molecular	molecular	ADJ
bioscience-243	91	5	docking	docking	NOUN
bioscience-243	91	6	method	method	NOUN
bioscience-243	91	7	the	the	DET
bioscience-243	91	8	next	next	ADJ
bioscience-243	91	9	step	step	NOUN
bioscience-243	91	10	in	in	ADP
bioscience-243	91	11	the	the	DET
bioscience-243	91	12	molecular	molecular	ADJ
bioscience-243	91	13	docking	docking	NOUN
bioscience-243	91	14	phase	phase	NOUN
bioscience-243	91	15	is	be	AUX
bioscience-243	91	16	to	to	PART
bioscience-243	91	17	validate	validate	VERB
bioscience-243	91	18	the	the	DET
bioscience-243	91	19	method	method	NOUN
bioscience-243	91	20	through	through	ADP
bioscience-243	91	21	a	a	DET
bioscience-243	91	22	re	re	ADJ
bioscience-243	91	23	-	-	ADJ
bioscience-243	91	24	docking	docking	ADJ
bioscience-243	91	25	process	process	NOUN
bioscience-243	91	26	of	of	ADP
bioscience-243	91	27	the	the	DET
bioscience-243	91	28	d7	d7	PROPN
bioscience-243	91	29	protein	protein	NOUN
bioscience-243	91	30	with	with	ADP
bioscience-243	91	31	its	its	PRON
bioscience-243	91	32	native	native	ADJ
bioscience-243	91	33	ligand	ligand	NOUN
bioscience-243	91	34	,	,	PUNCT
bioscience-243	91	35	l	l	NOUN
bioscience-243	91	36	-	-	NOUN
bioscience-243	91	37	norepinephrine	norepinephrine	NOUN
bioscience-243	91	38	,	,	PUNCT
bioscience-243	91	39	which	which	PRON
bioscience-243	91	40	has	have	AUX
bioscience-243	91	41	already	already	ADV
bioscience-243	91	42	been	be	AUX
bioscience-243	91	43	prepared	prepare	VERB
bioscience-243	91	44	and	and	CCONJ
bioscience-243	91	45	optimized	optimize	VERB
bioscience-243	91	46	.	.	PUNCT
bioscience-243	92	1	the	the	DET
bioscience-243	92	2	initial	initial	ADJ
bioscience-243	92	3	step	step	NOUN
bioscience-243	92	4	of	of	ADP
bioscience-243	92	5	the	the	DET
bioscience-243	92	6	re	re	ADJ
bioscience-243	92	7	-	-	ADJ
bioscience-243	92	8	docking	docking	ADJ
bioscience-243	92	9	process	process	NOUN
bioscience-243	92	10	involves	involve	VERB
bioscience-243	92	11	determining	determine	VERB
bioscience-243	92	12	the	the	DET
bioscience-243	92	13	interaction	interaction	NOUN
bioscience-243	92	14	site	site	NOUN
bioscience-243	92	15	by	by	ADP
bioscience-243	92	16	defining	define	VERB
bioscience-243	92	17	the	the	DET
bioscience-243	92	18	grid	grid	NOUN
bioscience-243	92	19	area	area	NOUN
bioscience-243	92	20	using	use	VERB
bioscience-243	92	21	a	a	DET
bioscience-243	92	22	grid	grid	NOUN
bioscience-243	92	23	box	box	NOUN
bioscience-243	92	24	.	.	PUNCT
bioscience-243	93	1	this	this	DET
bioscience-243	93	2	stage	stage	NOUN
bioscience-243	93	3	is	be	AUX
bioscience-243	93	4	conducted	conduct	VERB
bioscience-243	93	5	using	use	VERB
bioscience-243	93	6	autodock	autodock	NOUN
bioscience-243	93	7	tools	tool	NOUN
bioscience-243	93	8	software	software	NOUN
bioscience-243	93	9	[	[	X
bioscience-243	93	10	18	18	NUM
bioscience-243	93	11	]	]	PUNCT
bioscience-243	93	12	.	.	PUNCT
bioscience-243	94	1	the	the	DET
bioscience-243	94	2	grid	grid	NOUN
bioscience-243	94	3	box	box	NOUN
bioscience-243	94	4	settings	setting	NOUN
bioscience-243	94	5	include	include	VERB
bioscience-243	94	6	the	the	DET
bioscience-243	94	7	number	number	NOUN
bioscience-243	94	8	of	of	ADP
bioscience-243	94	9	points	point	NOUN
bioscience-243	94	10	in	in	ADP
bioscience-243	94	11	each	each	DET
bioscience-243	94	12	dimension	dimension	NOUN
bioscience-243	94	13	(	(	PUNCT
bioscience-243	94	14	x	x	X
bioscience-243	94	15	,	,	PUNCT
bioscience-243	94	16	y	y	PROPN
bioscience-243	94	17	,	,	PUNCT
bioscience-243	94	18	and	and	CCONJ
bioscience-243	94	19	z	z	X
bioscience-243	94	20	)	)	PUNCT
bioscience-243	94	21	,	,	PUNCT
bioscience-243	94	22	the	the	DET
bioscience-243	94	23	spacing	spacing	NOUN
bioscience-243	94	24	in	in	ADP
bioscience-243	94	25	å	å	NOUN
bioscience-243	94	26	,	,	PUNCT
bioscience-243	94	27	and	and	CCONJ
bioscience-243	94	28	the	the	DET
bioscience-243	94	29	center	center	NOUN
bioscience-243	94	30	coordinates	coordinate	NOUN
bioscience-243	94	31	of	of	ADP
bioscience-243	94	32	the	the	DET
bioscience-243	94	33	grid	grid	PROPN
bioscience-243	94	34	box	box	PROPN
bioscience-243	94	35	(	(	PUNCT
bioscience-243	94	36	x	x	X
bioscience-243	94	37	,	,	PUNCT
bioscience-243	94	38	y	y	PROPN
bioscience-243	94	39	,	,	PUNCT
bioscience-243	94	40	and	and	CCONJ
bioscience-243	94	41	z	z	NOUN
bioscience-243	94	42	)	)	PUNCT
bioscience-243	94	43	.	.	PUNCT
bioscience-243	95	1	these	these	DET
bioscience-243	95	2	settings	setting	NOUN
bioscience-243	95	3	are	be	AUX
bioscience-243	95	4	saved	save	VERB
bioscience-243	95	5	in	in	ADP
bioscience-243	95	6	the	the	DET
bioscience-243	95	7	.gpf	.gpf	PUNCT
bioscience-243	95	8	(	(	PUNCT
bioscience-243	95	9	grid	grid	NOUN
bioscience-243	95	10	parameter	parameter	NOUN
bioscience-243	95	11	file	file	NOUN
bioscience-243	95	12	)	)	PUNCT
bioscience-243	95	13	format	format	NOUN
bioscience-243	95	14	.	.	PUNCT
bioscience-243	96	1	the	the	DET
bioscience-243	96	2	validation	validation	NOUN
bioscience-243	96	3	of	of	ADP
bioscience-243	96	4	the	the	DET
bioscience-243	96	5	molecular	molecular	ADJ
bioscience-243	96	6	docking	docking	NOUN
bioscience-243	96	7	method	method	NOUN
bioscience-243	96	8	between	between	ADP
bioscience-243	96	9	the	the	DET
bioscience-243	96	10	d7	d7	PROPN
bioscience-243	96	11	protein	protein	NOUN
bioscience-243	96	12	and	and	CCONJ
bioscience-243	96	13	its	its	PRON
bioscience-243	96	14	native	native	ADJ
bioscience-243	96	15	ligand	ligand	NOUN
bioscience-243	96	16	is	be	AUX
bioscience-243	96	17	evaluated	evaluate	VERB
bioscience-243	96	18	using	use	VERB
bioscience-243	96	19	the	the	DET
bioscience-243	96	20	rmsd	rmsd	NOUN
bioscience-243	96	21	(	(	PUNCT
bioscience-243	96	22	root	root	NOUN
bioscience-243	96	23	mean	mean	ADJ
bioscience-243	96	24	square	square	ADJ
bioscience-243	96	25	deviation	deviation	NOUN
bioscience-243	96	26	)	)	PUNCT
bioscience-243	96	27	value	value	NOUN
bioscience-243	96	28	.	.	PUNCT
bioscience-243	97	1	an	an	DET
bioscience-243	97	2	rmsd	rmsd	ADJ
bioscience-243	97	3	value	value	NOUN
bioscience-243	97	4	of	of	ADP
bioscience-243	97	5	less	less	ADJ
bioscience-243	97	6	than	than	ADP
bioscience-243	97	7	2	2	NUM
bioscience-243	97	8	å	å	NOUN
bioscience-243	97	9	(	(	PUNCT
bioscience-243	97	10	<	<	X
bioscience-243	97	11	2	2	NUM
bioscience-243	97	12	å	å	NOUN
bioscience-243	97	13	)	)	PUNCT
bioscience-243	97	14	is	be	AUX
bioscience-243	97	15	considered	consider	VERB
bioscience-243	97	16	acceptable	acceptable	ADJ
bioscience-243	97	17	and	and	CCONJ
bioscience-243	97	18	indicates	indicate	VERB
bioscience-243	97	19	good	good	ADJ
bioscience-243	97	20	reproducibility	reproducibility	NOUN
bioscience-243	97	21	of	of	ADP
bioscience-243	97	22	the	the	DET
bioscience-243	97	23	docking	docking	NOUN
bioscience-243	97	24	result	result	NOUN
bioscience-243	97	25	[	[	X
bioscience-243	97	26	21	21	NUM
bioscience-243	97	27	]	]	PUNCT
bioscience-243	97	28	.	.	PUNCT
bioscience-243	98	1	preparation	preparation	NOUN
bioscience-243	98	2	of	of	ADP
bioscience-243	98	3	3d	3d	NUM
bioscience-243	98	4	structure	structure	NOUN
bioscience-243	98	5	of	of	ADP
bioscience-243	98	6	serotonin	serotonin	NOUN
bioscience-243	98	7	test	test	NOUN
bioscience-243	98	8	ligand	ligand	NOUN
bioscience-243	98	9	the	the	DET
bioscience-243	98	10	preparation	preparation	NOUN
bioscience-243	98	11	and	and	CCONJ
bioscience-243	98	12	optimization	optimization	NOUN
bioscience-243	98	13	of	of	ADP
bioscience-243	98	14	the	the	DET
bioscience-243	98	15	test	test	NOUN
bioscience-243	98	16	ligand	ligand	NOUN
bioscience-243	98	17	,	,	PUNCT
bioscience-243	98	18	serotonin	serotonin	VERB
bioscience-243	98	19	,	,	PUNCT
bioscience-243	98	20	were	be	AUX
bioscience-243	98	21	carried	carry	VERB
bioscience-243	98	22	out	out	ADP
bioscience-243	98	23	using	use	VERB
bioscience-243	98	24	chem3d	chem3d	NOUN
bioscience-243	98	25	and	and	CCONJ
bioscience-243	98	26	autodock	autodock	NOUN
bioscience-243	98	27	tools	tool	NOUN
bioscience-243	98	28	software	software	NOUN
bioscience-243	98	29	[	[	X
bioscience-243	98	30	19	19	NUM
bioscience-243	98	31	]	]	PUNCT
bioscience-243	98	32	.	.	PUNCT
bioscience-243	99	1	the	the	DET
bioscience-243	99	2	3d	3d	PROPN
bioscience-243	99	3	structure	structure	NOUN
bioscience-243	99	4	of	of	ADP
bioscience-243	99	5	serotonin	serotonin	NOUN
bioscience-243	99	6	was	be	AUX
bioscience-243	99	7	prepared	prepare	VERB
bioscience-243	99	8	through	through	ADP
bioscience-243	99	9	energy	energy	NOUN
bioscience-243	99	10	minimization	minimization	NOUN
bioscience-243	99	11	using	use	VERB
bioscience-243	99	12	the	the	DET
bioscience-243	99	13	force	force	NOUN
bioscience-243	99	14	field	field	NOUN
bioscience-243	99	15	molecular	molecular	ADJ
bioscience-243	99	16	mechanism	mechanism	NOUN
bioscience-243	99	17	(	(	PUNCT
bioscience-243	99	18	mm2	mm2	NOUN
bioscience-243	99	19	)	)	PUNCT
bioscience-243	99	20	method	method	NOUN
bioscience-243	100	1	[	[	X
bioscience-243	100	2	22	22	NUM
bioscience-243	100	3	]	]	PUNCT
bioscience-243	100	4	.	.	PUNCT
bioscience-243	101	1	the	the	DET
bioscience-243	101	2	resulting	result	VERB
bioscience-243	101	3	minimized	minimized	ADJ
bioscience-243	101	4	structure	structure	NOUN
bioscience-243	101	5	was	be	AUX
bioscience-243	101	6	saved	save	VERB
bioscience-243	101	7	in	in	ADP
bioscience-243	101	8	.pdb	.pdb	PROPN
bioscience-243	101	9	format	format	NOUN
bioscience-243	101	10	.	.	PUNCT
bioscience-243	102	1	subsequently	subsequently	ADV
bioscience-243	102	2	,	,	PUNCT
bioscience-243	102	3	the	the	DET
bioscience-243	102	4	test	test	NOUN
bioscience-243	102	5	ligand	ligand	NOUN
bioscience-243	102	6	structure	structure	NOUN
bioscience-243	102	7	was	be	AUX
bioscience-243	102	8	optimized	optimize	VERB
bioscience-243	102	9	by	by	ADP
bioscience-243	102	10	adding	add	VERB
bioscience-243	102	11	hydrogen	hydrogen	NOUN
bioscience-243	102	12	atoms	atom	NOUN
bioscience-243	102	13	,	,	PUNCT
bioscience-243	102	14	followed	follow	VERB
bioscience-243	102	15	by	by	ADP
bioscience-243	102	16	a	a	DET
bioscience-243	102	17	non	non	ADJ
bioscience-243	102	18	-	-	ADJ
bioscience-243	102	19	polar	polar	ADJ
bioscience-243	102	20	merge	merge	NOUN
bioscience-243	102	21	.	.	PUNCT
bioscience-243	103	1	gasteiger	gasteiger	NOUN
bioscience-243	103	2	charges	charge	NOUN
bioscience-243	103	3	were	be	AUX
bioscience-243	103	4	then	then	ADV
bioscience-243	103	5	applied	apply	VERB
bioscience-243	103	6	to	to	ADP
bioscience-243	103	7	the	the	DET
bioscience-243	103	8	ligand	ligand	ADJ
bioscience-243	103	9	structure	structure	NOUN
bioscience-243	103	10	.	.	PUNCT
bioscience-243	104	1	the	the	DET
bioscience-243	104	2	final	final	ADJ
bioscience-243	104	3	step	step	NOUN
bioscience-243	104	4	involved	involve	VERB
bioscience-243	104	5	adjusting	adjust	VERB
bioscience-243	104	6	the	the	DET
bioscience-243	104	7	torsional	torsional	ADJ
bioscience-243	104	8	rotation	rotation	NOUN
bioscience-243	104	9	points	point	NOUN
bioscience-243	104	10	using	use	VERB
bioscience-243	104	11	the	the	DET
bioscience-243	104	12	same	same	ADJ
bioscience-243	104	13	procedure	procedure	NOUN
bioscience-243	104	14	applied	apply	VERB
bioscience-243	104	15	to	to	ADP
bioscience-243	104	16	the	the	DET
bioscience-243	104	17	native	native	ADJ
bioscience-243	104	18	l	l	PROPN
bioscience-243	104	19	-	-	ADJ
bioscience-243	104	20	norepinephrine	norepinephrine	ADJ
bioscience-243	104	21	ligand	ligand	NOUN
bioscience-243	104	22	.	.	PUNCT
bioscience-243	105	1	highlights	highlight	NOUN
bioscience-243	105	2	in	in	ADP
bioscience-243	105	3	bioscience	bioscience	NOUN
bioscience-243	105	4	page	page	NOUN
bioscience-243	105	5	2	2	NUM
bioscience-243	105	6	of	of	ADP
bioscience-243	105	7	9	9	NUM
bioscience-243	105	8	may	may	PROPN
bioscience-243	105	9	2025|volume	2025|volume	NUM
bioscience-243	105	10	8	8	NUM
bioscience-243	105	11	http://bioscience.highlightsin.org/	http://bioscience.highlightsin.org/	ADV
bioscience-243	105	12	oktarianti	oktarianti	INTJ
bioscience-243	106	1	r	r	NOUN
bioscience-243	106	2	et	et	NOUN
bioscience-243	106	3	al	al	PROPN
bioscience-243	106	4	.	.	PROPN
bioscience-243	106	5	,	,	PUNCT
bioscience-243	106	6	2025	2025	NUM
bioscience-243	106	7	in	in	ADP
bioscience-243	106	8	silico	silico	NOUN
bioscience-243	106	9	study	study	NOUN
bioscience-243	106	10	of	of	ADP
bioscience-243	106	11	the	the	DET
bioscience-243	106	12	interaction	interaction	NOUN
bioscience-243	106	13	between	between	ADP
bioscience-243	106	14	serotonin	serotonin	VERB
bioscience-243	106	15	and	and	CCONJ
bioscience-243	106	16	d7	d7	PROPN
bioscience-243	106	17	protein	protein	NOUN
bioscience-243	106	18	the	the	DET
bioscience-243	106	19	fully	fully	ADV
bioscience-243	106	20	optimized	optimize	VERB
bioscience-243	106	21	structure	structure	NOUN
bioscience-243	106	22	of	of	ADP
bioscience-243	106	23	the	the	DET
bioscience-243	106	24	serotonin	serotonin	NOUN
bioscience-243	106	25	ligand	ligand	NOUN
bioscience-243	106	26	was	be	AUX
bioscience-243	106	27	saved	save	VERB
bioscience-243	106	28	in	in	ADP
bioscience-243	106	29	.pdbqt	.pdbqt	NOUN
bioscience-243	106	30	format	format	NOUN
bioscience-243	106	31	.	.	PUNCT
bioscience-243	107	1	molecular	molecular	ADJ
bioscience-243	107	2	docking	docking	NOUN
bioscience-243	107	3	between	between	ADP
bioscience-243	107	4	d7	d7	PROPN
bioscience-243	107	5	protein	protein	NOUN
bioscience-243	107	6	and	and	CCONJ
bioscience-243	107	7	serotonin	serotonin	VERB
bioscience-243	107	8	test	test	NOUN
bioscience-243	107	9	ligand	ligand	NOUN
bioscience-243	107	10	the	the	DET
bioscience-243	107	11	process	process	NOUN
bioscience-243	107	12	of	of	ADP
bioscience-243	107	13	molecular	molecular	ADJ
bioscience-243	107	14	docking	docking	NOUN
bioscience-243	107	15	of	of	ADP
bioscience-243	107	16	d7	d7	PROPN
bioscience-243	107	17	protein	protein	NOUN
bioscience-243	107	18	with	with	ADP
bioscience-243	107	19	the	the	DET
bioscience-243	107	20	serotonin	serotonin	NOUN
bioscience-243	107	21	test	test	NOUN
bioscience-243	107	22	ligand	ligand	NOUN
bioscience-243	107	23	is	be	AUX
bioscience-243	107	24	carried	carry	VERB
bioscience-243	107	25	out	out	ADP
bioscience-243	107	26	using	use	VERB
bioscience-243	107	27	autodock	autodock	NOUN
bioscience-243	107	28	tools	tool	NOUN
bioscience-243	107	29	software	software	NOUN
bioscience-243	107	30	.	.	PUNCT
bioscience-243	108	1	the	the	DET
bioscience-243	108	2	first	first	ADJ
bioscience-243	108	3	step	step	NOUN
bioscience-243	108	4	of	of	ADP
bioscience-243	108	5	this	this	DET
bioscience-243	108	6	process	process	NOUN
bioscience-243	108	7	is	be	AUX
bioscience-243	108	8	to	to	PART
bioscience-243	108	9	place	place	VERB
bioscience-243	108	10	the	the	DET
bioscience-243	108	11	structure	structure	NOUN
bioscience-243	108	12	file	file	NOUN
bioscience-243	108	13	of	of	ADP
bioscience-243	108	14	d7	d7	PROPN
bioscience-243	108	15	protein	protein	NOUN
bioscience-243	108	16	in	in	ADP
bioscience-243	108	17	.pdbqt	.pdbqt	NOUN
bioscience-243	108	18	format	format	NOUN
bioscience-243	108	19	and	and	CCONJ
bioscience-243	108	20	the	the	DET
bioscience-243	108	21	structure	structure	NOUN
bioscience-243	108	22	file	file	NOUN
bioscience-243	108	23	of	of	ADP
bioscience-243	108	24	the	the	DET
bioscience-243	108	25	serotonin	serotonin	NOUN
bioscience-243	108	26	ligand	ligand	NOUN
bioscience-243	108	27	into	into	ADP
bioscience-243	108	28	the	the	DET
bioscience-243	108	29	same	same	ADJ
bioscience-243	108	30	folder	folder	NOUN
bioscience-243	108	31	.	.	PUNCT
bioscience-243	109	1	this	this	DET
bioscience-243	109	2	folder	folder	NOUN
bioscience-243	109	3	also	also	ADV
bioscience-243	109	4	contains	contain	VERB
bioscience-243	109	5	the	the	DET
bioscience-243	109	6	programs	program	NOUN
bioscience-243	109	7	autogrid4	autogrid4	NOUN
bioscience-243	109	8	and	and	CCONJ
bioscience-243	109	9	autodock4	autodock4	X
bioscience-243	110	1	[	[	X
bioscience-243	110	2	23	23	NUM
bioscience-243	110	3	]	]	PUNCT
bioscience-243	110	4	.	.	PUNCT
bioscience-243	111	1	the	the	DET
bioscience-243	111	2	d7	d7	PROPN
bioscience-243	111	3	protein	protein	NOUN
bioscience-243	111	4	was	be	AUX
bioscience-243	111	5	first	first	ADV
bioscience-243	111	6	set	set	VERB
bioscience-243	111	7	up	up	ADP
bioscience-243	111	8	as	as	ADP
bioscience-243	111	9	the	the	DET
bioscience-243	111	10	macromolecule	macromolecule	NOUN
bioscience-243	111	11	,	,	PUNCT
bioscience-243	111	12	and	and	CCONJ
bioscience-243	111	13	the	the	DET
bioscience-243	111	14	serotonin	serotonin	ADJ
bioscience-243	111	15	ligand	ligand	NOUN
bioscience-243	111	16	configuration	configuration	NOUN
bioscience-243	111	17	was	be	AUX
bioscience-243	111	18	used	use	VERB
bioscience-243	111	19	to	to	PART
bioscience-243	111	20	determine	determine	VERB
bioscience-243	111	21	and	and	CCONJ
bioscience-243	111	22	create	create	VERB
bioscience-243	111	23	the	the	DET
bioscience-243	111	24	gridbox	gridbox	NOUN
bioscience-243	111	25	.	.	PUNCT
bioscience-243	112	1	the	the	DET
bioscience-243	112	2	gridbox	gridbox	NOUN
bioscience-243	112	3	used	use	VERB
bioscience-243	112	4	is	be	AUX
bioscience-243	112	5	based	base	VERB
bioscience-243	112	6	on	on	ADP
bioscience-243	112	7	the	the	DET
bioscience-243	112	8	result	result	NOUN
bioscience-243	112	9	of	of	ADP
bioscience-243	112	10	coordinate	coordinate	NOUN
bioscience-243	112	11	adjustments	adjustment	NOUN
bioscience-243	112	12	from	from	ADP
bioscience-243	112	13	the	the	DET
bioscience-243	112	14	validation	validation	NOUN
bioscience-243	112	15	or	or	CCONJ
bioscience-243	112	16	re	re	ADJ
bioscience-243	112	17	-	-	ADJ
bioscience-243	112	18	docking	docking	ADJ
bioscience-243	112	19	process	process	NOUN
bioscience-243	112	20	between	between	ADP
bioscience-243	112	21	d7	d7	PROPN
bioscience-243	112	22	protein	protein	NOUN
bioscience-243	112	23	and	and	CCONJ
bioscience-243	112	24	the	the	DET
bioscience-243	112	25	native	native	ADJ
bioscience-243	112	26	ligand	ligand	NOUN
bioscience-243	112	27	l	l	NOUN
bioscience-243	112	28	-	-	NOUN
bioscience-243	112	29	norepinephrine	norepinephrine	NOUN
bioscience-243	112	30	.	.	PUNCT
bioscience-243	113	1	the	the	DET
bioscience-243	113	2	coordinate	coordinate	ADJ
bioscience-243	113	3	adjustments	adjustment	NOUN
bioscience-243	113	4	of	of	ADP
bioscience-243	113	5	the	the	DET
bioscience-243	113	6	gridbox	gridbox	NOUN
bioscience-243	113	7	on	on	ADP
bioscience-243	113	8	protein	protein	NOUN
bioscience-243	113	9	d7	d7	PROPN
bioscience-243	113	10	with	with	ADP
bioscience-243	113	11	the	the	DET
bioscience-243	113	12	test	test	NOUN
bioscience-243	113	13	ligand	ligand	NOUN
bioscience-243	113	14	serotonin	serotonin	NOUN
bioscience-243	113	15	are	be	AUX
bioscience-243	113	16	then	then	ADV
bioscience-243	113	17	saved	save	VERB
bioscience-243	113	18	in	in	ADP
bioscience-243	113	19	.gpf	.gpf	NOUN
bioscience-243	113	20	format	format	NOUN
bioscience-243	113	21	in	in	ADP
bioscience-243	113	22	the	the	DET
bioscience-243	113	23	same	same	ADJ
bioscience-243	113	24	folder	folder	NOUN
bioscience-243	113	25	.	.	PUNCT
bioscience-243	114	1	the	the	DET
bioscience-243	114	2	next	next	ADJ
bioscience-243	114	3	step	step	NOUN
bioscience-243	114	4	is	be	AUX
bioscience-243	114	5	to	to	PART
bioscience-243	114	6	run	run	VERB
bioscience-243	114	7	the	the	DET
bioscience-243	114	8	autogrid4	autogrid4	NOUN
bioscience-243	114	9	program	program	NOUN
bioscience-243	114	10	using	use	VERB
bioscience-243	114	11	the	the	DET
bioscience-243	114	12	command	command	NOUN
bioscience-243	114	13	prompt	prompt	NOUN
bioscience-243	114	14	(	(	PUNCT
bioscience-243	114	15	cmd	cmd	NOUN
bioscience-243	114	16	)	)	PUNCT
bioscience-243	114	17	.	.	PUNCT
bioscience-243	115	1	this	this	DET
bioscience-243	115	2	program	program	NOUN
bioscience-243	115	3	is	be	AUX
bioscience-243	115	4	executed	execute	VERB
bioscience-243	115	5	based	base	VERB
bioscience-243	115	6	on	on	ADP
bioscience-243	115	7	the	the	DET
bioscience-243	115	8	coordinate	coordinate	NOUN
bioscience-243	115	9	settings	setting	NOUN
bioscience-243	115	10	of	of	ADP
bioscience-243	115	11	the	the	DET
bioscience-243	115	12	gridbox	gridbox	NOUN
bioscience-243	115	13	that	that	PRON
bioscience-243	115	14	have	have	AUX
bioscience-243	115	15	been	be	AUX
bioscience-243	115	16	created	create	VERB
bioscience-243	115	17	.	.	PUNCT
bioscience-243	116	1	the	the	DET
bioscience-243	116	2	next	next	ADJ
bioscience-243	116	3	step	step	NOUN
bioscience-243	116	4	is	be	AUX
bioscience-243	116	5	to	to	PART
bioscience-243	116	6	run	run	VERB
bioscience-243	116	7	the	the	DET
bioscience-243	116	8	autodock4	autodock4	PROPN
bioscience-243	116	9	program	program	NOUN
bioscience-243	116	10	,	,	PUNCT
bioscience-243	116	11	which	which	PRON
bioscience-243	116	12	treats	treat	VERB
bioscience-243	116	13	the	the	DET
bioscience-243	116	14	protein	protein	NOUN
bioscience-243	116	15	as	as	ADP
bioscience-243	116	16	rigid	rigid	ADJ
bioscience-243	116	17	.	.	PUNCT
bioscience-243	117	1	the	the	DET
bioscience-243	117	2	autodock4	autodock4	PROPN
bioscience-243	117	3	program	program	NOUN
bioscience-243	117	4	is	be	AUX
bioscience-243	117	5	run	run	VERB
bioscience-243	117	6	with	with	ADP
bioscience-243	117	7	the	the	DET
bioscience-243	117	8	same	same	ADJ
bioscience-243	117	9	command	command	NOUN
bioscience-243	117	10	based	base	VERB
bioscience-243	117	11	on	on	ADP
bioscience-243	117	12	the	the	DET
bioscience-243	117	13	previous	previous	ADJ
bioscience-243	117	14	autogrid	autogrid	ADJ
bioscience-243	117	15	data	datum	NOUN
bioscience-243	117	16	[	[	X
bioscience-243	117	17	24	24	NUM
bioscience-243	117	18	]	]	PUNCT
bioscience-243	117	19	.	.	PUNCT
bioscience-243	118	1	analysis	analysis	NOUN
bioscience-243	118	2	and	and	CCONJ
bioscience-243	118	3	visualization	visualization	NOUN
bioscience-243	118	4	of	of	ADP
bioscience-243	118	5	molecular	molecular	ADJ
bioscience-243	118	6	docking	docking	NOUN
bioscience-243	118	7	results	result	NOUN
bioscience-243	118	8	between	between	ADP
bioscience-243	118	9	d7	d7	PROPN
bioscience-243	118	10	protein	protein	NOUN
bioscience-243	118	11	and	and	CCONJ
bioscience-243	118	12	serotonin	serotonin	VERB
bioscience-243	118	13	test	test	NOUN
bioscience-243	118	14	ligand	ligand	NOUN
bioscience-243	118	15	the	the	DET
bioscience-243	118	16	analysis	analysis	NOUN
bioscience-243	118	17	of	of	ADP
bioscience-243	118	18	the	the	DET
bioscience-243	118	19	molecular	molecular	ADJ
bioscience-243	118	20	docking	docking	NOUN
bioscience-243	118	21	results	result	NOUN
bioscience-243	118	22	between	between	ADP
bioscience-243	118	23	d7	d7	PROPN
bioscience-243	118	24	protein	protein	NOUN
bioscience-243	118	25	and	and	CCONJ
bioscience-243	118	26	the	the	DET
bioscience-243	118	27	serotonin	serotonin	NOUN
bioscience-243	118	28	test	test	NOUN
bioscience-243	118	29	ligand	ligand	NOUN
bioscience-243	118	30	is	be	AUX
bioscience-243	118	31	shown	show	VERB
bioscience-243	118	32	from	from	ADP
bioscience-243	118	33	several	several	ADJ
bioscience-243	118	34	parameters	parameter	NOUN
bioscience-243	118	35	such	such	ADJ
bioscience-243	118	36	as	as	ADP
bioscience-243	118	37	the	the	DET
bioscience-243	118	38	gibbs	gibbs	PROPN
bioscience-243	118	39	free	free	ADJ
bioscience-243	118	40	energy	energy	NOUN
bioscience-243	118	41	value	value	NOUN
bioscience-243	118	42	(	(	PUNCT
bioscience-243	118	43	∆g	∆g	PROPN
bioscience-243	118	44	)	)	PUNCT
bioscience-243	118	45	,	,	PUNCT
bioscience-243	118	46	types	type	NOUN
bioscience-243	118	47	of	of	ADP
bioscience-243	118	48	chemical	chemical	NOUN
bioscience-243	118	49	bonds	bond	NOUN
bioscience-243	118	50	,	,	PUNCT
bioscience-243	118	51	and	and	CCONJ
bioscience-243	118	52	amino	amino	NOUN
bioscience-243	118	53	acid	acid	NOUN
bioscience-243	118	54	residues	residue	NOUN
bioscience-243	118	55	involved	involve	VERB
bioscience-243	118	56	in	in	ADP
bioscience-243	118	57	the	the	DET
bioscience-243	118	58	interactions	interaction	NOUN
bioscience-243	118	59	formed	form	VERB
bioscience-243	118	60	.	.	PUNCT
bioscience-243	119	1	the	the	DET
bioscience-243	119	2	results	result	NOUN
bioscience-243	119	3	of	of	ADP
bioscience-243	119	4	the	the	DET
bioscience-243	119	5	gibbs	gibbs	PROPN
bioscience-243	119	6	free	free	ADJ
bioscience-243	119	7	energy	energy	NOUN
bioscience-243	119	8	values	value	NOUN
bioscience-243	119	9	were	be	AUX
bioscience-243	119	10	compared	compare	VERB
bioscience-243	119	11	with	with	ADP
bioscience-243	119	12	the	the	DET
bioscience-243	119	13	validation	validation	NOUN
bioscience-243	119	14	results	result	NOUN
bioscience-243	119	15	of	of	ADP
bioscience-243	119	16	the	the	DET
bioscience-243	119	17	re	re	NOUN
bioscience-243	119	18	-	-	NOUN
bioscience-243	119	19	docking	docking	NOUN
bioscience-243	119	20	of	of	ADP
bioscience-243	119	21	d7	d7	PROPN
bioscience-243	119	22	protein	protein	NOUN
bioscience-243	119	23	with	with	ADP
bioscience-243	119	24	the	the	DET
bioscience-243	119	25	native	native	ADJ
bioscience-243	119	26	ligand	ligand	NOUN
bioscience-243	119	27	l	l	NOUN
bioscience-243	119	28	-	-	NOUN
bioscience-243	119	29	norepinephrine	norepinephrine	NOUN
bioscience-243	119	30	.	.	PUNCT
bioscience-243	120	1	this	this	DET
bioscience-243	120	2	comparison	comparison	NOUN
bioscience-243	120	3	was	be	AUX
bioscience-243	120	4	made	make	VERB
bioscience-243	120	5	to	to	PART
bioscience-243	120	6	observe	observe	VERB
bioscience-243	120	7	the	the	DET
bioscience-243	120	8	differences	difference	NOUN
bioscience-243	120	9	in	in	ADP
bioscience-243	120	10	gibbs	gibbs	PROPN
bioscience-243	120	11	free	free	ADJ
bioscience-243	120	12	energy	energy	NOUN
bioscience-243	120	13	in	in	ADP
bioscience-243	120	14	the	the	DET
bioscience-243	120	15	formation	formation	NOUN
bioscience-243	120	16	of	of	ADP
bioscience-243	120	17	interactions	interaction	NOUN
bioscience-243	120	18	between	between	ADP
bioscience-243	120	19	d7	d7	PROPN
bioscience-243	120	20	protein	protein	NOUN
bioscience-243	120	21	and	and	CCONJ
bioscience-243	120	22	the	the	DET
bioscience-243	120	23	test	test	NOUN
bioscience-243	120	24	ligand	ligand	NOUN
bioscience-243	120	25	.	.	PUNCT
bioscience-243	121	1	table	table	NOUN
bioscience-243	121	2	1	1	NUM
bioscience-243	121	3	.	.	PUNCT
bioscience-243	121	4	properly	properly	ADV
bioscience-243	121	5	formatted	format	VERB
bioscience-243	121	6	d7	d7	PROPN
bioscience-243	121	7	protein	protein	NOUN
bioscience-243	121	8	sequence	sequence	NOUN
bioscience-243	121	9	of	of	ADP
bioscience-243	121	10	ae	ae	PROPN
bioscience-243	121	11	.	.	PUNCT
bioscience-243	122	1	aegypti	aegypti	VERB
bioscience-243	122	2	>	>	PUNCT
bioscience-243	122	3	sp|p18153|all2_aedae	sp|p18153|all2_aedae	PROPN
bioscience-243	122	4	37	37	NUM
bioscience-243	122	5	kda	kda	NOUN
bioscience-243	122	6	salivary	salivary	NOUN
bioscience-243	122	7	gland	gland	NOUN
bioscience-243	122	8	allergen	allergen	NOUN
bioscience-243	122	9	aed	aed	NOUN
bioscience-243	122	10	a	a	DET
bioscience-243	122	11	2	2	NUM
bioscience-243	122	12	os	os	NOUN
bioscience-243	122	13	=	=	NOUN
bioscience-243	122	14	aedes	aedes	PROPN
bioscience-243	122	15	aegypti	aegypti	VERB
bioscience-243	122	16	ox=7159	ox=7159	PROPN
bioscience-243	122	17	gn	gn	NOUN
bioscience-243	122	18	=	=	NOUN
bioscience-243	122	19	d7	d7	ADJ
bioscience-243	122	20	pe=1	pe=1	PROPN
bioscience-243	122	21	sv=2	sv=2	PROPN
bioscience-243	122	22	mkedtlaavifsvvastgpfdpeemlftftrcmednlledgpnrlpmlakw	mkedtlaavifsvvastgpfdpeemlftftrcmednlledgpnrlpmlakw	ADJ
bioscience-243	122	23	kewinepvdspatqcgfkcvlvrtglydpvaqkfdasviqegfkaypslg	kewinepvdspatqcgfkcvlvrtglydpvaqkfdasviqegfkaypslg	VERB
bioscience-243	122	24	ekskveayanavqqlpstnndcaavfkaydpvhkahkdtsknlfhgnkel	ekskveayanavqqlpstnndcaavfkaydpvhkahkdtsknlfhgnkel	NOUN
bioscience-243	122	25	tkglyeklgkdirokkqsyfeecenkyypagsdkrqqlckiroytvldda	tkglyeklgkdirokkqsyfeecenkyypagsdkrqqlckiroytvldda	PROPN
bioscience-243	122	26	lfkehtdcvmkgiryitknneldaeevkrdemqvnkdtkalekvlndcks	lfkehtdcvmkgiryitknneldaeevkrdemqvnkdtkalekvlndcks	PROPN
bioscience-243	122	27	kepsnagekswhyxkclvssvkddekeafdyrevksqiyafnlpkkqvys	kepsnagekswhyxkclvssvkddekeafdyrevksqiyafnlpkkqvys	PROPN
bioscience-243	122	28	kpavqsqvmeidgkqcpq	kpavqsqvmeidgkqcpq	VERB
bioscience-243	122	29	the	the	DET
bioscience-243	122	30	results	result	NOUN
bioscience-243	122	31	of	of	ADP
bioscience-243	122	32	the	the	DET
bioscience-243	122	33	molecular	molecular	ADJ
bioscience-243	122	34	docking	docking	NOUN
bioscience-243	122	35	were	be	AUX
bioscience-243	122	36	then	then	ADV
bioscience-243	122	37	visualized	visualize	VERB
bioscience-243	122	38	to	to	PART
bioscience-243	122	39	observe	observe	VERB
bioscience-243	122	40	the	the	DET
bioscience-243	122	41	conformation	conformation	NOUN
bioscience-243	122	42	of	of	ADP
bioscience-243	122	43	the	the	DET
bioscience-243	122	44	bond	bond	NOUN
bioscience-243	122	45	between	between	ADP
bioscience-243	122	46	the	the	DET
bioscience-243	122	47	3d	3d	NUM
bioscience-243	122	48	structure	structure	NOUN
bioscience-243	122	49	and	and	CCONJ
bioscience-243	122	50	the	the	DET
bioscience-243	122	51	two	two	NUM
bioscience-243	122	52	-	-	PUNCT
bioscience-243	122	53	dimensional	dimensional	ADJ
bioscience-243	122	54	structure	structure	NOUN
bioscience-243	122	55	of	of	ADP
bioscience-243	122	56	the	the	DET
bioscience-243	122	57	protein	protein	NOUN
bioscience-243	122	58	and	and	CCONJ
bioscience-243	122	59	test	test	NOUN
bioscience-243	122	60	ligand	ligand	NOUN
bioscience-243	122	61	.	.	PUNCT
bioscience-243	123	1	the	the	DET
bioscience-243	123	2	visualization	visualization	NOUN
bioscience-243	123	3	results	result	NOUN
bioscience-243	123	4	can	can	AUX
bioscience-243	123	5	include	include	VERB
bioscience-243	123	6	information	information	NOUN
bioscience-243	123	7	on	on	ADP
bioscience-243	123	8	amino	amino	NOUN
bioscience-243	123	9	acid	acid	NOUN
bioscience-243	123	10	residues	residue	NOUN
bioscience-243	123	11	and	and	CCONJ
bioscience-243	123	12	the	the	DET
bioscience-243	123	13	types	type	NOUN
bioscience-243	123	14	of	of	ADP
bioscience-243	123	15	bonds	bond	NOUN
bioscience-243	123	16	formed	form	VERB
bioscience-243	123	17	.	.	PUNCT
bioscience-243	124	1	visualization	visualization	NOUN
bioscience-243	124	2	and	and	CCONJ
bioscience-243	124	3	analysis	analysis	NOUN
bioscience-243	124	4	of	of	ADP
bioscience-243	124	5	the	the	DET
bioscience-243	124	6	interaction	interaction	NOUN
bioscience-243	124	7	between	between	ADP
bioscience-243	124	8	d7	d7	PROPN
bioscience-243	124	9	protein	protein	NOUN
bioscience-243	124	10	and	and	CCONJ
bioscience-243	124	11	the	the	DET
bioscience-243	124	12	serotonin	serotonin	NOUN
bioscience-243	124	13	test	test	NOUN
bioscience-243	124	14	ligand	ligand	NOUN
bioscience-243	124	15	were	be	AUX
bioscience-243	124	16	performed	perform	VERB
bioscience-243	124	17	using	use	VERB
bioscience-243	124	18	biovia	biovia	PROPN
bioscience-243	124	19	discovery	discovery	PROPN
bioscience-243	124	20	studio	studio	NOUN
bioscience-243	124	21	software	software	NOUN
bioscience-243	125	1	[	[	X
bioscience-243	125	2	25	25	NUM
bioscience-243	125	3	]	]	PUNCT
bioscience-243	125	4	.	.	PUNCT
bioscience-243	126	1	results	result	NOUN
bioscience-243	126	2	and	and	CCONJ
bioscience-243	126	3	discussions	discussion	NOUN
bioscience-243	126	4	3d	3d	NUM
bioscience-243	126	5	structure	structure	NOUN
bioscience-243	126	6	of	of	ADP
bioscience-243	126	7	d7	d7	PROPN
bioscience-243	126	8	protein	protein	NOUN
bioscience-243	126	9	from	from	ADP
bioscience-243	126	10	ae	ae	PROPN
bioscience-243	126	11	.	.	PUNCT
bioscience-243	127	1	aegypti	aegypti	VERB
bioscience-243	127	2	salivary	salivary	ADJ
bioscience-243	127	3	gland	gland	NOUN
bioscience-243	127	4	the	the	DET
bioscience-243	127	5	amino	amino	NOUN
bioscience-243	127	6	acid	acid	NOUN
bioscience-243	127	7	sequence	sequence	NOUN
bioscience-243	127	8	data	datum	NOUN
bioscience-243	127	9	of	of	ADP
bioscience-243	127	10	the	the	DET
bioscience-243	127	11	d7	d7	PROPN
bioscience-243	127	12	protein	protein	NOUN
bioscience-243	127	13	from	from	ADP
bioscience-243	127	14	the	the	DET
bioscience-243	127	15	ae	ae	PROPN
bioscience-243	127	16	.	.	PUNCT
bioscience-243	128	1	aegypti	aegypti	VERB
bioscience-243	128	2	salivary	salivary	ADJ
bioscience-243	128	3	gland	gland	NOUN
bioscience-243	128	4	was	be	AUX
bioscience-243	128	5	obtained	obtain	VERB
bioscience-243	128	6	from	from	ADP
bioscience-243	128	7	the	the	DET
bioscience-243	128	8	uniprot	uniprot	ADJ
bioscience-243	128	9	database	database	NOUN
bioscience-243	128	10	with	with	ADP
bioscience-243	128	11	accession	accession	NOUN
bioscience-243	128	12	number	number	NOUN
bioscience-243	128	13	p18153	p18153	VERB
bioscience-243	128	14	.	.	PUNCT
bioscience-243	129	1	the	the	DET
bioscience-243	129	2	protein	protein	NOUN
bioscience-243	129	3	is	be	AUX
bioscience-243	129	4	identified	identify	VERB
bioscience-243	129	5	by	by	ADP
bioscience-243	129	6	the	the	DET
bioscience-243	129	7	gene	gene	NOUN
bioscience-243	129	8	name	name	NOUN
bioscience-243	129	9	d7	d7	PROPN
bioscience-243	129	10	and	and	CCONJ
bioscience-243	129	11	is	be	AUX
bioscience-243	129	12	known	know	VERB
bioscience-243	129	13	as	as	ADP
bioscience-243	129	14	the	the	DET
bioscience-243	129	15	salivary	salivary	ADJ
bioscience-243	129	16	gland	gland	NOUN
bioscience-243	129	17	allergen	allergen	NOUN
bioscience-243	129	18	aed	aed	NOUN
bioscience-243	129	19	a	a	DET
bioscience-243	129	20	2	2	NUM
bioscience-243	129	21	,	,	PUNCT
bioscience-243	129	22	with	with	ADP
bioscience-243	129	23	a	a	DET
bioscience-243	129	24	molecular	molecular	ADJ
bioscience-243	129	25	weight	weight	NOUN
bioscience-243	129	26	of	of	ADP
bioscience-243	129	27	37	37	NUM
bioscience-243	129	28	kda	kda	NOUN
bioscience-243	129	29	.	.	PUNCT
bioscience-243	130	1	the	the	DET
bioscience-243	130	2	d7	d7	PROPN
bioscience-243	130	3	protein	protein	NOUN
bioscience-243	130	4	with	with	ADP
bioscience-243	130	5	accession	accession	NOUN
bioscience-243	130	6	number	number	NOUN
bioscience-243	130	7	p18153	p18153	VERB
bioscience-243	130	8	is	be	AUX
bioscience-243	130	9	a	a	DET
bioscience-243	130	10	monomeric	monomeric	ADJ
bioscience-243	130	11	protein	protein	NOUN
bioscience-243	130	12	with	with	ADP
bioscience-243	130	13	a	a	DET
bioscience-243	130	14	long	long	ADJ
bioscience-243	130	15	chain	chain	NOUN
bioscience-243	130	16	domain	domain	NOUN
bioscience-243	130	17	that	that	PRON
bioscience-243	130	18	has	have	VERB
bioscience-243	130	19	binding	bind	VERB
bioscience-243	130	20	affinity	affinity	NOUN
bioscience-243	130	21	for	for	ADP
bioscience-243	130	22	a	a	DET
bioscience-243	130	23	ligand	ligand	NOUN
bioscience-243	130	24	.	.	PUNCT
bioscience-243	131	1	the	the	DET
bioscience-243	131	2	protein	protein	NOUN
bioscience-243	131	3	is	be	AUX
bioscience-243	131	4	composed	compose	VERB
bioscience-243	131	5	of	of	ADP
bioscience-243	131	6	321	321	NUM
bioscience-243	131	7	amino	amino	NOUN
bioscience-243	131	8	acid	acid	NOUN
bioscience-243	131	9	residues	residue	NOUN
bioscience-243	131	10	,	,	PUNCT
bioscience-243	131	11	as	as	SCONJ
bioscience-243	131	12	shown	show	VERB
bioscience-243	131	13	in	in	ADP
bioscience-243	131	14	table	table	NOUN
bioscience-243	131	15	1	1	NUM
bioscience-243	131	16	.	.	PUNCT
bioscience-243	132	1	the	the	DET
bioscience-243	132	2	3d	3d	PROPN
bioscience-243	132	3	structure	structure	NOUN
bioscience-243	132	4	of	of	ADP
bioscience-243	132	5	the	the	DET
bioscience-243	132	6	d7	d7	PROPN
bioscience-243	132	7	protein	protein	NOUN
bioscience-243	132	8	from	from	ADP
bioscience-243	132	9	ae	ae	PROPN
bioscience-243	132	10	.	.	PUNCT
bioscience-243	133	1	aegypti	aegypti	PROPN
bioscience-243	133	2	was	be	AUX
bioscience-243	133	3	obtained	obtain	VERB
bioscience-243	133	4	using	use	VERB
bioscience-243	133	5	homology	homology	NOUN
bioscience-243	133	6	modeling	model	VERB
bioscience-243	133	7	techniques	technique	NOUN
bioscience-243	133	8	through	through	ADP
bioscience-243	133	9	the	the	DET
bioscience-243	133	10	swiss	swiss	ADJ
bioscience-243	133	11	-	-	PUNCT
bioscience-243	133	12	model	model	NOUN
bioscience-243	133	13	protein	protein	NOUN
bioscience-243	133	14	database	database	NOUN
bioscience-243	133	15	.	.	PUNCT
bioscience-243	134	1	construction	construction	NOUN
bioscience-243	134	2	of	of	ADP
bioscience-243	134	3	the	the	DET
bioscience-243	134	4	3d	3d	NOUN
bioscience-243	134	5	protein	protein	NOUN
bioscience-243	134	6	structure	structure	NOUN
bioscience-243	134	7	was	be	AUX
bioscience-243	134	8	carried	carry	VERB
bioscience-243	134	9	out	out	ADP
bioscience-243	134	10	using	use	VERB
bioscience-243	134	11	amino	amino	NOUN
bioscience-243	134	12	acid	acid	NOUN
bioscience-243	134	13	sequence	sequence	NOUN
bioscience-243	134	14	data	datum	NOUN
bioscience-243	134	15	of	of	ADP
bioscience-243	134	16	the	the	DET
bioscience-243	134	17	d7	d7	PROPN
bioscience-243	134	18	protein	protein	NOUN
bioscience-243	134	19	from	from	ADP
bioscience-243	134	20	the	the	DET
bioscience-243	134	21	salivary	salivary	ADJ
bioscience-243	134	22	glands	gland	NOUN
bioscience-243	134	23	of	of	ADP
bioscience-243	134	24	ae	ae	PROPN
bioscience-243	134	25	.	.	PUNCT
bioscience-243	135	1	aegypti	aegypti	PROPN
bioscience-243	135	2	.	.	PUNCT
bioscience-243	136	1	based	base	VERB
bioscience-243	136	2	on	on	ADP
bioscience-243	136	3	the	the	DET
bioscience-243	136	4	homology	homology	NOUN
bioscience-243	136	5	modeling	modeling	NOUN
bioscience-243	136	6	process	process	NOUN
bioscience-243	136	7	,	,	PUNCT
bioscience-243	136	8	the	the	DET
bioscience-243	136	9	best	good	ADJ
bioscience-243	136	10	model	model	NOUN
bioscience-243	136	11	selected	select	VERB
bioscience-243	136	12	used	use	VERB
bioscience-243	136	13	the	the	DET
bioscience-243	136	14	template	template	NOUN
bioscience-243	136	15	with	with	ADP
bioscience-243	136	16	pdb	pdb	PROPN
bioscience-243	136	17	i	i	PROPN
bioscience-243	136	18	d	d	PROPN
bioscience-243	136	19	3dye.1	3dye.1	NUM
bioscience-243	136	20	.	.	PUNCT
bioscience-243	137	1	the	the	DET
bioscience-243	137	2	information	information	NOUN
bioscience-243	137	3	on	on	ADP
bioscience-243	137	4	the	the	DET
bioscience-243	137	5	3d	3d	NUM
bioscience-243	137	6	structure	structure	NOUN
bioscience-243	137	7	model	model	NOUN
bioscience-243	137	8	of	of	ADP
bioscience-243	137	9	the	the	DET
bioscience-243	137	10	protein	protein	NOUN
bioscience-243	137	11	is	be	AUX
bioscience-243	137	12	known	know	VERB
bioscience-243	137	13	as	as	ADP
bioscience-243	137	14	the	the	DET
bioscience-243	137	15	d7	d7	PROPN
bioscience-243	137	16	protein	protein	NOUN
bioscience-243	137	17	crystal	crystal	NOUN
bioscience-243	137	18	structure	structure	NOUN
bioscience-243	137	19	of	of	ADP
bioscience-243	137	20	the	the	DET
bioscience-243	137	21	aed7	aed7	ADJ
bioscience-243	137	22	–	–	PUNCT
bioscience-243	137	23	norepinephrine	norepinephrine	NOUN
bioscience-243	137	24	complex	complex	NOUN
bioscience-243	137	25	.	.	PUNCT
bioscience-243	138	1	the	the	DET
bioscience-243	138	2	3d	3d	PROPN
bioscience-243	138	3	structure	structure	NOUN
bioscience-243	138	4	of	of	ADP
bioscience-243	138	5	the	the	DET
bioscience-243	138	6	d7	d7	PROPN
bioscience-243	138	7	protein	protein	NOUN
bioscience-243	138	8	contains	contain	VERB
bioscience-243	138	9	a	a	DET
bioscience-243	138	10	norepinephrine	norepinephrine	NOUN
bioscience-243	138	11	molecule	molecule	NOUN
bioscience-243	138	12	which	which	PRON
bioscience-243	138	13	will	will	AUX
bioscience-243	138	14	then	then	ADV
bioscience-243	138	15	be	be	AUX
bioscience-243	138	16	used	use	VERB
bioscience-243	138	17	as	as	ADP
bioscience-243	138	18	a	a	DET
bioscience-243	138	19	native	native	ADJ
bioscience-243	138	20	ligand	ligand	NOUN
bioscience-243	138	21	.	.	PUNCT
bioscience-243	139	1	the	the	DET
bioscience-243	139	2	3d	3d	NUM
bioscience-243	139	3	structure	structure	NOUN
bioscience-243	139	4	of	of	ADP
bioscience-243	139	5	the	the	DET
bioscience-243	139	6	d7	d7	PROPN
bioscience-243	139	7	protein	protein	NOUN
bioscience-243	139	8	shows	show	VERB
bioscience-243	139	9	two	two	NUM
bioscience-243	139	10	domains	domain	NOUN
bioscience-243	139	11	of	of	ADP
bioscience-243	139	12	the	the	DET
bioscience-243	139	13	polypeptide	polypeptide	ADJ
bioscience-243	139	14	chain	chain	NOUN
bioscience-243	139	15	with	with	ADP
bioscience-243	139	16	different	different	ADJ
bioscience-243	139	17	functions	function	NOUN
bioscience-243	139	18	.	.	PUNCT
bioscience-243	140	1	the	the	DET
bioscience-243	140	2	n	n	CCONJ
bioscience-243	140	3	-	-	PUNCT
bioscience-243	140	4	terminal	terminal	ADJ
bioscience-243	140	5	domain	domain	NOUN
bioscience-243	140	6	can	can	AUX
bioscience-243	140	7	bind	bind	VERB
bioscience-243	140	8	cysteinyl	cysteinyl	ADJ
bioscience-243	140	9	leukotriene	leukotriene	NOUN
bioscience-243	140	10	molecules	molecule	NOUN
bioscience-243	140	11	,	,	PUNCT
bioscience-243	140	12	while	while	SCONJ
bioscience-243	140	13	the	the	DET
bioscience-243	140	14	c	c	NOUN
bioscience-243	140	15	-	-	PUNCT
bioscience-243	140	16	terminal	terminal	ADJ
bioscience-243	140	17	domain	domain	NOUN
bioscience-243	140	18	can	can	AUX
bioscience-243	140	19	bind	bind	VERB
bioscience-243	140	20	biogenic	biogenic	ADJ
bioscience-243	140	21	amine	amine	ADJ
bioscience-243	140	22	molecules	molecule	NOUN
bioscience-243	140	23	[	[	X
bioscience-243	140	24	10	10	NUM
bioscience-243	140	25	]	]	PUNCT
bioscience-243	140	26	.	.	PUNCT
bioscience-243	141	1	visualization	visualization	NOUN
bioscience-243	141	2	of	of	ADP
bioscience-243	141	3	the	the	DET
bioscience-243	141	4	3d	3d	PROPN
bioscience-243	141	5	structure	structure	NOUN
bioscience-243	141	6	model	model	NOUN
bioscience-243	141	7	of	of	ADP
bioscience-243	141	8	protein	protein	NOUN
bioscience-243	141	9	d7	d7	PROPN
bioscience-243	141	10	was	be	AUX
bioscience-243	141	11	carried	carry	VERB
bioscience-243	141	12	out	out	ADP
bioscience-243	141	13	using	use	VERB
bioscience-243	141	14	the	the	DET
bioscience-243	141	15	xray	xray	ADJ
bioscience-243	141	16	crystallography	crystallography	NOUN
bioscience-243	141	17	method	method	NOUN
bioscience-243	141	18	with	with	ADP
bioscience-243	141	19	a	a	DET
bioscience-243	141	20	resolution	resolution	NOUN
bioscience-243	141	21	of	of	ADP
bioscience-243	141	22	1.75	1.75	NUM
bioscience-243	141	23	å	å	NOUN
bioscience-243	141	24	.	.	PUNCT
bioscience-243	142	1	the	the	DET
bioscience-243	142	2	3d	3d	PROPN
bioscience-243	142	3	structure	structure	NOUN
bioscience-243	142	4	model	model	NOUN
bioscience-243	142	5	of	of	ADP
bioscience-243	142	6	a	a	DET
bioscience-243	142	7	protein	protein	NOUN
bioscience-243	142	8	is	be	AUX
bioscience-243	142	9	said	say	VERB
bioscience-243	142	10	to	to	PART
bioscience-243	142	11	have	have	VERB
bioscience-243	142	12	good	good	ADJ
bioscience-243	142	13	quality	quality	NOUN
bioscience-243	142	14	if	if	SCONJ
bioscience-243	142	15	it	it	PRON
bioscience-243	142	16	shows	show	VERB
bioscience-243	142	17	a	a	DET
bioscience-243	142	18	resolution	resolution	NOUN
bioscience-243	142	19	of	of	ADP
bioscience-243	142	20	<	<	X
bioscience-243	142	21	2.5	2.5	NUM
bioscience-243	142	22	å	å	NOUN
bioscience-243	142	23	from	from	ADP
bioscience-243	142	24	the	the	DET
bioscience-243	142	25	results	result	NOUN
bioscience-243	142	26	of	of	ADP
bioscience-243	142	27	x	x	ADJ
bioscience-243	142	28	-	-	NOUN
bioscience-243	142	29	ray	ray	NOUN
bioscience-243	142	30	crystallography	crystallography	NOUN
bioscience-243	142	31	[	[	X
bioscience-243	142	32	20	20	NUM
bioscience-243	142	33	]	]	PUNCT
bioscience-243	142	34	.	.	PUNCT
bioscience-243	143	1	the	the	DET
bioscience-243	143	2	3d	3d	PROPN
bioscience-243	143	3	structure	structure	NOUN
bioscience-243	143	4	model	model	NOUN
bioscience-243	143	5	of	of	ADP
bioscience-243	143	6	the	the	DET
bioscience-243	143	7	d7	d7	PROPN
bioscience-243	143	8	ae	ae	PROPN
bioscience-243	143	9	.	.	PUNCT
bioscience-243	144	1	aegypti	aegypti	VERB
bioscience-243	144	2	protein	protein	NOUN
bioscience-243	144	3	can	can	AUX
bioscience-243	144	4	be	be	AUX
bioscience-243	144	5	seen	see	VERB
bioscience-243	144	6	in	in	ADP
bioscience-243	144	7	figure	figure	NOUN
bioscience-243	144	8	1	1	NUM
bioscience-243	144	9	.	.	PUNCT
bioscience-243	145	1	figure	figure	NOUN
bioscience-243	145	2	1	1	NUM
bioscience-243	145	3	.	.	PUNCT
bioscience-243	145	4	3d	3d	NUM
bioscience-243	145	5	structure	structure	NOUN
bioscience-243	145	6	of	of	ADP
bioscience-243	145	7	d7	d7	PROPN
bioscience-243	145	8	protein	protein	NOUN
bioscience-243	145	9	(	(	PUNCT
bioscience-243	145	10	stml	stml	VERB
bioscience-243	145	11	i	i	PROPN
bioscience-243	145	12	d	d	NOUN
bioscience-243	145	13	:	:	PUNCT
bioscience-243	145	14	3dye.1	3dye.1	NUM
bioscience-243	145	15	)	)	PUNCT
bioscience-243	145	16	,	,	PUNCT
bioscience-243	145	17	a	a	DET
bioscience-243	145	18	:	:	PUNCT
bioscience-243	145	19	domain	domain	NOUN
bioscience-243	145	20	terminal	terminal	NOUN
bioscience-243	145	21	-	-	PUNCT
bioscience-243	145	22	n	n	CCONJ
bioscience-243	145	23	,	,	PUNCT
bioscience-243	145	24	b	b	NOUN
bioscience-243	145	25	:	:	PUNCT
bioscience-243	145	26	domain	domain	NOUN
bioscience-243	145	27	terminal	terminal	NOUN
bioscience-243	145	28	-	-	PUNCT
bioscience-243	145	29	c	c	NOUN
bioscience-243	145	30	,	,	PUNCT
bioscience-243	145	31	c	c	NOUN
bioscience-243	145	32	:	:	PUNCT
bioscience-243	145	33	native	native	ADJ
bioscience-243	145	34	lnr	lnr	PROPN
bioscience-243	145	35	ligand	ligand	NOUN
bioscience-243	145	36	binding	bind	VERB
bioscience-243	145	37	site	site	NOUN
bioscience-243	145	38	highlights	highlight	NOUN
bioscience-243	145	39	in	in	ADP
bioscience-243	145	40	bioscience	bioscience	NOUN
bioscience-243	145	41	page	page	NOUN
bioscience-243	145	42	3	3	NUM
bioscience-243	145	43	of	of	ADP
bioscience-243	145	44	9	9	NUM
bioscience-243	145	45	may	may	PROPN
bioscience-243	145	46	2025|volume	2025|volume	NUM
bioscience-243	145	47	8	8	NUM
bioscience-243	145	48	http://bioscience.highlightsin.org/	http://bioscience.highlightsin.org/	ADV
bioscience-243	145	49	oktarianti	oktarianti	INTJ
bioscience-243	146	1	r	r	NOUN
bioscience-243	146	2	et	et	NOUN
bioscience-243	146	3	al	al	PROPN
bioscience-243	146	4	.	.	PROPN
bioscience-243	146	5	,	,	PUNCT
bioscience-243	146	6	2025	2025	NUM
bioscience-243	146	7	in	in	ADP
bioscience-243	146	8	silico	silico	NOUN
bioscience-243	146	9	study	study	NOUN
bioscience-243	146	10	of	of	ADP
bioscience-243	146	11	the	the	DET
bioscience-243	146	12	interaction	interaction	NOUN
bioscience-243	146	13	between	between	ADP
bioscience-243	146	14	serotonin	serotonin	VERB
bioscience-243	146	15	and	and	CCONJ
bioscience-243	146	16	d7	d7	ADJ
bioscience-243	146	17	protein	protein	NOUN
bioscience-243	146	18	assessment	assessment	NOUN
bioscience-243	146	19	of	of	ADP
bioscience-243	146	20	the	the	DET
bioscience-243	146	21	structural	structural	ADJ
bioscience-243	146	22	quality	quality	NOUN
bioscience-243	146	23	of	of	ADP
bioscience-243	146	24	the	the	DET
bioscience-243	146	25	ae	ae	PROPN
bioscience-243	146	26	.	.	PUNCT
bioscience-243	146	27	aegypti	aegypti	VERB
bioscience-243	146	28	salivary	salivary	ADJ
bioscience-243	146	29	gland	gland	NOUN
bioscience-243	146	30	d7	d7	PROPN
bioscience-243	146	31	protein	protein	NOUN
bioscience-243	146	32	model	model	NOUN
bioscience-243	146	33	data	datum	NOUN
bioscience-243	146	34	from	from	ADP
bioscience-243	146	35	the	the	DET
bioscience-243	146	36	results	result	NOUN
bioscience-243	146	37	of	of	ADP
bioscience-243	146	38	homology	homology	NOUN
bioscience-243	146	39	modeling	modeling	NOUN
bioscience-243	146	40	of	of	ADP
bioscience-243	146	41	d7	d7	PROPN
bioscience-243	146	42	protein	protein	NOUN
bioscience-243	146	43	were	be	AUX
bioscience-243	146	44	obtained	obtain	VERB
bioscience-243	146	45	from	from	ADP
bioscience-243	146	46	the	the	DET
bioscience-243	146	47	uniprot	uniprot	ADJ
bioscience-243	146	48	website	website	NOUN
bioscience-243	146	49	with	with	ADP
bioscience-243	146	50	the	the	DET
bioscience-243	146	51	accession	accession	NOUN
bioscience-243	146	52	code	code	NOUN
bioscience-243	146	53	p18153	p18153	PROPN
bioscience-243	146	54	.	.	PUNCT
bioscience-243	147	1	the	the	DET
bioscience-243	147	2	sequence	sequence	NOUN
bioscience-243	147	3	obtained	obtain	VERB
bioscience-243	147	4	was	be	AUX
bioscience-243	147	5	then	then	ADV
bioscience-243	147	6	copied	copy	VERB
bioscience-243	147	7	to	to	ADP
bioscience-243	147	8	the	the	DET
bioscience-243	147	9	swissmodel	swissmodel	NOUN
bioscience-243	147	10	website	website	NOUN
bioscience-243	147	11	to	to	PART
bioscience-243	147	12	build	build	VERB
bioscience-243	147	13	the	the	DET
bioscience-243	147	14	model	model	NOUN
bioscience-243	147	15	.	.	PUNCT
bioscience-243	148	1	the	the	DET
bioscience-243	148	2	results	result	NOUN
bioscience-243	148	3	of	of	ADP
bioscience-243	148	4	the	the	DET
bioscience-243	148	5	model	model	NOUN
bioscience-243	148	6	build	build	NOUN
bioscience-243	148	7	obtained	obtain	VERB
bioscience-243	148	8	the	the	DET
bioscience-243	148	9	template	template	NOUN
bioscience-243	148	10	pdb	pdb	NOUN
bioscience-243	148	11	i	i	PROPN
bioscience-243	148	12	d	d	PROPN
bioscience-243	148	13	3dye.1	3dye.1	NUM
bioscience-243	148	14	.	.	PUNCT
bioscience-243	149	1	the	the	DET
bioscience-243	149	2	results	result	NOUN
bioscience-243	149	3	of	of	ADP
bioscience-243	149	4	homology	homology	NOUN
bioscience-243	149	5	modeling	modeling	NOUN
bioscience-243	149	6	were	be	AUX
bioscience-243	149	7	obtained	obtain	VERB
bioscience-243	149	8	with	with	ADP
bioscience-243	149	9	crystallography	crystallography	NOUN
bioscience-243	149	10	results	result	NOUN
bioscience-243	149	11	of	of	ADP
bioscience-243	149	12	1.75	1.75	NUM
bioscience-243	149	13	å	å	NOUN
bioscience-243	149	14	using	use	VERB
bioscience-243	149	15	the	the	DET
bioscience-243	149	16	x	x	ADJ
bioscience-243	149	17	-	-	NOUN
bioscience-243	149	18	ray	ray	NOUN
bioscience-243	149	19	method	method	NOUN
bioscience-243	149	20	.	.	PUNCT
bioscience-243	150	1	for	for	ADP
bioscience-243	150	2	crystallography	crystallography	NOUN
bioscience-243	150	3	,	,	PUNCT
bioscience-243	150	4	a	a	DET
bioscience-243	150	5	smaller	small	ADJ
bioscience-243	150	6	value	value	NOUN
bioscience-243	150	7	indicates	indicate	VERB
bioscience-243	150	8	better	well	ADJ
bioscience-243	150	9	resolution	resolution	NOUN
bioscience-243	150	10	[	[	X
bioscience-243	150	11	26	26	NUM
bioscience-243	150	12	]	]	PUNCT
bioscience-243	150	13	.	.	PUNCT
bioscience-243	151	1	assessment	assessment	NOUN
bioscience-243	151	2	of	of	ADP
bioscience-243	151	3	homology	homology	NOUN
bioscience-243	151	4	modeling	modeling	NOUN
bioscience-243	151	5	results	result	NOUN
bioscience-243	151	6	is	be	AUX
bioscience-243	151	7	based	base	VERB
bioscience-243	151	8	on	on	ADP
bioscience-243	151	9	several	several	ADJ
bioscience-243	151	10	parameters	parameter	NOUN
bioscience-243	151	11	such	such	ADJ
bioscience-243	151	12	as	as	ADP
bioscience-243	151	13	gmqe	gmqe	NOUN
bioscience-243	151	14	value	value	NOUN
bioscience-243	151	15	,	,	PUNCT
bioscience-243	151	16	qmean	qmean	ADJ
bioscience-243	151	17	value	value	NOUN
bioscience-243	151	18	,	,	PUNCT
bioscience-243	151	19	qmeandisco	qmeandisco	ADJ
bioscience-243	151	20	value	value	NOUN
bioscience-243	151	21	,	,	PUNCT
bioscience-243	151	22	and	and	CCONJ
bioscience-243	151	23	sequence	sequence	NOUN
bioscience-243	151	24	identity	identity	NOUN
bioscience-243	151	25	[	[	X
bioscience-243	151	26	27	27	NUM
bioscience-243	151	27	]	]	PUNCT
bioscience-243	151	28	.	.	PUNCT
bioscience-243	152	1	the	the	DET
bioscience-243	152	2	gmqe	gmqe	NOUN
bioscience-243	152	3	(	(	PUNCT
bioscience-243	152	4	global	global	ADJ
bioscience-243	152	5	model	model	NOUN
bioscience-243	152	6	quality	quality	PROPN
bioscience-243	152	7	estimate	estimate	NOUN
bioscience-243	152	8	)	)	PUNCT
bioscience-243	152	9	value	value	NOUN
bioscience-243	152	10	parameter	parameter	NOUN
bioscience-243	152	11	is	be	AUX
bioscience-243	152	12	a	a	DET
bioscience-243	152	13	value	value	NOUN
bioscience-243	152	14	that	that	PRON
bioscience-243	152	15	describes	describe	VERB
bioscience-243	152	16	the	the	DET
bioscience-243	152	17	quality	quality	NOUN
bioscience-243	152	18	of	of	ADP
bioscience-243	152	19	the	the	DET
bioscience-243	152	20	alignment	alignment	NOUN
bioscience-243	152	21	between	between	ADP
bioscience-243	152	22	the	the	DET
bioscience-243	152	23	target	target	NOUN
bioscience-243	152	24	and	and	CCONJ
bioscience-243	152	25	template	template	NOUN
bioscience-243	152	26	.	.	PUNCT
bioscience-243	153	1	the	the	DET
bioscience-243	153	2	range	range	NOUN
bioscience-243	153	3	for	for	ADP
bioscience-243	153	4	the	the	DET
bioscience-243	153	5	gmqe	gmqe	NOUN
bioscience-243	153	6	value	value	NOUN
bioscience-243	153	7	means	mean	VERB
bioscience-243	153	8	that	that	SCONJ
bioscience-243	153	9	if	if	SCONJ
bioscience-243	153	10	it	it	PRON
bioscience-243	153	11	approaches	approach	VERB
bioscience-243	153	12	one	one	NUM
bioscience-243	153	13	,	,	PUNCT
bioscience-243	153	14	it	it	PRON
bioscience-243	153	15	indicates	indicate	VERB
bioscience-243	153	16	a	a	DET
bioscience-243	153	17	higher	high	ADJ
bioscience-243	153	18	level	level	NOUN
bioscience-243	153	19	of	of	ADP
bioscience-243	153	20	accuracy	accuracy	NOUN
bioscience-243	153	21	of	of	ADP
bioscience-243	153	22	the	the	DET
bioscience-243	153	23	protein	protein	NOUN
bioscience-243	153	24	model	model	NOUN
bioscience-243	153	25	[	[	X
bioscience-243	153	26	28	28	NUM
bioscience-243	153	27	]	]	PUNCT
bioscience-243	153	28	.	.	PUNCT
bioscience-243	154	1	the	the	DET
bioscience-243	154	2	value	value	NOUN
bioscience-243	154	3	of	of	ADP
bioscience-243	154	4	gmqe	gmqe	NOUN
bioscience-243	154	5	is	be	AUX
bioscience-243	154	6	expressed	express	VERB
bioscience-243	154	7	with	with	ADP
bioscience-243	154	8	a	a	DET
bioscience-243	154	9	range	range	NOUN
bioscience-243	154	10	of	of	ADP
bioscience-243	154	11	values	value	NOUN
bioscience-243	154	12	between	between	ADP
bioscience-243	154	13	0	0	NUM
bioscience-243	154	14	and	and	CCONJ
bioscience-243	154	15	1	1	NUM
bioscience-243	154	16	.	.	PUNCT
bioscience-243	155	1	the	the	DET
bioscience-243	155	2	value	value	NOUN
bioscience-243	155	3	of	of	ADP
bioscience-243	155	4	the	the	DET
bioscience-243	155	5	d7	d7	PROPN
bioscience-243	155	6	protein	protein	NOUN
bioscience-243	155	7	model	model	NOUN
bioscience-243	155	8	on	on	ADP
bioscience-243	155	9	the	the	DET
bioscience-243	155	10	gmqe	gmqe	NOUN
bioscience-243	155	11	value	value	NOUN
bioscience-243	155	12	parameter	parameter	NOUN
bioscience-243	155	13	is	be	AUX
bioscience-243	155	14	0.91	0.91	NUM
bioscience-243	155	15	,	,	PUNCT
bioscience-243	155	16	where	where	SCONJ
bioscience-243	155	17	the	the	DET
bioscience-243	155	18	results	result	NOUN
bioscience-243	155	19	indicate	indicate	VERB
bioscience-243	155	20	that	that	SCONJ
bioscience-243	155	21	the	the	DET
bioscience-243	155	22	accuracy	accuracy	NOUN
bioscience-243	155	23	of	of	ADP
bioscience-243	155	24	the	the	DET
bioscience-243	155	25	model	model	NOUN
bioscience-243	155	26	is	be	AUX
bioscience-243	155	27	good	good	ADJ
bioscience-243	155	28	.	.	PUNCT
bioscience-243	156	1	table	table	NOUN
bioscience-243	156	2	s1	s1	PROPN
bioscience-243	156	3	shows	show	VERB
bioscience-243	156	4	the	the	DET
bioscience-243	156	5	results	result	NOUN
bioscience-243	156	6	of	of	ADP
bioscience-243	156	7	the	the	DET
bioscience-243	156	8	model	model	NOUN
bioscience-243	156	9	quality	quality	NOUN
bioscience-243	156	10	assessment	assessment	NOUN
bioscience-243	156	11	on	on	ADP
bioscience-243	156	12	the	the	DET
bioscience-243	156	13	d7	d7	PROPN
bioscience-243	156	14	protein	protein	NOUN
bioscience-243	156	15	.	.	PUNCT
bioscience-243	157	1	the	the	DET
bioscience-243	157	2	qmean	qmean	ADJ
bioscience-243	157	3	value	value	NOUN
bioscience-243	157	4	is	be	AUX
bioscience-243	157	5	a	a	DET
bioscience-243	157	6	composite	composite	ADJ
bioscience-243	157	7	score	score	NOUN
bioscience-243	157	8	of	of	ADP
bioscience-243	157	9	a	a	DET
bioscience-243	157	10	combined	combine	VERB
bioscience-243	157	11	assessment	assessment	NOUN
bioscience-243	157	12	that	that	PRON
bioscience-243	157	13	can	can	AUX
bioscience-243	157	14	determine	determine	VERB
bioscience-243	157	15	an	an	DET
bioscience-243	157	16	estimate	estimate	NOUN
bioscience-243	157	17	of	of	ADP
bioscience-243	157	18	the	the	DET
bioscience-243	157	19	global	global	ADJ
bioscience-243	157	20	absolute	absolute	ADJ
bioscience-243	157	21	quality	quality	NOUN
bioscience-243	157	22	(	(	PUNCT
bioscience-243	157	23	entire	entire	ADJ
bioscience-243	157	24	structure	structure	NOUN
bioscience-243	157	25	)	)	PUNCT
bioscience-243	157	26	and	and	CCONJ
bioscience-243	157	27	local	local	ADJ
bioscience-243	157	28	(	(	PUNCT
bioscience-243	157	29	per	per	ADP
bioscience-243	157	30	amino	amino	NOUN
bioscience-243	157	31	acid	acid	NOUN
bioscience-243	157	32	residue	residue	NOUN
bioscience-243	157	33	)	)	PUNCT
bioscience-243	157	34	based	base	VERB
bioscience-243	157	35	on	on	ADP
bioscience-243	157	36	a	a	DET
bioscience-243	157	37	single	single	ADJ
bioscience-243	157	38	model	model	NOUN
bioscience-243	157	39	.	.	PUNCT
bioscience-243	158	1	the	the	DET
bioscience-243	158	2	qmean	qmean	ADJ
bioscience-243	158	3	score	score	NOUN
bioscience-243	158	4	ranges	range	VERB
bioscience-243	158	5	from	from	ADP
bioscience-243	158	6	0	0	NUM
bioscience-243	158	7	to	to	ADP
bioscience-243	158	8	1	1	NUM
bioscience-243	158	9	,	,	PUNCT
bioscience-243	158	10	where	where	SCONJ
bioscience-243	158	11	a	a	DET
bioscience-243	158	12	value	value	NOUN
bioscience-243	158	13	of	of	ADP
bioscience-243	158	14	1	1	NUM
bioscience-243	158	15	means	mean	VERB
bioscience-243	158	16	good	good	ADJ
bioscience-243	159	1	[	[	X
bioscience-243	159	2	29	29	NUM
bioscience-243	159	3	]	]	PUNCT
bioscience-243	159	4	.	.	PUNCT
bioscience-243	160	1	this	this	DET
bioscience-243	160	2	qmean	qmean	ADJ
bioscience-243	160	3	value	value	NOUN
bioscience-243	160	4	can	can	AUX
bioscience-243	160	5	be	be	AUX
bioscience-243	160	6	represented	represent	VERB
bioscience-243	160	7	by	by	ADP
bioscience-243	160	8	the	the	DET
bioscience-243	160	9	z	z	NOUN
bioscience-243	160	10	-	-	PUNCT
bioscience-243	160	11	score	score	NOUN
bioscience-243	160	12	value	value	NOUN
bioscience-243	160	13	.	.	PUNCT
bioscience-243	161	1	the	the	DET
bioscience-243	161	2	z	z	NOUN
bioscience-243	161	3	-	-	PUNCT
bioscience-243	161	4	score	score	NOUN
bioscience-243	161	5	value	value	NOUN
bioscience-243	161	6	at	at	ADP
bioscience-243	161	7	the	the	DET
bioscience-243	161	8	model	model	NOUN
bioscience-243	161	9	position	position	NOUN
bioscience-243	161	10	(	(	PUNCT
bioscience-243	161	11	marked	mark	VERB
bioscience-243	161	12	with	with	ADP
bioscience-243	161	13	a	a	DET
bioscience-243	161	14	red	red	ADJ
bioscience-243	161	15	asterisk	asterisk	NOUN
bioscience-243	161	16	)	)	PUNCT
bioscience-243	161	17	in	in	ADP
bioscience-243	161	18	the	the	DET
bioscience-243	161	19	z	z	NOUN
bioscience-243	161	20	-	-	PUNCT
bioscience-243	161	21	value	value	NOUN
bioscience-243	161	22	distribution	distribution	NOUN
bioscience-243	161	23	.	.	PUNCT
bioscience-243	162	1	this	this	DET
bioscience-243	162	2	result	result	NOUN
bioscience-243	162	3	is	be	AUX
bioscience-243	162	4	marked	mark	VERB
bioscience-243	162	5	in	in	ADP
bioscience-243	162	6	figure	figure	NOUN
bioscience-243	162	7	2	2	NUM
bioscience-243	162	8	.	.	PUNCT
bioscience-243	163	1	the	the	DET
bioscience-243	163	2	red	red	ADJ
bioscience-243	163	3	asterisk	asterisk	NOUN
bioscience-243	163	4	indicates	indicate	VERB
bioscience-243	163	5	the	the	DET
bioscience-243	163	6	model	model	NOUN
bioscience-243	163	7	’s	’s	PART
bioscience-243	163	8	z	z	NOUN
bioscience-243	163	9	-	-	PUNCT
bioscience-243	163	10	score	score	NOUN
bioscience-243	163	11	is	be	AUX
bioscience-243	163	12	within	within	ADP
bioscience-243	163	13	the	the	DET
bioscience-243	163	14	typical	typical	ADJ
bioscience-243	163	15	range	range	NOUN
bioscience-243	163	16	for	for	ADP
bioscience-243	163	17	native	native	ADJ
bioscience-243	163	18	proteins	protein	NOUN
bioscience-243	163	19	of	of	ADP
bioscience-243	163	20	similar	similar	ADJ
bioscience-243	163	21	size	size	NOUN
bioscience-243	163	22	,	,	PUNCT
bioscience-243	163	23	suggesting	suggest	VERB
bioscience-243	163	24	reasonable	reasonable	ADJ
bioscience-243	163	25	overall	overall	ADJ
bioscience-243	163	26	quality	quality	NOUN
bioscience-243	163	27	.	.	PUNCT
bioscience-243	164	1	estimates	estimate	NOUN
bioscience-243	164	2	of	of	ADP
bioscience-243	164	3	the	the	DET
bioscience-243	164	4	local	local	ADJ
bioscience-243	164	5	quality	quality	NOUN
bioscience-243	164	6	of	of	ADP
bioscience-243	164	7	the	the	DET
bioscience-243	164	8	model	model	NOUN
bioscience-243	164	9	per	per	ADP
bioscience-243	164	10	amino	amino	NOUN
bioscience-243	164	11	acid	acid	NOUN
bioscience-243	164	12	residue	residue	NOUN
bioscience-243	164	13	can	can	AUX
bioscience-243	164	14	also	also	ADV
bioscience-243	164	15	help	help	VERB
bioscience-243	164	16	in	in	ADP
bioscience-243	164	17	providing	provide	VERB
bioscience-243	164	18	an	an	DET
bioscience-243	164	19	explanation	explanation	NOUN
bioscience-243	164	20	regarding	regard	VERB
bioscience-243	164	21	the	the	DET
bioscience-243	164	22	quality	quality	NOUN
bioscience-243	164	23	of	of	ADP
bioscience-243	164	24	the	the	DET
bioscience-243	164	25	d7	d7	PROPN
bioscience-243	164	26	protein	protein	NOUN
bioscience-243	164	27	to	to	PART
bioscience-243	164	28	be	be	AUX
bioscience-243	164	29	used	use	VERB
bioscience-243	164	30	.	.	PUNCT
bioscience-243	165	1	this	this	DET
bioscience-243	165	2	z	z	NOUN
bioscience-243	165	3	-	-	PUNCT
bioscience-243	165	4	score	score	NOUN
bioscience-243	165	5	reflects	reflect	VERB
bioscience-243	165	6	the	the	DET
bioscience-243	165	7	overall	overall	ADJ
bioscience-243	165	8	model	model	NOUN
bioscience-243	165	9	quality	quality	NOUN
bioscience-243	165	10	(	(	PUNCT
bioscience-243	165	11	qmean	qmean	PROPN
bioscience-243	165	12	)	)	PUNCT
bioscience-243	165	13	.	.	PUNCT
bioscience-243	166	1	the	the	DET
bioscience-243	166	2	sequence	sequence	NOUN
bioscience-243	166	3	identity	identity	NOUN
bioscience-243	166	4	of	of	ADP
bioscience-243	166	5	the	the	DET
bioscience-243	166	6	d7	d7	PROPN
bioscience-243	166	7	protein	protein	NOUN
bioscience-243	166	8	model	model	NOUN
bioscience-243	166	9	results	result	NOUN
bioscience-243	166	10	has	have	VERB
bioscience-243	166	11	a	a	DET
bioscience-243	166	12	value	value	NOUN
bioscience-243	166	13	of	of	ADP
bioscience-243	166	14	95.70	95.70	NUM
bioscience-243	166	15	%	%	NOUN
bioscience-243	166	16	.	.	PUNCT
bioscience-243	167	1	sequence	sequence	NOUN
bioscience-243	167	2	identity	identity	NOUN
bioscience-243	167	3	is	be	AUX
bioscience-243	167	4	a	a	DET
bioscience-243	167	5	value	value	NOUN
bioscience-243	167	6	that	that	PRON
bioscience-243	167	7	can	can	AUX
bioscience-243	167	8	indicate	indicate	VERB
bioscience-243	167	9	the	the	DET
bioscience-243	167	10	percentage	percentage	NOUN
bioscience-243	167	11	of	of	ADP
bioscience-243	167	12	residues	residue	NOUN
bioscience-243	167	13	in	in	ADP
bioscience-243	167	14	the	the	DET
bioscience-243	167	15	target	target	NOUN
bioscience-243	167	16	protein	protein	NOUN
bioscience-243	167	17	sequence	sequence	NOUN
bioscience-243	167	18	that	that	PRON
bioscience-243	167	19	are	be	AUX
bioscience-243	167	20	identical	identical	ADJ
bioscience-243	167	21	to	to	ADP
bioscience-243	167	22	those	those	PRON
bioscience-243	167	23	in	in	ADP
bioscience-243	167	24	the	the	DET
bioscience-243	167	25	template	template	NOUN
bioscience-243	167	26	protein	protein	NOUN
bioscience-243	167	27	sequence	sequence	NOUN
bioscience-243	167	28	[	[	X
bioscience-243	167	29	30	30	NUM
bioscience-243	167	30	]	]	PUNCT
bioscience-243	167	31	.	.	PUNCT
bioscience-243	168	1	the	the	DET
bioscience-243	168	2	value	value	NOUN
bioscience-243	168	3	of	of	ADP
bioscience-243	168	4	the	the	DET
bioscience-243	168	5	acceptable	acceptable	ADJ
bioscience-243	168	6	sequence	sequence	NOUN
bioscience-243	168	7	identity	identity	NOUN
bioscience-243	168	8	starts	start	VERB
bioscience-243	168	9	at	at	ADP
bioscience-243	168	10	30	30	NUM
bioscience-243	168	11	%	%	NOUN
bioscience-243	168	12	,	,	PUNCT
bioscience-243	168	13	where	where	SCONJ
bioscience-243	168	14	the	the	DET
bioscience-243	168	15	higher	high	ADJ
bioscience-243	168	16	value	value	NOUN
bioscience-243	168	17	indicates	indicate	VERB
bioscience-243	168	18	the	the	DET
bioscience-243	168	19	level	level	NOUN
bioscience-243	168	20	of	of	ADP
bioscience-243	168	21	accuracy	accuracy	NOUN
bioscience-243	168	22	between	between	ADP
bioscience-243	168	23	the	the	DET
bioscience-243	168	24	target	target	NOUN
bioscience-243	168	25	protein	protein	NOUN
bioscience-243	168	26	and	and	CCONJ
bioscience-243	168	27	the	the	DET
bioscience-243	168	28	template	template	NOUN
bioscience-243	168	29	protein	protein	NOUN
bioscience-243	168	30	.	.	PUNCT
bioscience-243	169	1	the	the	DET
bioscience-243	169	2	results	result	NOUN
bioscience-243	169	3	based	base	VERB
bioscience-243	169	4	on	on	ADP
bioscience-243	169	5	the	the	DET
bioscience-243	169	6	ramachandran	ramachandran	PROPN
bioscience-243	169	7	plot	plot	NOUN
bioscience-243	169	8	in	in	ADP
bioscience-243	169	9	figure	figure	NOUN
bioscience-243	169	10	3	3	NUM
bioscience-243	169	11	,	,	PUNCT
bioscience-243	169	12	the	the	DET
bioscience-243	169	13	protein	protein	NOUN
bioscience-243	169	14	has	have	VERB
bioscience-243	169	15	good	good	ADJ
bioscience-243	169	16	structural	structural	ADJ
bioscience-243	169	17	quality	quality	NOUN
bioscience-243	169	18	if	if	SCONJ
bioscience-243	169	19	the	the	DET
bioscience-243	169	20	amino	amino	NOUN
bioscience-243	169	21	acid	acid	NOUN
bioscience-243	169	22	residues	residue	NOUN
bioscience-243	169	23	are	be	AUX
bioscience-243	169	24	mostly	mostly	ADV
bioscience-243	169	25	in	in	ADP
bioscience-243	169	26	the	the	DET
bioscience-243	169	27	favored	favor	VERB
bioscience-243	169	28	area	area	NOUN
bioscience-243	169	29	rather	rather	ADV
bioscience-243	169	30	than	than	ADP
bioscience-243	169	31	the	the	DET
bioscience-243	169	32	outliers	outlier	NOUN
bioscience-243	169	33	.	.	PUNCT
bioscience-243	170	1	lighter	light	ADJ
bioscience-243	170	2	shades	shade	NOUN
bioscience-243	170	3	or	or	CCONJ
bioscience-243	170	4	white	white	NOUN
bioscience-243	170	5	indicate	indicate	VERB
bioscience-243	170	6	residues	residue	NOUN
bioscience-243	170	7	with	with	ADP
bioscience-243	170	8	less	less	ADV
bioscience-243	170	9	favorable	favorable	ADJ
bioscience-243	170	10	conformations	conformation	NOUN
bioscience-243	170	11	.	.	PUNCT
bioscience-243	171	1	the	the	DET
bioscience-243	171	2	φ	φ	PROPN
bioscience-243	171	3	sign	sign	NOUN
bioscience-243	171	4	is	be	AUX
bioscience-243	171	5	the	the	DET
bioscience-243	171	6	phi	phi	NOUN
bioscience-243	171	7	dihedral	dihedral	ADJ
bioscience-243	171	8	angle	angle	NOUN
bioscience-243	171	9	and	and	CCONJ
bioscience-243	171	10	the	the	DET
bioscience-243	171	11	ψ	ψ	NOUN
bioscience-243	171	12	sign	sign	NOUN
bioscience-243	171	13	is	be	AUX
bioscience-243	171	14	the	the	DET
bioscience-243	171	15	psi	psi	ADJ
bioscience-243	171	16	dihedral	dihedral	ADJ
bioscience-243	171	17	angle	angle	NOUN
bioscience-243	171	18	,	,	PUNCT
bioscience-243	171	19	where	where	SCONJ
bioscience-243	171	20	both	both	PRON
bioscience-243	171	21	represent	represent	VERB
bioscience-243	171	22	the	the	DET
bioscience-243	171	23	dihedral	dihedral	ADJ
bioscience-243	171	24	angles	angle	NOUN
bioscience-243	171	25	of	of	ADP
bioscience-243	171	26	the	the	DET
bioscience-243	171	27	amino	amino	NOUN
bioscience-243	171	28	acid	acid	NOUN
bioscience-243	171	29	residue	residue	NOUN
bioscience-243	171	30	backbone	backbone	NOUN
bioscience-243	171	31	.	.	PUNCT
bioscience-243	172	1	the	the	DET
bioscience-243	172	2	ramachandran	ramachandran	PROPN
bioscience-243	172	3	plot	plot	NOUN
bioscience-243	172	4	shows	show	VERB
bioscience-243	172	5	residues	residue	NOUN
bioscience-243	172	6	primarily	primarily	ADV
bioscience-243	172	7	in	in	ADP
bioscience-243	172	8	the	the	DET
bioscience-243	172	9	allowed	allow	VERB
bioscience-243	172	10	regions	region	NOUN
bioscience-243	172	11	.	.	PUNCT
bioscience-243	173	1	the	the	DET
bioscience-243	173	2	results	result	NOUN
bioscience-243	173	3	of	of	ADP
bioscience-243	173	4	the	the	DET
bioscience-243	173	5	d7	d7	PROPN
bioscience-243	173	6	protein	protein	NOUN
bioscience-243	173	7	parameters	parameter	NOUN
bioscience-243	173	8	in	in	ADP
bioscience-243	173	9	the	the	DET
bioscience-243	173	10	ramachandran	ramachandran	PROPN
bioscience-243	173	11	plot	plot	NOUN
bioscience-243	173	12	show	show	NOUN
bioscience-243	173	13	residues	residue	NOUN
bioscience-243	173	14	distributed	distribute	VERB
bioscience-243	173	15	across	across	ADP
bioscience-243	173	16	the	the	DET
bioscience-243	173	17	favored	favor	VERB
bioscience-243	173	18	and	and	CCONJ
bioscience-243	173	19	allowed	allow	VERB
bioscience-243	173	20	regions	region	NOUN
bioscience-243	173	21	,	,	PUNCT
bioscience-243	173	22	indicating	indicate	VERB
bioscience-243	173	23	a	a	DET
bioscience-243	173	24	good	good	NOUN
bioscience-243	173	25	and	and	CCONJ
bioscience-243	173	26	figure	figure	NOUN
bioscience-243	173	27	2	2	NUM
bioscience-243	173	28	.	.	PUNCT
bioscience-243	173	29	model	model	NOUN
bioscience-243	173	30	position	position	NOUN
bioscience-243	173	31	(	(	PUNCT
bioscience-243	173	32	star	star	NOUN
bioscience-243	173	33	)	)	PUNCT
bioscience-243	173	34	on	on	ADP
bioscience-243	173	35	z	z	NOUN
bioscience-243	173	36	score	score	NOUN
bioscience-243	173	37	of	of	ADP
bioscience-243	173	38	protein	protein	NOUN
bioscience-243	173	39	d7	d7	PROPN
bioscience-243	173	40	stable	stable	ADJ
bioscience-243	173	41	structure	structure	NOUN
bioscience-243	173	42	.	.	PUNCT
bioscience-243	174	1	protein	protein	NOUN
bioscience-243	174	2	d7	d7	PROPN
bioscience-243	174	3	shown	show	VERB
bioscience-243	174	4	in	in	ADP
bioscience-243	174	5	table	table	NOUN
bioscience-243	174	6	2	2	NUM
bioscience-243	174	7	has	have	VERB
bioscience-243	174	8	a	a	DET
bioscience-243	174	9	favored	favor	VERB
bioscience-243	174	10	area	area	NOUN
bioscience-243	174	11	of	of	ADP
bioscience-243	174	12	98.66	98.66	NUM
bioscience-243	174	13	%	%	NOUN
bioscience-243	174	14	and	and	CCONJ
bioscience-243	174	15	an	an	DET
bioscience-243	174	16	outlier	outlier	ADJ
bioscience-243	174	17	area	area	NOUN
bioscience-243	174	18	of	of	ADP
bioscience-243	174	19	0.00	0.00	NUM
bioscience-243	174	20	%	%	NOUN
bioscience-243	174	21	,	,	PUNCT
bioscience-243	174	22	which	which	PRON
bioscience-243	174	23	means	mean	VERB
bioscience-243	174	24	the	the	DET
bioscience-243	174	25	structure	structure	NOUN
bioscience-243	174	26	of	of	ADP
bioscience-243	174	27	the	the	DET
bioscience-243	174	28	model	model	NOUN
bioscience-243	174	29	is	be	AUX
bioscience-243	174	30	very	very	ADV
bioscience-243	174	31	good	good	ADJ
bioscience-243	174	32	.	.	PUNCT
bioscience-243	175	1	the	the	DET
bioscience-243	175	2	plot	plot	NOUN
bioscience-243	175	3	uses	use	VERB
bioscience-243	175	4	contour	contour	NOUN
bioscience-243	175	5	lines	line	NOUN
bioscience-243	175	6	to	to	PART
bioscience-243	175	7	indicate	indicate	VERB
bioscience-243	175	8	regions	region	NOUN
bioscience-243	175	9	of	of	ADP
bioscience-243	175	10	probability	probability	NOUN
bioscience-243	175	11	density	density	NOUN
bioscience-243	175	12	;	;	PUNCT
bioscience-243	175	13	98.66	98.66	NUM
bioscience-243	175	14	%	%	NOUN
bioscience-243	175	15	of	of	ADP
bioscience-243	175	16	residues	residue	NOUN
bioscience-243	175	17	fall	fall	VERB
bioscience-243	175	18	within	within	ADP
bioscience-243	175	19	the	the	DET
bioscience-243	175	20	favored	favor	VERB
bioscience-243	175	21	regions	region	NOUN
bioscience-243	175	22	(	(	PUNCT
bioscience-243	175	23	darkest	dark	ADJ
bioscience-243	175	24	contours	contours	NOUN
bioscience-243	175	25	)	)	PUNCT
bioscience-243	175	26	,	,	PUNCT
bioscience-243	175	27	and	and	CCONJ
bioscience-243	175	28	0.00	0.00	NUM
bioscience-243	175	29	%	%	NOUN
bioscience-243	175	30	are	be	AUX
bioscience-243	175	31	in	in	ADP
bioscience-243	175	32	outlier	outlier	ADJ
bioscience-243	175	33	regions	region	NOUN
bioscience-243	175	34	table	table	NOUN
bioscience-243	175	35	2	2	NUM
bioscience-243	175	36	,	,	PUNCT
bioscience-243	175	37	indicating	indicate	VERB
bioscience-243	175	38	very	very	ADV
bioscience-243	175	39	good	good	ADJ
bioscience-243	175	40	stereochemical	stereochemical	ADJ
bioscience-243	175	41	quality	quality	NOUN
bioscience-243	175	42	.	.	PUNCT
bioscience-243	176	1	table	table	NOUN
bioscience-243	176	2	2	2	NUM
bioscience-243	176	3	.	.	PUNCT
bioscience-243	176	4	ramachandran	ramachandran	PROPN
bioscience-243	176	5	plot	plot	NOUN
bioscience-243	176	6	parameters	parameter	NOUN
bioscience-243	176	7	of	of	ADP
bioscience-243	176	8	d7	d7	PROPN
bioscience-243	176	9	protein	protein	NOUN
bioscience-243	176	10	parameter	parameter	NOUN
bioscience-243	176	11	model-1	model-1	NUM
bioscience-243	176	12	molprobity	molprobity	NOUN
bioscience-243	176	13	score	score	NOUN
bioscience-243	176	14	0.65	0.65	NUM
bioscience-243	176	15	clash	clash	VERB
bioscience-243	176	16	score	score	NOUN
bioscience-243	176	17	0.41	0.41	NUM
bioscience-243	176	18	ramachandran	ramachandran	NOUN
bioscience-243	176	19	favoured	favour	VERB
bioscience-243	176	20	98.66	98.66	NUM
bioscience-243	176	21	%	%	NOUN
bioscience-243	176	22	ramachandran	ramachandran	NOUN
bioscience-243	176	23	outliers	outlier	NOUN
bioscience-243	176	24	0.00	0.00	NUM
bioscience-243	176	25	%	%	NOUN
bioscience-243	176	26	rotamer	rotamer	NOUN
bioscience-243	176	27	outliers	outlier	NOUN
bioscience-243	176	28	0.00	0.00	NUM
bioscience-243	176	29	%	%	NOUN
bioscience-243	176	30	c	c	NOUN
bioscience-243	176	31	-	-	PUNCT
bioscience-243	176	32	beta	beta	ADJ
bioscience-243	176	33	deviations	deviation	NOUN
bioscience-243	176	34	0	0	NUM
bioscience-243	176	35	bad	bad	ADJ
bioscience-243	176	36	bonds	bond	NOUN
bioscience-243	176	37	0/2504	0/2504	VERB
bioscience-243	176	38	bad	bad	ADJ
bioscience-243	176	39	angles	angle	VERB
bioscience-243	176	40	a276	a276	PROPN
bioscience-243	176	41	asp	asp	NOUN
bioscience-243	176	42	,	,	PUNCT
bioscience-243	176	43	(	(	PUNCT
bioscience-243	176	44	a296	a296	PROPN
bioscience-243	176	45	leu	leu	PROPN
bioscience-243	176	46	-	-	PUNCT
bioscience-243	176	47	a297	a297	PROPN
bioscience-243	176	48	pro	pro	NOUN
bioscience-243	176	49	)	)	PUNCT
bioscience-243	176	50	,	,	PUNCT
bioscience-243	176	51	a163	a163	PROPN
bioscience-243	176	52	asp	asp	NOUN
bioscience-243	176	53	,	,	PUNCT
bioscience-243	176	54	a140	a140	PROPN
bioscience-243	176	55	asp	asp	NOUN
bioscience-243	176	56	,	,	PUNCT
bioscience-243	176	57	(	(	PUNCT
bioscience-243	176	58	a132	a132	PROPN
bioscience-243	176	59	aspa133	aspa133	X
bioscience-243	176	60	pro	pro	ADJ
bioscience-243	176	61	)	)	PUNCT
bioscience-243	176	62	,	,	PUNCT
bioscience-243	176	63	(	(	PUNCT
bioscience-243	176	64	a304	a304	PROPN
bioscience-243	176	65	lys	lys	PROPN
bioscience-243	176	66	-	-	PUNCT
bioscience-243	176	67	a205	a205	X
bioscience-243	176	68	pro	pro	NOUN
bioscience-243	176	69	)	)	PUNCT
bioscience-243	176	70	,	,	PUNCT
bioscience-243	176	71	a264	a264	PROPN
bioscience-243	176	72	his	his	PRON
bioscience-243	176	73	,	,	PUNCT
bioscience-243	176	74	a135	a135	PROPN
bioscience-243	176	75	his	his	PRON
bioscience-243	176	76	,	,	PUNCT
bioscience-243	176	77	a207	a207	PROPN
bioscience-243	176	78	his	his	PRON
bioscience-243	176	79	,	,	PUNCT
bioscience-243	176	80	a138	a138	PROPN
bioscience-243	176	81	his	his	PRON
bioscience-243	176	82	,	,	PUNCT
bioscience-243	176	83	a263	a263	PROPN
bioscience-243	176	84	trp	trp	PROPN
bioscience-243	176	85	the	the	DET
bioscience-243	176	86	molprobity	molprobity	NOUN
bioscience-243	176	87	score	score	NOUN
bioscience-243	176	88	of	of	ADP
bioscience-243	176	89	model-1	model-1	PROPN
bioscience-243	176	90	is	be	AUX
bioscience-243	176	91	0.65	0.65	NUM
bioscience-243	176	92	.	.	PUNCT
bioscience-243	177	1	the	the	DET
bioscience-243	177	2	molprobity	molprobity	NOUN
bioscience-243	177	3	score	score	NOUN
bioscience-243	177	4	is	be	AUX
bioscience-243	177	5	a	a	DET
bioscience-243	177	6	combination	combination	NOUN
bioscience-243	177	7	of	of	ADP
bioscience-243	177	8	the	the	DET
bioscience-243	177	9	log	log	NOUN
bioscience-243	177	10	-	-	PUNCT
bioscience-243	177	11	weighted	weight	VERB
bioscience-243	177	12	clash	clash	NOUN
bioscience-243	177	13	score	score	NOUN
bioscience-243	177	14	,	,	PUNCT
bioscience-243	177	15	the	the	DET
bioscience-243	177	16	percentage	percentage	NOUN
bioscience-243	177	17	of	of	ADP
bioscience-243	177	18	unfavorable	unfavorable	ADJ
bioscience-243	177	19	ramachandran	ramachandran	NOUN
bioscience-243	177	20	outliers	outlier	NOUN
bioscience-243	177	21	,	,	PUNCT
bioscience-243	177	22	and	and	CCONJ
bioscience-243	177	23	the	the	DET
bioscience-243	177	24	percentage	percentage	NOUN
bioscience-243	177	25	of	of	ADP
bioscience-243	177	26	bad	bad	ADJ
bioscience-243	177	27	side	side	NOUN
bioscience-243	177	28	chain	chain	NOUN
bioscience-243	177	29	rotamers	rotamer	NOUN
bioscience-243	177	30	.	.	PUNCT
bioscience-243	178	1	this	this	DET
bioscience-243	178	2	score	score	NOUN
bioscience-243	178	3	indicates	indicate	VERB
bioscience-243	178	4	a	a	DET
bioscience-243	178	5	value	value	NOUN
bioscience-243	178	6	that	that	PRON
bioscience-243	178	7	is	be	AUX
bioscience-243	178	8	expected	expect	VERB
bioscience-243	178	9	to	to	PART
bioscience-243	178	10	describe	describe	VERB
bioscience-243	178	11	the	the	DET
bioscience-243	178	12	equivalent	equivalent	ADJ
bioscience-243	178	13	resolution	resolution	NOUN
bioscience-243	178	14	of	of	ADP
bioscience-243	178	15	a	a	DET
bioscience-243	178	16	comparable	comparable	ADJ
bioscience-243	178	17	experimental	experimental	ADJ
bioscience-243	178	18	structure	structure	NOUN
bioscience-243	178	19	.	.	PUNCT
bioscience-243	179	1	a	a	DET
bioscience-243	179	2	lower	low	ADJ
bioscience-243	179	3	molprobity	molprobity	NOUN
bioscience-243	179	4	score	score	NOUN
bioscience-243	179	5	generally	generally	ADV
bioscience-243	179	6	indicates	indicate	VERB
bioscience-243	179	7	better	well	ADJ
bioscience-243	179	8	quality	quality	NOUN
bioscience-243	179	9	.	.	PUNCT
bioscience-243	180	1	if	if	SCONJ
bioscience-243	180	2	the	the	DET
bioscience-243	180	3	score	score	NOUN
bioscience-243	180	4	is	be	AUX
bioscience-243	180	5	lower	low	ADJ
bioscience-243	180	6	than	than	ADP
bioscience-243	180	7	typical	typical	ADJ
bioscience-243	180	8	for	for	ADP
bioscience-243	180	9	structures	structure	NOUN
bioscience-243	180	10	at	at	ADP
bioscience-243	180	11	the	the	DET
bioscience-243	180	12	template	template	NOUN
bioscience-243	180	13	’s	’s	PART
bioscience-243	180	14	resolution	resolution	NOUN
bioscience-243	180	15	(	(	PUNCT
bioscience-243	180	16	1.75	1.75	NUM
bioscience-243	180	17	å	å	NOUN
bioscience-243	180	18	)	)	PUNCT
bioscience-243	180	19	,	,	PUNCT
bioscience-243	180	20	then	then	ADV
bioscience-243	180	21	the	the	DET
bioscience-243	180	22	model	model	NOUN
bioscience-243	180	23	highlights	highlight	NOUN
bioscience-243	180	24	in	in	ADP
bioscience-243	180	25	bioscience	bioscience	NOUN
bioscience-243	180	26	page	page	NOUN
bioscience-243	180	27	4	4	NUM
bioscience-243	180	28	of	of	ADP
bioscience-243	180	29	9	9	NUM
bioscience-243	180	30	may	may	PROPN
bioscience-243	180	31	2025|volume	2025|volume	NUM
bioscience-243	180	32	8	8	NUM
bioscience-243	180	33	http://bioscience.highlightsin.org/	http://bioscience.highlightsin.org/	ADV
bioscience-243	180	34	oktarianti	oktarianti	INTJ
bioscience-243	180	35	r	r	NOUN
bioscience-243	180	36	et	et	NOUN
bioscience-243	180	37	al	al	PROPN
bioscience-243	180	38	.	.	PROPN
bioscience-243	180	39	,	,	PUNCT
bioscience-243	180	40	2025	2025	NUM
bioscience-243	180	41	in	in	ADP
bioscience-243	180	42	silico	silico	NOUN
bioscience-243	180	43	study	study	NOUN
bioscience-243	180	44	of	of	ADP
bioscience-243	180	45	the	the	DET
bioscience-243	180	46	interaction	interaction	NOUN
bioscience-243	180	47	between	between	ADP
bioscience-243	180	48	serotonin	serotonin	VERB
bioscience-243	180	49	and	and	CCONJ
bioscience-243	180	50	d7	d7	PROPN
bioscience-243	180	51	protein	protein	NOUN
bioscience-243	180	52	figure	figure	NOUN
bioscience-243	180	53	3	3	NUM
bioscience-243	180	54	.	.	PUNCT
bioscience-243	181	1	ramachandran	ramachandran	PROPN
bioscience-243	181	2	plot	plot	NOUN
bioscience-243	181	3	of	of	ADP
bioscience-243	181	4	aedes	aedes	PROPN
bioscience-243	181	5	aegypti	aegypti	VERB
bioscience-243	181	6	salivary	salivary	ADJ
bioscience-243	181	7	gland	gland	NOUN
bioscience-243	181	8	d7	d7	PROPN
bioscience-243	181	9	protein	protein	NOUN
bioscience-243	181	10	quality	quality	NOUN
bioscience-243	181	11	is	be	AUX
bioscience-243	181	12	considered	consider	VERB
bioscience-243	181	13	very	very	ADV
bioscience-243	181	14	good	good	ADJ
bioscience-243	181	15	.	.	PUNCT
bioscience-243	182	1	the	the	DET
bioscience-243	182	2	resolution	resolution	NOUN
bioscience-243	182	3	of	of	ADP
bioscience-243	182	4	the	the	DET
bioscience-243	182	5	template	template	NOUN
bioscience-243	182	6	crystallography	crystallography	NOUN
bioscience-243	182	7	is	be	AUX
bioscience-243	182	8	1.75	1.75	NUM
bioscience-243	182	9	å	å	X
bioscience-243	182	10	.	.	PUNCT
bioscience-243	183	1	3d	3d	NUM
bioscience-243	183	2	structure	structure	NOUN
bioscience-243	183	3	of	of	ADP
bioscience-243	183	4	native	native	ADJ
bioscience-243	183	5	ligand	ligand	PROPN
bioscience-243	183	6	l	l	PROPN
bioscience-243	183	7	-	-	NOUN
bioscience-243	183	8	norepinephrine	norepinephrine	NOUN
bioscience-243	183	9	and	and	CCONJ
bioscience-243	183	10	test	test	NOUN
bioscience-243	183	11	ligand	ligand	NOUN
bioscience-243	183	12	serotonin	serotonin	VERB
bioscience-243	183	13	the	the	DET
bioscience-243	183	14	3d	3d	NUM
bioscience-243	183	15	structure	structure	NOUN
bioscience-243	183	16	model	model	NOUN
bioscience-243	183	17	of	of	ADP
bioscience-243	183	18	d7	d7	PROPN
bioscience-243	183	19	protein	protein	NOUN
bioscience-243	183	20	with	with	ADP
bioscience-243	183	21	template	template	NOUN
bioscience-243	183	22	pdb	pdb	NOUN
bioscience-243	184	1	i	i	PROPN
bioscience-243	184	2	d	d	PROPN
bioscience-243	184	3	3dye.1	3dye.1	PROPN
bioscience-243	184	4	has	have	VERB
bioscience-243	184	5	a	a	DET
bioscience-243	184	6	native	native	ADJ
bioscience-243	184	7	ligand	ligand	NOUN
bioscience-243	184	8	in	in	ADP
bioscience-243	184	9	the	the	DET
bioscience-243	184	10	form	form	NOUN
bioscience-243	184	11	of	of	ADP
bioscience-243	184	12	l	l	NOUN
bioscience-243	184	13	-	-	NOUN
bioscience-243	184	14	norepinephrine	norepinephrine	NOUN
bioscience-243	184	15	.	.	PUNCT
bioscience-243	185	1	the	the	DET
bioscience-243	185	2	l	l	ADJ
bioscience-243	185	3	-	-	ADJ
bioscience-243	185	4	norepinephrine	norepinephrine	ADJ
bioscience-243	185	5	molecule	molecule	NOUN
bioscience-243	185	6	is	be	AUX
bioscience-243	185	7	a	a	DET
bioscience-243	185	8	type	type	NOUN
bioscience-243	185	9	of	of	ADP
bioscience-243	185	10	biogenic	biogenic	NOUN
bioscience-243	185	11	amine	amine	NOUN
bioscience-243	185	12	which	which	PRON
bioscience-243	185	13	is	be	AUX
bioscience-243	185	14	a	a	DET
bioscience-243	185	15	component	component	NOUN
bioscience-243	185	16	of	of	ADP
bioscience-243	185	17	monoamine	monoamine	ADJ
bioscience-243	185	18	neurotransmitters	neurotransmitter	NOUN
bioscience-243	185	19	[	[	X
bioscience-243	185	20	31	31	NUM
bioscience-243	185	21	]	]	PUNCT
bioscience-243	185	22	.	.	PUNCT
bioscience-243	186	1	the	the	DET
bioscience-243	186	2	lnorepinephrine	lnorepinephrine	ADJ
bioscience-243	186	3	molecule	molecule	NOUN
bioscience-243	186	4	is	be	AUX
bioscience-243	186	5	a	a	DET
bioscience-243	186	6	non	non	ADJ
bioscience-243	186	7	-	-	ADJ
bioscience-243	186	8	polymer	polymer	ADJ
bioscience-243	186	9	molecule	molecule	NOUN
bioscience-243	186	10	with	with	ADP
bioscience-243	186	11	a	a	DET
bioscience-243	186	12	molecular	molecular	ADJ
bioscience-243	186	13	weight	weight	NOUN
bioscience-243	186	14	of	of	ADP
bioscience-243	186	15	169.178	169.178	NUM
bioscience-243	186	16	g	g	NOUN
bioscience-243	186	17	/	/	SYM
bioscience-243	186	18	mol	mol	NOUN
bioscience-243	186	19	.	.	PUNCT
bioscience-243	187	1	l	l	NOUN
bioscience-243	187	2	-	-	NOUN
bioscience-243	187	3	norepinephrine	norepinephrine	NOUN
bioscience-243	187	4	has	have	VERB
bioscience-243	187	5	a	a	DET
bioscience-243	187	6	structure	structure	NOUN
bioscience-243	187	7	containing	contain	VERB
bioscience-243	187	8	an	an	DET
bioscience-243	187	9	aromatic	aromatic	ADJ
bioscience-243	187	10	ring	ring	NOUN
bioscience-243	187	11	and	and	CCONJ
bioscience-243	187	12	a	a	DET
bioscience-243	187	13	carbon	carbon	NOUN
bioscience-243	187	14	chain	chain	NOUN
bioscience-243	187	15	with	with	ADP
bioscience-243	187	16	the	the	DET
bioscience-243	187	17	chemical	chemical	NOUN
bioscience-243	187	18	formula	formula	NOUN
bioscience-243	187	19	c8h11no3	c8h11no3	PROPN
bioscience-243	187	20	.	.	PUNCT
bioscience-243	188	1	the	the	DET
bioscience-243	188	2	structure	structure	NOUN
bioscience-243	188	3	of	of	ADP
bioscience-243	188	4	l	l	NOUN
bioscience-243	188	5	-	-	NOUN
bioscience-243	188	6	norepinephrine	norepinephrine	NOUN
bioscience-243	188	7	consists	consist	VERB
bioscience-243	188	8	of	of	ADP
bioscience-243	188	9	23	23	NUM
bioscience-243	188	10	atoms	atom	NOUN
bioscience-243	188	11	,	,	PUNCT
bioscience-243	188	12	each	each	PRON
bioscience-243	188	13	of	of	ADP
bioscience-243	188	14	which	which	PRON
bioscience-243	188	15	is	be	AUX
bioscience-243	188	16	connected	connect	VERB
bioscience-243	188	17	by	by	ADP
bioscience-243	188	18	chemical	chemical	ADJ
bioscience-243	188	19	bonds	bond	NOUN
bioscience-243	188	20	and	and	CCONJ
bioscience-243	188	21	has	have	VERB
bioscience-243	188	22	one	one	NUM
bioscience-243	188	23	aromatic	aromatic	ADJ
bioscience-243	188	24	ring	ring	NOUN
bioscience-243	188	25	[	[	X
bioscience-243	188	26	32	32	NUM
bioscience-243	188	27	]	]	PUNCT
bioscience-243	188	28	.	.	PUNCT
bioscience-243	189	1	the	the	DET
bioscience-243	189	2	use	use	NOUN
bioscience-243	189	3	of	of	ADP
bioscience-243	189	4	native	native	ADJ
bioscience-243	189	5	ligands	ligand	NOUN
bioscience-243	189	6	is	be	AUX
bioscience-243	189	7	important	important	ADJ
bioscience-243	189	8	for	for	ADP
bioscience-243	189	9	the	the	DET
bioscience-243	189	10	validation	validation	NOUN
bioscience-243	189	11	stage	stage	NOUN
bioscience-243	189	12	of	of	ADP
bioscience-243	189	13	the	the	DET
bioscience-243	189	14	molecular	molecular	ADJ
bioscience-243	189	15	docking	docking	NOUN
bioscience-243	189	16	method	method	NOUN
bioscience-243	189	17	as	as	ADV
bioscience-243	189	18	well	well	ADV
bioscience-243	189	19	as	as	ADP
bioscience-243	189	20	for	for	ADP
bioscience-243	189	21	determining	determine	VERB
bioscience-243	189	22	the	the	DET
bioscience-243	189	23	orientation	orientation	NOUN
bioscience-243	189	24	of	of	ADP
bioscience-243	189	25	the	the	DET
bioscience-243	189	26	binding	bind	VERB
bioscience-243	189	27	site	site	NOUN
bioscience-243	189	28	for	for	ADP
bioscience-243	189	29	test	test	NOUN
bioscience-243	189	30	ligands	ligand	NOUN
bioscience-243	189	31	in	in	ADP
bioscience-243	189	32	the	the	DET
bioscience-243	189	33	molecular	molecular	ADJ
bioscience-243	189	34	docking	docking	NOUN
bioscience-243	189	35	process	process	NOUN
bioscience-243	189	36	[	[	X
bioscience-243	189	37	33	33	NUM
bioscience-243	189	38	]	]	PUNCT
bioscience-243	189	39	.	.	PUNCT
bioscience-243	190	1	the	the	DET
bioscience-243	190	2	test	test	NOUN
bioscience-243	190	3	ligand	ligand	NOUN
bioscience-243	190	4	used	use	VERB
bioscience-243	190	5	in	in	ADP
bioscience-243	190	6	this	this	DET
bioscience-243	190	7	study	study	NOUN
bioscience-243	190	8	was	be	AUX
bioscience-243	190	9	the	the	DET
bioscience-243	190	10	serotonin	serotonin	NOUN
bioscience-243	190	11	molecule	molecule	NOUN
bioscience-243	190	12	,	,	PUNCT
bioscience-243	190	13	which	which	PRON
bioscience-243	190	14	is	be	AUX
bioscience-243	190	15	one	one	NUM
bioscience-243	190	16	of	of	ADP
bioscience-243	190	17	the	the	DET
bioscience-243	190	18	biogenic	biogenic	ADJ
bioscience-243	190	19	amines	amine	NOUN
bioscience-243	190	20	in	in	ADP
bioscience-243	190	21	the	the	DET
bioscience-243	190	22	human	human	ADJ
bioscience-243	190	23	bloodstream	bloodstream	NOUN
bioscience-243	190	24	.	.	PUNCT
bioscience-243	191	1	serotonin	serotonin	VERB
bioscience-243	191	2	in	in	ADP
bioscience-243	191	3	the	the	DET
bioscience-243	191	4	human	human	ADJ
bioscience-243	191	5	body	body	NOUN
bioscience-243	191	6	plays	play	VERB
bioscience-243	191	7	a	a	DET
bioscience-243	191	8	role	role	NOUN
bioscience-243	191	9	in	in	ADP
bioscience-243	191	10	the	the	DET
bioscience-243	191	11	platelet	platelet	NOUN
bioscience-243	191	12	aggregation	aggregation	NOUN
bioscience-243	191	13	process	process	NOUN
bioscience-243	191	14	through	through	ADP
bioscience-243	191	15	the	the	DET
bioscience-243	191	16	activation	activation	NOUN
bioscience-243	191	17	mechanism	mechanism	NOUN
bioscience-243	191	18	between	between	ADP
bioscience-243	191	19	platelet	platelet	NOUN
bioscience-243	191	20	cells	cell	NOUN
bioscience-243	191	21	[	[	X
bioscience-243	191	22	34	34	NUM
bioscience-243	191	23	]	]	PUNCT
bioscience-243	191	24	.	.	PUNCT
bioscience-243	192	1	the	the	DET
bioscience-243	192	2	structure	structure	NOUN
bioscience-243	192	3	of	of	ADP
bioscience-243	192	4	serotonin	serotonin	NOUN
bioscience-243	192	5	can	can	AUX
bioscience-243	192	6	interact	interact	VERB
bioscience-243	192	7	with	with	ADP
bioscience-243	192	8	functional	functional	ADJ
bioscience-243	192	9	groups	group	NOUN
bioscience-243	192	10	to	to	PART
bioscience-243	192	11	form	form	VERB
bioscience-243	192	12	hydrogen	hydrogen	NOUN
bioscience-243	192	13	bonds	bond	NOUN
bioscience-243	192	14	and	and	CCONJ
bioscience-243	192	15	can	can	AUX
bioscience-243	192	16	also	also	ADV
bioscience-243	192	17	participate	participate	VERB
bioscience-243	192	18	in	in	ADP
bioscience-243	192	19	aromatic	aromatic	ADJ
bioscience-243	192	20	interactions	interaction	NOUN
bioscience-243	192	21	[	[	X
bioscience-243	192	22	35	35	NUM
bioscience-243	192	23	]	]	PUNCT
bioscience-243	192	24	.	.	PUNCT
bioscience-243	193	1	serotonin	serotonin	VERB
bioscience-243	193	2	(	(	PUNCT
bioscience-243	193	3	also	also	ADV
bioscience-243	193	4	known	know	VERB
bioscience-243	193	5	as	as	ADP
bioscience-243	193	6	enteramine	enteramine	NOUN
bioscience-243	193	7	)	)	PUNCT
bioscience-243	193	8	has	have	VERB
bioscience-243	193	9	the	the	DET
bioscience-243	193	10	chemical	chemical	NOUN
bioscience-243	193	11	formula	formula	NOUN
bioscience-243	193	12	c10h12n2o	c10h12n2o	NOUN
bioscience-243	193	13	with	with	ADP
bioscience-243	193	14	a	a	DET
bioscience-243	193	15	molecular	molecular	ADJ
bioscience-243	193	16	weight	weight	NOUN
bioscience-243	193	17	of	of	ADP
bioscience-243	193	18	176.21	176.21	NUM
bioscience-243	193	19	g	g	NOUN
bioscience-243	193	20	/	/	SYM
bioscience-243	193	21	mol	mol	NOUN
bioscience-243	193	22	.	.	PROPN
bioscience-243	193	23	serotonin	serotonin	NOUN
bioscience-243	193	24	is	be	AUX
bioscience-243	193	25	composed	compose	VERB
bioscience-243	193	26	of	of	ADP
bioscience-243	193	27	25	25	NUM
bioscience-243	193	28	atoms	atom	NOUN
bioscience-243	193	29	connected	connect	VERB
bioscience-243	193	30	by	by	ADP
bioscience-243	193	31	chemical	chemical	ADJ
bioscience-243	193	32	bonds	bond	NOUN
bioscience-243	193	33	and	and	CCONJ
bioscience-243	193	34	has	have	VERB
bioscience-243	193	35	an	an	DET
bioscience-243	193	36	indole	indole	ADJ
bioscience-243	193	37	ring	ring	NOUN
bioscience-243	193	38	system	system	NOUN
bioscience-243	193	39	[	[	X
bioscience-243	193	40	36	36	NUM
bioscience-243	193	41	]	]	PUNCT
bioscience-243	193	42	.	.	PUNCT
bioscience-243	194	1	the	the	DET
bioscience-243	194	2	differences	difference	NOUN
bioscience-243	194	3	in	in	ADP
bioscience-243	194	4	the	the	DET
bioscience-243	194	5	2d	2d	NUM
bioscience-243	194	6	and	and	CCONJ
bioscience-243	194	7	3d	3d	NUM
bioscience-243	194	8	structures	structure	NOUN
bioscience-243	194	9	of	of	ADP
bioscience-243	194	10	the	the	DET
bioscience-243	194	11	l	l	ADJ
bioscience-243	194	12	-	-	ADJ
bioscience-243	194	13	norepinephrine	norepinephrine	ADJ
bioscience-243	194	14	ligand	ligand	NOUN
bioscience-243	194	15	and	and	CCONJ
bioscience-243	194	16	the	the	DET
bioscience-243	194	17	serotonin	serotonin	NOUN
bioscience-243	194	18	test	test	NOUN
bioscience-243	194	19	ligand	ligand	NOUN
bioscience-243	194	20	can	can	AUX
bioscience-243	194	21	be	be	AUX
bioscience-243	194	22	seen	see	VERB
bioscience-243	194	23	in	in	ADP
bioscience-243	194	24	table	table	NOUN
bioscience-243	194	25	3	3	NUM
bioscience-243	194	26	.	.	X
bioscience-243	194	27	molecular	molecular	ADJ
bioscience-243	194	28	docking	docking	NOUN
bioscience-243	194	29	validation	validation	NOUN
bioscience-243	194	30	method	method	NOUN
bioscience-243	194	31	validation	validation	NOUN
bioscience-243	194	32	of	of	ADP
bioscience-243	194	33	the	the	DET
bioscience-243	194	34	molecular	molecular	ADJ
bioscience-243	194	35	docking	docking	NOUN
bioscience-243	194	36	method	method	NOUN
bioscience-243	194	37	was	be	AUX
bioscience-243	194	38	carried	carry	VERB
bioscience-243	194	39	out	out	ADP
bioscience-243	194	40	through	through	ADP
bioscience-243	194	41	the	the	DET
bioscience-243	194	42	re	re	ADJ
bioscience-243	194	43	-	-	ADJ
bioscience-243	194	44	docking	docking	ADJ
bioscience-243	194	45	technique	technique	NOUN
bioscience-243	194	46	using	use	VERB
bioscience-243	194	47	the	the	DET
bioscience-243	194	48	native	native	ADJ
bioscience-243	194	49	ligand	ligand	NOUN
bioscience-243	194	50	and	and	CCONJ
bioscience-243	194	51	d7	d7	PROPN
bioscience-243	194	52	protein	protein	NOUN
bioscience-243	194	53	as	as	ADP
bioscience-243	194	54	the	the	DET
bioscience-243	194	55	target	target	NOUN
bioscience-243	194	56	protein	protein	NOUN
bioscience-243	194	57	in	in	ADP
bioscience-243	194	58	this	this	DET
bioscience-243	194	59	study	study	NOUN
bioscience-243	194	60	.	.	PUNCT
bioscience-243	195	1	before	before	ADP
bioscience-243	195	2	validating	validate	VERB
bioscience-243	195	3	figure	figure	NOUN
bioscience-243	195	4	4	4	NUM
bioscience-243	195	5	.	.	PUNCT
bioscience-243	195	6	visualization	visualization	NOUN
bioscience-243	195	7	of	of	ADP
bioscience-243	195	8	the	the	DET
bioscience-243	195	9	overlapping	overlap	VERB
bioscience-243	195	10	conformation	conformation	NOUN
bioscience-243	195	11	between	between	ADP
bioscience-243	195	12	the	the	DET
bioscience-243	195	13	native	native	ADJ
bioscience-243	195	14	ligand	ligand	NOUN
bioscience-243	195	15	l	l	NOUN
bioscience-243	195	16	-	-	NOUN
bioscience-243	195	17	norepinephrine	norepinephrine	NOUN
bioscience-243	195	18	from	from	ADP
bioscience-243	195	19	crystallography	crystallography	NOUN
bioscience-243	195	20	(	(	PUNCT
bioscience-243	195	21	green	green	NOUN
bioscience-243	195	22	)	)	PUNCT
bioscience-243	195	23	and	and	CCONJ
bioscience-243	195	24	the	the	DET
bioscience-243	195	25	conformation	conformation	NOUN
bioscience-243	195	26	of	of	ADP
bioscience-243	195	27	the	the	DET
bioscience-243	195	28	native	native	ADJ
bioscience-243	195	29	ligand	ligand	PROPN
bioscience-243	195	30	l	l	NOUN
bioscience-243	195	31	-	-	NOUN
bioscience-243	195	32	norepinephrine	norepinephrine	NOUN
bioscience-243	195	33	from	from	ADP
bioscience-243	195	34	re	re	NOUN
bioscience-243	195	35	-	-	NOUN
bioscience-243	195	36	docking	docking	ADJ
bioscience-243	195	37	(	(	PUNCT
bioscience-243	195	38	yellow	yellow	ADJ
bioscience-243	195	39	)	)	PUNCT
bioscience-243	195	40	.	.	PUNCT
bioscience-243	196	1	the	the	DET
bioscience-243	196	2	molecular	molecular	ADJ
bioscience-243	196	3	docking	docking	NOUN
bioscience-243	196	4	method	method	NOUN
bioscience-243	196	5	,	,	PUNCT
bioscience-243	196	6	it	it	PRON
bioscience-243	196	7	is	be	AUX
bioscience-243	196	8	necessary	necessary	ADJ
bioscience-243	196	9	to	to	PART
bioscience-243	196	10	prepare	prepare	VERB
bioscience-243	196	11	and	and	CCONJ
bioscience-243	196	12	optimize	optimize	VERB
bioscience-243	196	13	the	the	DET
bioscience-243	196	14	structure	structure	NOUN
bioscience-243	196	15	of	of	ADP
bioscience-243	196	16	the	the	DET
bioscience-243	196	17	d7	d7	PROPN
bioscience-243	196	18	protein	protein	NOUN
bioscience-243	196	19	by	by	ADP
bioscience-243	196	20	separating	separate	VERB
bioscience-243	196	21	it	it	PRON
bioscience-243	196	22	from	from	ADP
bioscience-243	196	23	the	the	DET
bioscience-243	196	24	native	native	ADJ
bioscience-243	196	25	ligand	ligand	NOUN
bioscience-243	196	26	l	l	NOUN
bioscience-243	196	27	-	-	NOUN
bioscience-243	196	28	norepinephrine	norepinephrine	NOUN
bioscience-243	196	29	and	and	CCONJ
bioscience-243	196	30	removing	remove	VERB
bioscience-243	196	31	water	water	NOUN
bioscience-243	196	32	molecules	molecule	NOUN
bioscience-243	196	33	,	,	PUNCT
bioscience-243	196	34	which	which	PRON
bioscience-243	196	35	are	be	AUX
bioscience-243	196	36	non	non	ADJ
bioscience-243	196	37	-	-	ADJ
bioscience-243	196	38	standard	standard	ADJ
bioscience-243	196	39	residues	residue	NOUN
bioscience-243	196	40	.	.	PUNCT
bioscience-243	197	1	the	the	DET
bioscience-243	197	2	separation	separation	NOUN
bioscience-243	197	3	of	of	ADP
bioscience-243	197	4	the	the	DET
bioscience-243	197	5	native	native	ADJ
bioscience-243	197	6	ligand	ligand	NOUN
bioscience-243	197	7	from	from	ADP
bioscience-243	197	8	the	the	DET
bioscience-243	197	9	target	target	NOUN
bioscience-243	197	10	protein	protein	NOUN
bioscience-243	197	11	structure	structure	NOUN
bioscience-243	197	12	aims	aim	VERB
bioscience-243	197	13	to	to	PART
bioscience-243	197	14	provide	provide	VERB
bioscience-243	197	15	a	a	DET
bioscience-243	197	16	binding	bind	VERB
bioscience-243	197	17	pocket	pocket	NOUN
bioscience-243	197	18	for	for	ADP
bioscience-243	197	19	the	the	DET
bioscience-243	197	20	test	test	NOUN
bioscience-243	197	21	ligand	ligand	NOUN
bioscience-243	197	22	and	and	CCONJ
bioscience-243	197	23	the	the	DET
bioscience-243	197	24	target	target	NOUN
bioscience-243	197	25	protein	protein	NOUN
bioscience-243	197	26	.	.	PUNCT
bioscience-243	198	1	the	the	DET
bioscience-243	198	2	removal	removal	NOUN
bioscience-243	198	3	of	of	ADP
bioscience-243	198	4	water	water	NOUN
bioscience-243	198	5	molecules	molecule	NOUN
bioscience-243	198	6	from	from	ADP
bioscience-243	198	7	the	the	DET
bioscience-243	198	8	target	target	NOUN
bioscience-243	198	9	protein	protein	NOUN
bioscience-243	198	10	structure	structure	NOUN
bioscience-243	198	11	is	be	AUX
bioscience-243	198	12	carried	carry	VERB
bioscience-243	198	13	out	out	ADP
bioscience-243	198	14	so	so	SCONJ
bioscience-243	198	15	that	that	SCONJ
bioscience-243	198	16	they	they	PRON
bioscience-243	198	17	do	do	AUX
bioscience-243	198	18	not	not	PART
bioscience-243	198	19	become	become	VERB
bioscience-243	198	20	an	an	DET
bioscience-243	198	21	obstacle	obstacle	NOUN
bioscience-243	198	22	during	during	ADP
bioscience-243	198	23	the	the	DET
bioscience-243	198	24	molecular	molecular	ADJ
bioscience-243	198	25	docking	docking	NOUN
bioscience-243	198	26	process	process	NOUN
bioscience-243	198	27	.	.	PUNCT
bioscience-243	199	1	this	this	DET
bioscience-243	199	2	step	step	NOUN
bioscience-243	199	3	is	be	AUX
bioscience-243	199	4	important	important	ADJ
bioscience-243	199	5	so	so	SCONJ
bioscience-243	199	6	that	that	SCONJ
bioscience-243	199	7	in	in	ADP
bioscience-243	199	8	the	the	DET
bioscience-243	199	9	molecular	molecular	ADJ
bioscience-243	199	10	docking	docking	NOUN
bioscience-243	199	11	process	process	NOUN
bioscience-243	199	12	,	,	PUNCT
bioscience-243	199	13	only	only	ADV
bioscience-243	199	14	the	the	DET
bioscience-243	199	15	ligand	ligand	ADJ
bioscience-243	199	16	structure	structure	NOUN
bioscience-243	199	17	interacts	interact	VERB
bioscience-243	199	18	with	with	ADP
bioscience-243	199	19	the	the	DET
bioscience-243	199	20	target	target	NOUN
bioscience-243	199	21	protein	protein	NOUN
bioscience-243	199	22	[	[	X
bioscience-243	199	23	37	37	NUM
bioscience-243	199	24	]	]	PUNCT
bioscience-243	199	25	.	.	PUNCT
bioscience-243	200	1	the	the	DET
bioscience-243	200	2	results	result	NOUN
bioscience-243	200	3	of	of	ADP
bioscience-243	200	4	the	the	DET
bioscience-243	200	5	molecular	molecular	ADJ
bioscience-243	200	6	docking	docking	NOUN
bioscience-243	200	7	method	method	NOUN
bioscience-243	200	8	validation	validation	NOUN
bioscience-243	200	9	process	process	NOUN
bioscience-243	200	10	can	can	AUX
bioscience-243	200	11	be	be	AUX
bioscience-243	200	12	seen	see	VERB
bioscience-243	200	13	from	from	ADP
bioscience-243	200	14	the	the	DET
bioscience-243	200	15	rmsd	rmsd	NOUN
bioscience-243	200	16	value	value	NOUN
bioscience-243	200	17	.	.	PUNCT
bioscience-243	201	1	the	the	DET
bioscience-243	201	2	rmsd	rmsd	NOUN
bioscience-243	201	3	parameter	parameter	NOUN
bioscience-243	201	4	can	can	AUX
bioscience-243	201	5	show	show	VERB
bioscience-243	201	6	the	the	DET
bioscience-243	201	7	results	result	NOUN
bioscience-243	201	8	of	of	ADP
bioscience-243	201	9	the	the	DET
bioscience-243	201	10	conformational	conformational	ADJ
bioscience-243	201	11	alignment	alignment	NOUN
bioscience-243	201	12	between	between	ADP
bioscience-243	201	13	the	the	DET
bioscience-243	201	14	native	native	ADJ
bioscience-243	201	15	ligand	ligand	PROPN
bioscience-243	201	16	pose	pose	VERB
bioscience-243	201	17	resulting	result	VERB
bioscience-243	201	18	from	from	ADP
bioscience-243	201	19	the	the	DET
bioscience-243	201	20	re	re	ADJ
bioscience-243	201	21	-	-	ADJ
bioscience-243	201	22	docking	docking	ADJ
bioscience-243	201	23	process	process	NOUN
bioscience-243	201	24	and	and	CCONJ
bioscience-243	201	25	the	the	DET
bioscience-243	201	26	native	native	ADJ
bioscience-243	201	27	ligand	ligand	PROPN
bioscience-243	201	28	conformation	conformation	NOUN
bioscience-243	201	29	from	from	ADP
bioscience-243	201	30	x	x	ADJ
bioscience-243	201	31	-	-	NOUN
bioscience-243	201	32	ray	ray	NOUN
bioscience-243	201	33	crystallography	crystallography	NOUN
bioscience-243	201	34	[	[	X
bioscience-243	201	35	21	21	NUM
bioscience-243	201	36	]	]	PUNCT
bioscience-243	201	37	.	.	PUNCT
bioscience-243	202	1	the	the	DET
bioscience-243	202	2	rmsd	rmsd	ADJ
bioscience-243	202	3	value	value	NOUN
bioscience-243	202	4	is	be	AUX
bioscience-243	202	5	obtained	obtain	VERB
bioscience-243	202	6	by	by	ADP
bioscience-243	202	7	examining	examine	VERB
bioscience-243	202	8	the	the	DET
bioscience-243	202	9	overlap	overlap	NOUN
bioscience-243	202	10	between	between	ADP
bioscience-243	202	11	the	the	DET
bioscience-243	202	12	conformation	conformation	NOUN
bioscience-243	202	13	of	of	ADP
bioscience-243	202	14	the	the	DET
bioscience-243	202	15	native	native	ADJ
bioscience-243	202	16	ligand	ligand	NOUN
bioscience-243	202	17	resulting	result	VERB
bioscience-243	202	18	from	from	ADP
bioscience-243	202	19	re	re	NOUN
bioscience-243	202	20	-	-	NOUN
bioscience-243	202	21	docking	docking	ADJ
bioscience-243	202	22	and	and	CCONJ
bioscience-243	202	23	the	the	DET
bioscience-243	202	24	native	native	ADJ
bioscience-243	202	25	ligand	ligand	NOUN
bioscience-243	202	26	in	in	ADP
bioscience-243	202	27	its	its	PRON
bioscience-243	202	28	original	original	ADJ
bioscience-243	202	29	crystallographic	crystallographic	ADJ
bioscience-243	202	30	conformation	conformation	NOUN
bioscience-243	202	31	.	.	PUNCT
bioscience-243	203	1	a	a	DET
bioscience-243	203	2	smaller	small	ADJ
bioscience-243	203	3	rmsd	rmsd	NOUN
bioscience-243	203	4	value	value	NOUN
bioscience-243	203	5	indicates	indicate	VERB
bioscience-243	203	6	that	that	SCONJ
bioscience-243	203	7	the	the	DET
bioscience-243	203	8	predicted	predict	VERB
bioscience-243	203	9	binding	binding	NOUN
bioscience-243	203	10	pose	pose	VERB
bioscience-243	203	11	from	from	ADP
bioscience-243	203	12	re	re	NOUN
bioscience-243	203	13	-	-	NOUN
bioscience-243	203	14	docking	docking	ADJ
bioscience-243	203	15	closely	closely	ADV
bioscience-243	203	16	matches	match	VERB
bioscience-243	203	17	the	the	DET
bioscience-243	203	18	experimentally	experimentally	ADV
bioscience-243	203	19	observed	observe	VERB
bioscience-243	203	20	binding	bind	VERB
bioscience-243	203	21	pose	pose	NOUN
bioscience-243	203	22	.	.	PUNCT
bioscience-243	204	1	the	the	DET
bioscience-243	204	2	validity	validity	NOUN
bioscience-243	204	3	of	of	ADP
bioscience-243	204	4	the	the	DET
bioscience-243	204	5	rmsd	rmsd	NOUN
bioscience-243	204	6	value	value	NOUN
bioscience-243	204	7	is	be	AUX
bioscience-243	204	8	indicated	indicate	VERB
bioscience-243	204	9	by	by	ADP
bioscience-243	204	10	a	a	DET
bioscience-243	204	11	value	value	NOUN
bioscience-243	204	12	<	<	X
bioscience-243	204	13	2	2	NUM
bioscience-243	204	14	å	å	X
bioscience-243	204	15	[	[	X
bioscience-243	204	16	38	38	NUM
bioscience-243	204	17	]	]	PUNCT
bioscience-243	204	18	.	.	PUNCT
bioscience-243	205	1	the	the	DET
bioscience-243	205	2	rmsd	rmsd	ADJ
bioscience-243	205	3	value	value	NOUN
bioscience-243	205	4	of	of	ADP
bioscience-243	205	5	the	the	DET
bioscience-243	205	6	re	re	ADJ
bioscience-243	205	7	-	-	ADJ
bioscience-243	205	8	docking	docking	ADJ
bioscience-243	205	9	process	process	NOUN
bioscience-243	205	10	between	between	ADP
bioscience-243	205	11	the	the	DET
bioscience-243	205	12	l	l	ADJ
bioscience-243	205	13	-	-	ADJ
bioscience-243	205	14	norepinephrine	norepinephrine	ADJ
bioscience-243	205	15	ligand	ligand	NOUN
bioscience-243	205	16	and	and	CCONJ
bioscience-243	205	17	the	the	DET
bioscience-243	205	18	d7	d7	PROPN
bioscience-243	205	19	protein	protein	NOUN
bioscience-243	205	20	shows	show	VERB
bioscience-243	205	21	a	a	DET
bioscience-243	205	22	value	value	NOUN
bioscience-243	205	23	of	of	ADP
bioscience-243	205	24	1.088	1.088	NUM
bioscience-243	205	25	å	å	NOUN
bioscience-243	205	26	.	.	PUNCT
bioscience-243	206	1	these	these	DET
bioscience-243	206	2	results	result	NOUN
bioscience-243	206	3	indicate	indicate	VERB
bioscience-243	206	4	that	that	SCONJ
bioscience-243	206	5	the	the	DET
bioscience-243	206	6	validation	validation	NOUN
bioscience-243	206	7	of	of	ADP
bioscience-243	206	8	the	the	DET
bioscience-243	206	9	molecular	molecular	ADJ
bioscience-243	206	10	docking	docking	NOUN
bioscience-243	206	11	method	method	NOUN
bioscience-243	206	12	is	be	AUX
bioscience-243	206	13	accepted	accept	VERB
bioscience-243	206	14	and	and	CCONJ
bioscience-243	206	15	the	the	DET
bioscience-243	206	16	method	method	NOUN
bioscience-243	206	17	can	can	AUX
bioscience-243	206	18	be	be	AUX
bioscience-243	206	19	used	use	VERB
bioscience-243	206	20	for	for	ADP
bioscience-243	206	21	the	the	DET
bioscience-243	206	22	molecular	molecular	ADJ
bioscience-243	206	23	docking	docking	NOUN
bioscience-243	206	24	process	process	NOUN
bioscience-243	206	25	between	between	ADP
bioscience-243	206	26	the	the	DET
bioscience-243	206	27	d7	d7	PROPN
bioscience-243	206	28	protein	protein	NOUN
bioscience-243	206	29	and	and	CCONJ
bioscience-243	206	30	the	the	DET
bioscience-243	206	31	serotonin	serotonin	NOUN
bioscience-243	206	32	ligand	ligand	NOUN
bioscience-243	206	33	.	.	PUNCT
bioscience-243	207	1	the	the	DET
bioscience-243	207	2	results	result	NOUN
bioscience-243	207	3	of	of	ADP
bioscience-243	207	4	the	the	DET
bioscience-243	207	5	alignment	alignment	NOUN
bioscience-243	207	6	or	or	CCONJ
bioscience-243	207	7	overlapping	overlap	VERB
bioscience-243	207	8	conformation	conformation	NOUN
bioscience-243	207	9	between	between	ADP
bioscience-243	207	10	the	the	DET
bioscience-243	207	11	crystallographic	crystallographic	ADJ
bioscience-243	207	12	pose	pose	NOUN
bioscience-243	207	13	(	(	PUNCT
bioscience-243	207	14	green	green	NOUN
bioscience-243	207	15	)	)	PUNCT
bioscience-243	207	16	and	and	CCONJ
bioscience-243	207	17	the	the	DET
bioscience-243	207	18	re	re	ADJ
bioscience-243	207	19	-	-	ADJ
bioscience-243	207	20	docked	docked	ADJ
bioscience-243	207	21	pose	pose	NOUN
bioscience-243	207	22	(	(	PUNCT
bioscience-243	207	23	yellow	yellow	NOUN
bioscience-243	207	24	)	)	PUNCT
bioscience-243	207	25	of	of	ADP
bioscience-243	207	26	the	the	DET
bioscience-243	207	27	native	native	ADJ
bioscience-243	207	28	l	l	PROPN
bioscience-243	207	29	-	-	ADJ
bioscience-243	207	30	norepinephrine	norepinephrine	ADJ
bioscience-243	207	31	ligand	ligand	NOUN
bioscience-243	207	32	can	can	AUX
bioscience-243	207	33	be	be	AUX
bioscience-243	207	34	seen	see	VERB
bioscience-243	207	35	in	in	ADP
bioscience-243	207	36	figure	figure	NOUN
bioscience-243	207	37	4	4	NUM
bioscience-243	207	38	.	.	X
bioscience-243	207	39	molecular	molecular	ADJ
bioscience-243	207	40	docking	docking	NOUN
bioscience-243	207	41	of	of	ADP
bioscience-243	207	42	protein	protein	NOUN
bioscience-243	207	43	d7	d7	PROPN
bioscience-243	207	44	from	from	ADP
bioscience-243	207	45	ae	ae	PROPN
bioscience-243	207	46	.	.	PUNCT
bioscience-243	208	1	aegypti	aegypti	VERB
bioscience-243	208	2	and	and	CCONJ
bioscience-243	208	3	serotonin	serotonin	VERB
bioscience-243	208	4	test	test	NOUN
bioscience-243	208	5	ligand	ligand	NOUN
bioscience-243	208	6	the	the	DET
bioscience-243	208	7	molecular	molecular	ADJ
bioscience-243	208	8	docking	docking	NOUN
bioscience-243	208	9	process	process	NOUN
bioscience-243	208	10	is	be	AUX
bioscience-243	208	11	carried	carry	VERB
bioscience-243	208	12	out	out	ADP
bioscience-243	208	13	using	use	VERB
bioscience-243	208	14	serotonin	serotonin	NOUN
bioscience-243	208	15	ligands	ligand	NOUN
bioscience-243	208	16	that	that	PRON
bioscience-243	208	17	have	have	AUX
bioscience-243	208	18	been	be	AUX
bioscience-243	208	19	prepared	prepare	VERB
bioscience-243	208	20	and	and	CCONJ
bioscience-243	208	21	optimized	optimize	VERB
bioscience-243	208	22	against	against	ADP
bioscience-243	208	23	the	the	DET
bioscience-243	208	24	d7	d7	PROPN
bioscience-243	208	25	highlights	highlight	NOUN
bioscience-243	208	26	in	in	ADP
bioscience-243	208	27	bioscience	bioscience	NOUN
bioscience-243	208	28	page	page	NOUN
bioscience-243	208	29	5	5	NUM
bioscience-243	208	30	of	of	ADP
bioscience-243	208	31	9	9	NUM
bioscience-243	208	32	may	may	PROPN
bioscience-243	208	33	2025|volume	2025|volume	NUM
bioscience-243	208	34	8	8	NUM
bioscience-243	208	35	http://bioscience.highlightsin.org/	http://bioscience.highlightsin.org/	ADV
bioscience-243	209	1	oktarianti	oktarianti	INTJ
bioscience-243	210	1	r	r	NOUN
bioscience-243	210	2	et	et	NOUN
bioscience-243	210	3	al	al	PROPN
bioscience-243	210	4	.	.	PROPN
bioscience-243	210	5	,	,	PUNCT
bioscience-243	210	6	2025	2025	NUM
bioscience-243	210	7	in	in	ADP
bioscience-243	210	8	silico	silico	NOUN
bioscience-243	210	9	study	study	NOUN
bioscience-243	210	10	of	of	ADP
bioscience-243	210	11	the	the	DET
bioscience-243	210	12	interaction	interaction	NOUN
bioscience-243	210	13	between	between	ADP
bioscience-243	210	14	serotonin	serotonin	VERB
bioscience-243	210	15	and	and	CCONJ
bioscience-243	210	16	d7	d7	PROPN
bioscience-243	210	17	protein	protein	NOUN
bioscience-243	210	18	table	table	NOUN
bioscience-243	210	19	3	3	NUM
bioscience-243	210	20	.	.	PUNCT
bioscience-243	210	21	differences	difference	NOUN
bioscience-243	210	22	in	in	ADP
bioscience-243	210	23	2d	2d	NUM
bioscience-243	210	24	and	and	CCONJ
bioscience-243	210	25	3d	3d	NUM
bioscience-243	210	26	structure	structure	NOUN
bioscience-243	210	27	of	of	ADP
bioscience-243	210	28	native	native	ADJ
bioscience-243	210	29	ligands	ligand	NOUN
bioscience-243	210	30	and	and	CCONJ
bioscience-243	210	31	test	test	NOUN
bioscience-243	210	32	ligands	ligand	NOUN
bioscience-243	210	33	ligand	ligand	VERB
bioscience-243	210	34	2d	2d	NOUN
bioscience-243	210	35	3d	3d	NOUN
bioscience-243	211	1	[	[	X
bioscience-243	211	2	l]native	l]native	PROPN
bioscience-243	211	3	ligand	ligand	NOUN
bioscience-243	211	4	(	(	PUNCT
bioscience-243	211	5	l	l	NOUN
bioscience-243	211	6	-	-	NOUN
bioscience-243	211	7	norepinephrine	norepinephrine	NOUN
bioscience-243	211	8	)	)	PUNCT
bioscience-243	212	1	[	[	X
bioscience-243	212	2	l]test	l]t	ADJ
bioscience-243	212	3	ligand	ligand	NOUN
bioscience-243	212	4	(	(	PUNCT
bioscience-243	212	5	serotonin	serotonin	NOUN
bioscience-243	212	6	)	)	PUNCT
bioscience-243	212	7	protein	protein	NOUN
bioscience-243	212	8	from	from	ADP
bioscience-243	212	9	ae	ae	PROPN
bioscience-243	212	10	.	.	PUNCT
bioscience-243	213	1	aegypti	aegypti	PROPN
bioscience-243	213	2	.	.	PUNCT
bioscience-243	214	1	the	the	DET
bioscience-243	214	2	grid	grid	PROPN
bioscience-243	214	3	box	box	PROPN
bioscience-243	214	4	coordinates	coordinate	NOUN
bioscience-243	214	5	obtained	obtain	VERB
bioscience-243	214	6	from	from	ADP
bioscience-243	214	7	the	the	DET
bioscience-243	214	8	re	re	ADJ
bioscience-243	214	9	-	-	ADJ
bioscience-243	214	10	docking	docking	ADJ
bioscience-243	214	11	stage	stage	NOUN
bioscience-243	214	12	with	with	ADP
bioscience-243	214	13	the	the	DET
bioscience-243	214	14	native	native	ADJ
bioscience-243	214	15	ligand	ligand	NOUN
bioscience-243	214	16	are	be	AUX
bioscience-243	214	17	then	then	ADV
bioscience-243	214	18	used	use	VERB
bioscience-243	214	19	as	as	ADP
bioscience-243	214	20	the	the	DET
bioscience-243	214	21	basis	basis	NOUN
bioscience-243	214	22	for	for	ADP
bioscience-243	214	23	the	the	DET
bioscience-243	214	24	grid	grid	NOUN
bioscience-243	214	25	box	box	NOUN
bioscience-243	214	26	for	for	ADP
bioscience-243	214	27	the	the	DET
bioscience-243	214	28	molecular	molecular	ADJ
bioscience-243	214	29	docking	docking	NOUN
bioscience-243	214	30	process	process	NOUN
bioscience-243	214	31	between	between	ADP
bioscience-243	214	32	the	the	DET
bioscience-243	214	33	d7	d7	PROPN
bioscience-243	214	34	protein	protein	NOUN
bioscience-243	214	35	and	and	CCONJ
bioscience-243	214	36	the	the	DET
bioscience-243	214	37	serotonin	serotonin	NOUN
bioscience-243	214	38	ligand	ligand	NOUN
bioscience-243	214	39	.	.	PUNCT
bioscience-243	215	1	this	this	PRON
bioscience-243	215	2	is	be	AUX
bioscience-243	215	3	done	do	VERB
bioscience-243	215	4	so	so	SCONJ
bioscience-243	215	5	that	that	SCONJ
bioscience-243	215	6	the	the	DET
bioscience-243	215	7	test	test	NOUN
bioscience-243	215	8	ligand	ligand	NOUN
bioscience-243	215	9	can	can	AUX
bioscience-243	215	10	bind	bind	VERB
bioscience-243	215	11	to	to	ADP
bioscience-243	215	12	the	the	DET
bioscience-243	215	13	active	active	ADJ
bioscience-243	215	14	site	site	NOUN
bioscience-243	215	15	of	of	ADP
bioscience-243	215	16	the	the	DET
bioscience-243	215	17	target	target	NOUN
bioscience-243	215	18	protein	protein	NOUN
bioscience-243	215	19	[	[	X
bioscience-243	215	20	39	39	NUM
bioscience-243	215	21	]	]	PUNCT
bioscience-243	215	22	.	.	PUNCT
bioscience-243	216	1	in	in	ADP
bioscience-243	216	2	the	the	DET
bioscience-243	216	3	molecular	molecular	ADJ
bioscience-243	216	4	docking	docking	NOUN
bioscience-243	216	5	process	process	NOUN
bioscience-243	216	6	,	,	PUNCT
bioscience-243	216	7	the	the	DET
bioscience-243	216	8	structure	structure	NOUN
bioscience-243	216	9	of	of	ADP
bioscience-243	216	10	the	the	DET
bioscience-243	216	11	d7	d7	PROPN
bioscience-243	216	12	protein	protein	NOUN
bioscience-243	216	13	is	be	AUX
bioscience-243	216	14	kept	keep	VERB
bioscience-243	216	15	rigid	rigid	ADJ
bioscience-243	216	16	during	during	ADP
bioscience-243	216	17	the	the	DET
bioscience-243	216	18	docking	docking	NOUN
bioscience-243	216	19	process	process	NOUN
bioscience-243	216	20	.	.	PUNCT
bioscience-243	217	1	the	the	DET
bioscience-243	217	2	structure	structure	NOUN
bioscience-243	217	3	of	of	ADP
bioscience-243	217	4	the	the	DET
bioscience-243	217	5	serotonin	serotonin	NOUN
bioscience-243	217	6	ligand	ligand	NOUN
bioscience-243	217	7	is	be	AUX
bioscience-243	217	8	treated	treat	VERB
bioscience-243	217	9	as	as	ADP
bioscience-243	217	10	flexible	flexible	ADJ
bioscience-243	217	11	.	.	PUNCT
bioscience-243	218	1	this	this	PRON
bioscience-243	218	2	is	be	AUX
bioscience-243	218	3	done	do	VERB
bioscience-243	218	4	so	so	SCONJ
bioscience-243	218	5	that	that	SCONJ
bioscience-243	218	6	the	the	DET
bioscience-243	218	7	test	test	NOUN
bioscience-243	218	8	ligand	ligand	NOUN
bioscience-243	218	9	can	can	AUX
bioscience-243	218	10	interact	interact	VERB
bioscience-243	218	11	and	and	CCONJ
bioscience-243	218	12	bind	bind	VERB
bioscience-243	218	13	in	in	ADP
bioscience-243	218	14	the	the	DET
bioscience-243	218	15	most	most	ADV
bioscience-243	218	16	stable	stable	ADJ
bioscience-243	218	17	conformation	conformation	NOUN
bioscience-243	218	18	within	within	ADP
bioscience-243	218	19	the	the	DET
bioscience-243	218	20	active	active	ADJ
bioscience-243	218	21	site	site	NOUN
bioscience-243	218	22	of	of	ADP
bioscience-243	218	23	the	the	DET
bioscience-243	218	24	amino	amino	NOUN
bioscience-243	218	25	acid	acid	NOUN
bioscience-243	218	26	residues	residue	NOUN
bioscience-243	218	27	of	of	ADP
bioscience-243	218	28	the	the	DET
bioscience-243	218	29	target	target	NOUN
bioscience-243	218	30	protein	protein	NOUN
bioscience-243	218	31	[	[	X
bioscience-243	218	32	40	40	NUM
bioscience-243	218	33	]	]	PUNCT
bioscience-243	218	34	.	.	PUNCT
bioscience-243	219	1	analysis	analysis	NOUN
bioscience-243	219	2	and	and	CCONJ
bioscience-243	219	3	visualization	visualization	NOUN
bioscience-243	219	4	of	of	ADP
bioscience-243	219	5	molecular	molecular	ADJ
bioscience-243	219	6	docking	docking	NOUN
bioscience-243	219	7	results	result	NOUN
bioscience-243	219	8	of	of	ADP
bioscience-243	219	9	ae	ae	PROPN
bioscience-243	219	10	.	.	PUNCT
bioscience-243	219	11	aegypti	aegypti	VERB
bioscience-243	219	12	d7	d7	PROPN
bioscience-243	219	13	protein	protein	NOUN
bioscience-243	219	14	with	with	ADP
bioscience-243	219	15	serotonin	serotonin	NOUN
bioscience-243	219	16	ligand	ligand	NOUN
bioscience-243	219	17	a	a	DET
bioscience-243	219	18	∆g	∆g	PROPN
bioscience-243	219	19	value	value	NOUN
bioscience-243	219	20	>	>	X
bioscience-243	219	21	0	0	PUNCT
bioscience-243	219	22	indicates	indicate	VERB
bioscience-243	219	23	that	that	SCONJ
bioscience-243	219	24	the	the	DET
bioscience-243	219	25	binding	bind	VERB
bioscience-243	219	26	reaction	reaction	NOUN
bioscience-243	219	27	between	between	ADP
bioscience-243	219	28	the	the	DET
bioscience-243	219	29	target	target	NOUN
bioscience-243	219	30	protein	protein	NOUN
bioscience-243	219	31	and	and	CCONJ
bioscience-243	219	32	the	the	DET
bioscience-243	219	33	test	test	NOUN
bioscience-243	219	34	ligand	ligand	NOUN
bioscience-243	219	35	can	can	AUX
bioscience-243	219	36	not	not	PART
bioscience-243	219	37	occur	occur	VERB
bioscience-243	219	38	spontaneously	spontaneously	ADV
bioscience-243	219	39	.	.	PUNCT
bioscience-243	220	1	conversely	conversely	ADV
bioscience-243	220	2	,	,	PUNCT
bioscience-243	220	3	if	if	SCONJ
bioscience-243	220	4	the	the	DET
bioscience-243	220	5	∆g	∆g	PROPN
bioscience-243	220	6	value	value	NOUN
bioscience-243	220	7	<	<	X
bioscience-243	220	8	0	0	NUM
bioscience-243	220	9	,	,	PUNCT
bioscience-243	220	10	it	it	PRON
bioscience-243	220	11	indicates	indicate	VERB
bioscience-243	220	12	that	that	SCONJ
bioscience-243	220	13	the	the	DET
bioscience-243	220	14	binding	bind	VERB
bioscience-243	220	15	reaction	reaction	NOUN
bioscience-243	220	16	between	between	ADP
bioscience-243	220	17	the	the	DET
bioscience-243	220	18	target	target	NOUN
bioscience-243	220	19	protein	protein	NOUN
bioscience-243	220	20	and	and	CCONJ
bioscience-243	220	21	the	the	DET
bioscience-243	220	22	test	test	NOUN
bioscience-243	220	23	ligand	ligand	NOUN
bioscience-243	220	24	occurs	occur	VERB
bioscience-243	220	25	spontaneously	spontaneously	ADV
bioscience-243	220	26	(	(	PUNCT
bioscience-243	220	27	a	a	DET
bioscience-243	220	28	reaction	reaction	NOUN
bioscience-243	220	29	that	that	PRON
bioscience-243	220	30	favors	favor	VERB
bioscience-243	220	31	product	product	NOUN
bioscience-243	220	32	formation	formation	NOUN
bioscience-243	220	33	)	)	PUNCT
bioscience-243	220	34	.	.	PUNCT
bioscience-243	221	1	a	a	DET
bioscience-243	221	2	∆g	∆g	PROPN
bioscience-243	221	3	value	value	NOUN
bioscience-243	221	4	=	=	SYM
bioscience-243	221	5	0	0	NUM
bioscience-243	221	6	indicates	indicate	VERB
bioscience-243	221	7	that	that	SCONJ
bioscience-243	221	8	the	the	DET
bioscience-243	221	9	reaction	reaction	NOUN
bioscience-243	221	10	is	be	AUX
bioscience-243	221	11	at	at	ADP
bioscience-243	221	12	equilibrium	equilibrium	NOUN
bioscience-243	221	13	.	.	PUNCT
bioscience-243	222	1	the	the	DET
bioscience-243	222	2	more	more	ADV
bioscience-243	222	3	negative	negative	ADJ
bioscience-243	222	4	the	the	DET
bioscience-243	222	5	∆g	∆g	PROPN
bioscience-243	222	6	value	value	NOUN
bioscience-243	222	7	,	,	PUNCT
bioscience-243	222	8	the	the	PRON
bioscience-243	222	9	stronger	strong	ADJ
bioscience-243	222	10	the	the	DET
bioscience-243	222	11	binding	bind	VERB
bioscience-243	222	12	affinity	affinity	NOUN
bioscience-243	222	13	between	between	ADP
bioscience-243	222	14	the	the	DET
bioscience-243	222	15	target	target	NOUN
bioscience-243	222	16	protein	protein	NOUN
bioscience-243	222	17	and	and	CCONJ
bioscience-243	222	18	the	the	DET
bioscience-243	222	19	ligand	ligand	NOUN
bioscience-243	222	20	[	[	X
bioscience-243	222	21	41	41	NUM
bioscience-243	222	22	]	]	PUNCT
bioscience-243	222	23	.	.	PUNCT
bioscience-243	223	1	in	in	ADP
bioscience-243	223	2	addition	addition	NOUN
bioscience-243	223	3	,	,	PUNCT
bioscience-243	223	4	the	the	DET
bioscience-243	223	5	negative	negative	ADJ
bioscience-243	223	6	value	value	NOUN
bioscience-243	223	7	of	of	ADP
bioscience-243	223	8	∆g	∆g	PROPN
bioscience-243	223	9	indicates	indicate	VERB
bioscience-243	223	10	that	that	SCONJ
bioscience-243	223	11	the	the	DET
bioscience-243	223	12	interaction	interaction	NOUN
bioscience-243	223	13	between	between	ADP
bioscience-243	223	14	the	the	DET
bioscience-243	223	15	target	target	NOUN
bioscience-243	223	16	protein	protein	NOUN
bioscience-243	223	17	and	and	CCONJ
bioscience-243	223	18	the	the	DET
bioscience-243	223	19	ligand	ligand	ADJ
bioscience-243	223	20	binding	bind	VERB
bioscience-243	223	21	process	process	NOUN
bioscience-243	223	22	is	be	AUX
bioscience-243	223	23	thermodynamically	thermodynamically	ADV
bioscience-243	223	24	favorable	favorable	ADJ
bioscience-243	223	25	.	.	PUNCT
bioscience-243	224	1	this	this	PRON
bioscience-243	224	2	means	mean	VERB
bioscience-243	224	3	that	that	SCONJ
bioscience-243	224	4	the	the	DET
bioscience-243	224	5	binding	binding	NOUN
bioscience-243	224	6	between	between	ADP
bioscience-243	224	7	the	the	DET
bioscience-243	224	8	ligand	ligand	NOUN
bioscience-243	224	9	and	and	CCONJ
bioscience-243	224	10	the	the	DET
bioscience-243	224	11	active	active	ADJ
bioscience-243	224	12	site	site	NOUN
bioscience-243	224	13	of	of	ADP
bioscience-243	224	14	a	a	DET
bioscience-243	224	15	target	target	NOUN
bioscience-243	224	16	protein	protein	NOUN
bioscience-243	224	17	occurs	occur	VERB
bioscience-243	224	18	in	in	ADP
bioscience-243	224	19	a	a	DET
bioscience-243	224	20	stable	stable	ADJ
bioscience-243	224	21	condition	condition	NOUN
bioscience-243	224	22	and	and	CCONJ
bioscience-243	224	23	spontaneously	spontaneously	ADV
bioscience-243	224	24	[	[	X
bioscience-243	224	25	42	42	NUM
bioscience-243	224	26	]	]	PUNCT
bioscience-243	224	27	.	.	PUNCT
bioscience-243	225	1	the	the	DET
bioscience-243	225	2	results	result	NOUN
bioscience-243	225	3	of	of	ADP
bioscience-243	225	4	molecular	molecular	ADJ
bioscience-243	225	5	docking	docking	NOUN
bioscience-243	225	6	between	between	ADP
bioscience-243	225	7	protein	protein	NOUN
bioscience-243	225	8	d7	d7	PROPN
bioscience-243	225	9	and	and	CCONJ
bioscience-243	225	10	serotonin	serotonin	VERB
bioscience-243	225	11	ligand	ligand	NOUN
bioscience-243	225	12	show	show	VERB
bioscience-243	225	13	a	a	DET
bioscience-243	225	14	∆g	∆g	PROPN
bioscience-243	225	15	value	value	NOUN
bioscience-243	225	16	of	of	ADP
bioscience-243	225	17	-9.25	-9.25	ADJ
bioscience-243	225	18	kcal	kcal	PROPN
bioscience-243	225	19	/	/	SYM
bioscience-243	225	20	mol	mol	PROPN
bioscience-243	225	21	.	.	PUNCT
bioscience-243	226	1	these	these	DET
bioscience-243	226	2	results	result	NOUN
bioscience-243	226	3	indicate	indicate	VERB
bioscience-243	226	4	that	that	SCONJ
bioscience-243	226	5	protein	protein	NOUN
bioscience-243	226	6	d7	d7	PROPN
bioscience-243	226	7	can	can	AUX
bioscience-243	226	8	bind	bind	VERB
bioscience-243	226	9	to	to	PART
bioscience-243	226	10	serotonin	serotonin	VERB
bioscience-243	226	11	ligands	ligand	NOUN
bioscience-243	226	12	in	in	ADP
bioscience-243	226	13	a	a	DET
bioscience-243	226	14	stable	stable	ADJ
bioscience-243	226	15	and	and	CCONJ
bioscience-243	226	16	spontaneous	spontaneous	ADJ
bioscience-243	226	17	manner	manner	NOUN
bioscience-243	226	18	.	.	PUNCT
bioscience-243	227	1	this	this	PRON
bioscience-243	227	2	can	can	AUX
bioscience-243	227	3	be	be	AUX
bioscience-243	227	4	correlated	correlate	VERB
bioscience-243	227	5	with	with	ADP
bioscience-243	227	6	the	the	DET
bioscience-243	227	7	mechanism	mechanism	NOUN
bioscience-243	227	8	during	during	ADP
bioscience-243	227	9	the	the	DET
bioscience-243	227	10	blood	blood	NOUN
bioscience-243	227	11	feeding	feeding	NOUN
bioscience-243	227	12	process	process	NOUN
bioscience-243	227	13	,	,	PUNCT
bioscience-243	227	14	where	where	SCONJ
bioscience-243	227	15	protein	protein	NOUN
bioscience-243	227	16	d7	d7	PROPN
bioscience-243	227	17	from	from	ADP
bioscience-243	227	18	the	the	DET
bioscience-243	227	19	salivary	salivary	ADJ
bioscience-243	227	20	glands	gland	NOUN
bioscience-243	227	21	of	of	ADP
bioscience-243	227	22	ae	ae	PROPN
bioscience-243	227	23	.	.	PUNCT
bioscience-243	228	1	aegypti	aegypti	PROPN
bioscience-243	228	2	can	can	AUX
bioscience-243	228	3	inhibit	inhibit	VERB
bioscience-243	228	4	platelet	platelet	NOUN
bioscience-243	228	5	aggregation	aggregation	NOUN
bioscience-243	228	6	by	by	ADP
bioscience-243	228	7	binding	bind	VERB
bioscience-243	228	8	biogenic	biogenic	ADJ
bioscience-243	228	9	amines	amine	NOUN
bioscience-243	228	10	,	,	PUNCT
bioscience-243	228	11	including	include	VERB
bioscience-243	228	12	serotonin	serotonin	NOUN
bioscience-243	228	13	,	,	PUNCT
bioscience-243	228	14	thereby	thereby	ADV
bioscience-243	228	15	inhibiting	inhibit	VERB
bioscience-243	228	16	serotonin	serotonin	NOUN
bioscience-243	228	17	’s	’s	PART
bioscience-243	228	18	role	role	NOUN
bioscience-243	228	19	in	in	ADP
bioscience-243	228	20	platelet	platelet	NOUN
bioscience-243	228	21	aggregation	aggregation	NOUN
bioscience-243	228	22	and	and	CCONJ
bioscience-243	228	23	disrupting	disrupt	VERB
bioscience-243	228	24	the	the	DET
bioscience-243	228	25	host	host	NOUN
bioscience-243	228	26	’s	’s	PART
bioscience-243	228	27	homeostasis	homeostasis	NOUN
bioscience-243	228	28	reaction	reaction	NOUN
bioscience-243	228	29	[	[	X
bioscience-243	228	30	5	5	NUM
bioscience-243	228	31	]	]	PUNCT
bioscience-243	228	32	.	.	PUNCT
bioscience-243	229	1	the	the	DET
bioscience-243	229	2	d7	d7	PROPN
bioscience-243	229	3	protein	protein	NOUN
bioscience-243	229	4	from	from	ADP
bioscience-243	229	5	ae	ae	PROPN
bioscience-243	229	6	.	.	PUNCT
bioscience-243	230	1	aegypti	aegypti	PROPN
bioscience-243	230	2	has	have	AUX
bioscience-243	230	3	been	be	AUX
bioscience-243	230	4	studied	study	VERB
bioscience-243	230	5	for	for	ADP
bioscience-243	230	6	its	its	PRON
bioscience-243	230	7	potential	potential	ADJ
bioscience-243	230	8	role	role	NOUN
bioscience-243	230	9	in	in	ADP
bioscience-243	230	10	modulating	modulate	VERB
bioscience-243	230	11	host	host	NOUN
bioscience-243	230	12	hemostasis	hemostasis	NOUN
bioscience-243	230	13	,	,	PUNCT
bioscience-243	230	14	primarily	primarily	ADV
bioscience-243	230	15	through	through	ADP
bioscience-243	230	16	its	its	PRON
bioscience-243	230	17	ability	ability	NOUN
bioscience-243	230	18	to	to	PART
bioscience-243	230	19	bind	bind	VERB
bioscience-243	230	20	biogenic	biogenic	ADJ
bioscience-243	230	21	amines	amine	NOUN
bioscience-243	230	22	and	and	CCONJ
bioscience-243	230	23	eicosanoids	eicosanoid	NOUN
bioscience-243	230	24	,	,	PUNCT
bioscience-243	230	25	thereby	thereby	ADV
bioscience-243	230	26	facilitating	facilitate	VERB
bioscience-243	230	27	blood	blood	NOUN
bioscience-243	230	28	feeding	feeding	NOUN
bioscience-243	230	29	.	.	PUNCT
bioscience-243	231	1	however	however	ADV
bioscience-243	231	2	,	,	PUNCT
bioscience-243	231	3	direct	direct	ADJ
bioscience-243	231	4	experimental	experimental	ADJ
bioscience-243	231	5	evidence	evidence	NOUN
bioscience-243	231	6	demonstrating	demonstrate	VERB
bioscience-243	231	7	its	its	PRON
bioscience-243	231	8	specific	specific	ADJ
bioscience-243	231	9	function	function	NOUN
bioscience-243	231	10	as	as	ADP
bioscience-243	231	11	an	an	DET
bioscience-243	231	12	inhibitor	inhibitor	NOUN
bioscience-243	231	13	of	of	ADP
bioscience-243	231	14	platelet	platelet	NOUN
bioscience-243	231	15	aggregation	aggregation	NOUN
bioscience-243	231	16	is	be	AUX
bioscience-243	231	17	limited	limited	ADJ
bioscience-243	231	18	.	.	PUNCT
bioscience-243	232	1	in	in	ADP
bioscience-243	232	2	contrast	contrast	NOUN
bioscience-243	232	3	,	,	PUNCT
bioscience-243	232	4	studies	study	NOUN
bioscience-243	232	5	on	on	ADP
bioscience-243	232	6	the	the	DET
bioscience-243	232	7	d7	d7	PROPN
bioscience-243	232	8	protein	protein	NOUN
bioscience-243	232	9	from	from	ADP
bioscience-243	232	10	aedes	aedes	PROPN
bioscience-243	232	11	albopictus	albopictus	PROPN
bioscience-243	232	12	,	,	PUNCT
bioscience-243	232	13	a	a	DET
bioscience-243	232	14	related	relate	VERB
bioscience-243	232	15	mosquito	mosquito	ADJ
bioscience-243	232	16	species	specie	NOUN
bioscience-243	232	17	,	,	PUNCT
bioscience-243	232	18	have	have	AUX
bioscience-243	232	19	provided	provide	VERB
bioscience-243	232	20	functional	functional	ADJ
bioscience-243	232	21	evidence	evidence	NOUN
bioscience-243	232	22	of	of	ADP
bioscience-243	232	23	its	its	PRON
bioscience-243	232	24	role	role	NOUN
bioscience-243	232	25	in	in	ADP
bioscience-243	232	26	inhibiting	inhibit	VERB
bioscience-243	232	27	platelet	platelet	NOUN
bioscience-243	232	28	aggregation	aggregation	NOUN
bioscience-243	232	29	.	.	PUNCT
bioscience-243	233	1	for	for	ADP
bioscience-243	233	2	instance	instance	NOUN
bioscience-243	233	3	,	,	PUNCT
bioscience-243	233	4	albod7l1	albod7l1	PROPN
bioscience-243	233	5	,	,	PUNCT
bioscience-243	233	6	a	a	DET
bioscience-243	233	7	long	long	ADJ
bioscience-243	233	8	-	-	PUNCT
bioscience-243	233	9	form	form	NOUN
bioscience-243	233	10	d7	d7	PROPN
bioscience-243	233	11	protein	protein	NOUN
bioscience-243	233	12	from	from	ADP
bioscience-243	233	13	aedes	aedes	PROPN
bioscience-243	233	14	albopictus	albopictus	PROPN
bioscience-243	233	15	,	,	PUNCT
bioscience-243	233	16	has	have	AUX
bioscience-243	233	17	been	be	AUX
bioscience-243	233	18	shown	show	VERB
bioscience-243	233	19	to	to	PART
bioscience-243	233	20	bind	bind	VERB
bioscience-243	233	21	various	various	ADJ
bioscience-243	233	22	ligands	ligand	NOUN
bioscience-243	233	23	and	and	CCONJ
bioscience-243	233	24	inhibit	inhibit	VERB
bioscience-243	233	25	platelet	platelet	NOUN
bioscience-243	233	26	aggregation	aggregation	NOUN
bioscience-243	233	27	in	in	ADP
bioscience-243	233	28	ex	ex	PRON
bioscience-243	233	29	vivo	vivo	ADJ
bioscience-243	233	30	experiments	experiment	NOUN
bioscience-243	233	31	[	[	X
bioscience-243	233	32	10	10	NUM
bioscience-243	233	33	]	]	PUNCT
bioscience-243	233	34	.	.	PUNCT
bioscience-243	234	1	visualization	visualization	NOUN
bioscience-243	234	2	of	of	ADP
bioscience-243	234	3	molecular	molecular	ADJ
bioscience-243	234	4	docking	docking	NOUN
bioscience-243	234	5	results	result	NOUN
bioscience-243	234	6	was	be	AUX
bioscience-243	234	7	carried	carry	VERB
bioscience-243	234	8	out	out	ADP
bioscience-243	234	9	to	to	PART
bioscience-243	234	10	determine	determine	VERB
bioscience-243	234	11	the	the	DET
bioscience-243	234	12	binding	bind	VERB
bioscience-243	234	13	interaction	interaction	NOUN
bioscience-243	234	14	mode	mode	NOUN
bioscience-243	234	15	between	between	ADP
bioscience-243	234	16	protein	protein	NOUN
bioscience-243	234	17	d7	d7	PROPN
bioscience-243	234	18	and	and	CCONJ
bioscience-243	234	19	serotonin	serotonin	VERB
bioscience-243	234	20	ligand	ligand	NOUN
bioscience-243	234	21	.	.	PUNCT
bioscience-243	235	1	the	the	DET
bioscience-243	235	2	target	target	NOUN
bioscience-243	235	3	protein	protein	NOUN
bioscience-243	235	4	can	can	AUX
bioscience-243	235	5	bind	bind	VERB
bioscience-243	235	6	to	to	ADP
bioscience-243	235	7	the	the	DET
bioscience-243	235	8	test	test	NOUN
bioscience-243	235	9	ligand	ligand	NOUN
bioscience-243	235	10	through	through	ADP
bioscience-243	235	11	several	several	ADJ
bioscience-243	235	12	amino	amino	NOUN
bioscience-243	235	13	acid	acid	NOUN
bioscience-243	235	14	residues	residue	NOUN
bioscience-243	235	15	[	[	X
bioscience-243	235	16	20	20	NUM
bioscience-243	235	17	]	]	PUNCT
bioscience-243	235	18	.	.	PUNCT
bioscience-243	236	1	the	the	DET
bioscience-243	236	2	interaction	interaction	NOUN
bioscience-243	236	3	between	between	ADP
bioscience-243	236	4	the	the	DET
bioscience-243	236	5	target	target	NOUN
bioscience-243	236	6	protein	protein	NOUN
bioscience-243	236	7	and	and	CCONJ
bioscience-243	236	8	the	the	DET
bioscience-243	236	9	test	test	NOUN
bioscience-243	236	10	ligand	ligand	NOUN
bioscience-243	236	11	is	be	AUX
bioscience-243	236	12	indicated	indicate	VERB
bioscience-243	236	13	by	by	ADP
bioscience-243	236	14	the	the	DET
bioscience-243	236	15	formation	formation	NOUN
bioscience-243	236	16	of	of	ADP
bioscience-243	236	17	several	several	ADJ
bioscience-243	236	18	types	type	NOUN
bioscience-243	236	19	of	of	ADP
bioscience-243	236	20	chemical	chemical	NOUN
bioscience-243	236	21	bonds	bond	NOUN
bioscience-243	236	22	,	,	PUNCT
bioscience-243	236	23	such	such	ADJ
bioscience-243	236	24	as	as	ADP
bioscience-243	236	25	hydrogen	hydrogen	NOUN
bioscience-243	236	26	bonds	bond	NOUN
bioscience-243	236	27	,	,	PUNCT
bioscience-243	236	28	hydrophobic	hydrophobic	NOUN
bioscience-243	236	29	interactions	interaction	NOUN
bioscience-243	236	30	,	,	PUNCT
bioscience-243	236	31	electrostatic	electrostatic	ADJ
bioscience-243	236	32	interactions	interaction	NOUN
bioscience-243	236	33	,	,	PUNCT
bioscience-243	236	34	and	and	CCONJ
bioscience-243	236	35	highlights	highlight	NOUN
bioscience-243	236	36	in	in	ADP
bioscience-243	236	37	bioscience	bioscience	NOUN
bioscience-243	236	38	page	page	NOUN
bioscience-243	236	39	6	6	NUM
bioscience-243	236	40	of	of	ADP
bioscience-243	236	41	9	9	NUM
bioscience-243	236	42	may	may	PROPN
bioscience-243	236	43	2025|volume	2025|volume	NUM
bioscience-243	236	44	8	8	NUM
bioscience-243	236	45	http://bioscience.highlightsin.org/	http://bioscience.highlightsin.org/	ADV
bioscience-243	237	1	oktarianti	oktarianti	INTJ
bioscience-243	238	1	r	r	NOUN
bioscience-243	238	2	et	et	NOUN
bioscience-243	238	3	al	al	PROPN
bioscience-243	238	4	.	.	PROPN
bioscience-243	238	5	,	,	PUNCT
bioscience-243	238	6	2025	2025	NUM
bioscience-243	238	7	in	in	ADP
bioscience-243	238	8	silico	silico	NOUN
bioscience-243	238	9	study	study	NOUN
bioscience-243	238	10	of	of	ADP
bioscience-243	238	11	the	the	DET
bioscience-243	238	12	interaction	interaction	NOUN
bioscience-243	238	13	between	between	ADP
bioscience-243	238	14	serotonin	serotonin	VERB
bioscience-243	238	15	and	and	CCONJ
bioscience-243	238	16	d7	d7	PROPN
bioscience-243	238	17	protein	protein	NOUN
bioscience-243	238	18	figure	figure	NOUN
bioscience-243	238	19	5	5	NUM
bioscience-243	238	20	.	.	PUNCT
bioscience-243	239	1	visualization	visualization	NOUN
bioscience-243	239	2	of	of	ADP
bioscience-243	239	3	the	the	DET
bioscience-243	239	4	interaction	interaction	NOUN
bioscience-243	239	5	of	of	ADP
bioscience-243	239	6	amino	amino	NOUN
bioscience-243	239	7	acid	acid	NOUN
bioscience-243	239	8	residues	residue	NOUN
bioscience-243	239	9	of	of	ADP
bioscience-243	239	10	d7	d7	PROPN
bioscience-243	239	11	protein	protein	NOUN
bioscience-243	239	12	with	with	ADP
bioscience-243	239	13	serotonin	serotonin	ADJ
bioscience-243	239	14	ligand	ligand	NOUN
bioscience-243	239	15	.	.	PUNCT
bioscience-243	240	1	van	van	PROPN
bioscience-243	240	2	der	der	NOUN
bioscience-243	240	3	waals	waal	NOUN
bioscience-243	240	4	bonds	bond	NOUN
bioscience-243	240	5	[	[	X
bioscience-243	240	6	43	43	NUM
bioscience-243	240	7	]	]	PUNCT
bioscience-243	240	8	.	.	PUNCT
bioscience-243	241	1	the	the	DET
bioscience-243	241	2	results	result	NOUN
bioscience-243	241	3	of	of	ADP
bioscience-243	241	4	molecular	molecular	ADJ
bioscience-243	241	5	docking	docking	NOUN
bioscience-243	241	6	visualization	visualization	NOUN
bioscience-243	241	7	between	between	ADP
bioscience-243	241	8	protein	protein	NOUN
bioscience-243	241	9	d7	d7	PROPN
bioscience-243	241	10	and	and	CCONJ
bioscience-243	241	11	serotonin	serotonin	NOUN
bioscience-243	241	12	ligand	ligand	NOUN
bioscience-243	241	13	can	can	AUX
bioscience-243	241	14	be	be	AUX
bioscience-243	241	15	seen	see	VERB
bioscience-243	241	16	in	in	ADP
bioscience-243	241	17	figure	figure	NOUN
bioscience-243	241	18	5	5	NUM
bioscience-243	241	19	.	.	PUNCT
bioscience-243	241	20	table	table	NOUN
bioscience-243	241	21	4	4	NUM
bioscience-243	241	22	.	.	PUNCT
bioscience-243	241	23	amino	amino	NOUN
bioscience-243	241	24	acid	acid	NOUN
bioscience-243	241	25	residue	residue	NOUN
bioscience-243	241	26	d7	d7	PROPN
bioscience-243	241	27	protein	protein	NOUN
bioscience-243	241	28	that	that	PRON
bioscience-243	241	29	binds	bind	VERB
bioscience-243	241	30	to	to	ADP
bioscience-243	241	31	the	the	DET
bioscience-243	241	32	serotonin	serotonin	VERB
bioscience-243	241	33	ligand	ligand	NOUN
bioscience-243	241	34	amino	amino	NOUN
bioscience-243	241	35	acid	acid	NOUN
bioscience-243	241	36	residue	residue	NOUN
bioscience-243	241	37	d7	d7	PROPN
bioscience-243	241	38	protein	protein	NOUN
bioscience-243	241	39	serotonin	serotonin	VERB
bioscience-243	241	40	ligand	ligand	ADJ
bioscience-243	241	41	atom	atom	NOUN
bioscience-243	241	42	chemical	chemical	PROPN
bioscience-243	241	43	bond	bond	NOUN
bioscience-243	241	44	glutamic	glutamic	ADJ
bioscience-243	241	45	acid	acid	NOUN
bioscience-243	241	46	158	158	NUM
bioscience-243	241	47	(	(	PUNCT
bioscience-243	241	48	glu	glu	NOUN
bioscience-243	241	49	158	158	NUM
bioscience-243	241	50	)	)	PUNCT
bioscience-243	241	51	h	h	NOUN
bioscience-243	241	52	(	(	PUNCT
bioscience-243	241	53	hydrogen	hydrogen	NOUN
bioscience-243	241	54	)	)	PUNCT
bioscience-243	241	55	conventional	conventional	ADJ
bioscience-243	241	56	hydrogen	hydrogen	NOUN
bioscience-243	241	57	bond	bond	NOUN
bioscience-243	241	58	tyrosine	tyrosine	NOUN
bioscience-243	241	59	178	178	NUM
bioscience-243	241	60	(	(	PUNCT
bioscience-243	241	61	tyr	tyr	PROPN
bioscience-243	241	62	178	178	NUM
bioscience-243	241	63	)	)	PUNCT
bioscience-243	241	64	tyrosine	tyrosine	NOUN
bioscience-243	241	65	248	248	NUM
bioscience-243	241	66	(	(	PUNCT
bioscience-243	241	67	tyr	tyr	PROPN
bioscience-243	241	68	248	248	NUM
bioscience-243	241	69	)	)	PUNCT
bioscience-243	241	70	aspartic	aspartic	ADJ
bioscience-243	241	71	acid	acid	NOUN
bioscience-243	241	72	265	265	NUM
bioscience-243	241	73	(	(	PUNCT
bioscience-243	241	74	asp	asp	NOUN
bioscience-243	241	75	265	265	NUM
bioscience-243	241	76	)	)	PUNCT
bioscience-243	241	77	glutamic	glutamic	ADJ
bioscience-243	241	78	acid	acid	NOUN
bioscience-243	241	79	268	268	NUM
bioscience-243	241	80	(	(	PUNCT
bioscience-243	241	81	glu	glu	NOUN
bioscience-243	241	82	268	268	NUM
bioscience-243	241	83	)	)	PUNCT
bioscience-243	241	84	arginine	arginine	NOUN
bioscience-243	241	85	176	176	NUM
bioscience-243	241	86	(	(	PUNCT
bioscience-243	241	87	arg	arg	NOUN
bioscience-243	241	88	176	176	NUM
bioscience-243	241	89	)	)	PUNCT
bioscience-243	241	90	c	c	NOUN
bioscience-243	241	91	(	(	PUNCT
bioscience-243	241	92	carbon	carbon	NOUN
bioscience-243	241	93	)	)	PUNCT
bioscience-243	241	94	carbon	carbon	NOUN
bioscience-243	241	95	hydrogen	hydrogen	NOUN
bioscience-243	241	96	bond	bond	NOUN
bioscience-243	241	97	isoleucine	isoleucine	NOUN
bioscience-243	241	98	175	175	NUM
bioscience-243	241	99	(	(	PUNCT
bioscience-243	241	100	ile	ile	PROPN
bioscience-243	241	101	175	175	NUM
bioscience-243	241	102	)	)	PUNCT
bioscience-243	241	103	c	c	NOUN
bioscience-243	241	104	-	-	PUNCT
bioscience-243	241	105	h	h	NOUN
bioscience-243	241	106	(	(	PUNCT
bioscience-243	241	107	carbon	carbon	NOUN
bioscience-243	241	108	hydrogen	hydrogen	NOUN
bioscience-243	241	109	)	)	PUNCT
bioscience-243	241	110	π	π	PROPN
bioscience-243	241	111	-	-	PUNCT
bioscience-243	241	112	sigma	sigma	PROPN
bioscience-243	241	113	bond	bond	NOUN
bioscience-243	241	114	tyrosine	tyrosine	NOUN
bioscience-243	241	115	178	178	NUM
bioscience-243	241	116	(	(	PUNCT
bioscience-243	241	117	tyr	tyr	PROPN
bioscience-243	241	118	178	178	NUM
bioscience-243	241	119	)	)	PUNCT
bioscience-243	241	120	pi	pi	NOUN
bioscience-243	241	121	-	-	PUNCT
bioscience-243	241	122	orbitals	orbital	NOUN
bioscience-243	241	123	π	π	PROPN
bioscience-243	241	124	-	-	PROPN
bioscience-243	241	125	π	π	PROPN
bioscience-243	241	126	t	t	NOUN
bioscience-243	241	127	-	-	PUNCT
bioscience-243	241	128	shaped	shape	VERB
bioscience-243	241	129	bond	bond	NOUN
bioscience-243	241	130	arginine	arginine	NOUN
bioscience-243	241	131	176	176	NUM
bioscience-243	241	132	(	(	PUNCT
bioscience-243	241	133	arg	arg	NOUN
bioscience-243	241	134	176	176	NUM
bioscience-243	241	135	)	)	PUNCT
bioscience-243	241	136	pi	pi	NOUN
bioscience-243	241	137	-	-	PUNCT
bioscience-243	241	138	orbitals	orbital	NOUN
bioscience-243	241	139	π	π	ADJ
bioscience-243	241	140	-	-	PUNCT
bioscience-243	241	141	alkyl	alkyl	ADJ
bioscience-243	241	142	bond	bond	NOUN
bioscience-243	241	143	table	table	NOUN
bioscience-243	241	144	4	4	NUM
bioscience-243	241	145	shows	show	VERB
bioscience-243	241	146	the	the	DET
bioscience-243	241	147	various	various	ADJ
bioscience-243	241	148	types	type	NOUN
bioscience-243	241	149	of	of	ADP
bioscience-243	241	150	chemical	chemical	NOUN
bioscience-243	241	151	bonds	bond	NOUN
bioscience-243	241	152	formed	form	VERB
bioscience-243	241	153	between	between	ADP
bioscience-243	241	154	amino	amino	NOUN
bioscience-243	241	155	acid	acid	NOUN
bioscience-243	241	156	residues	residue	NOUN
bioscience-243	241	157	of	of	ADP
bioscience-243	241	158	the	the	DET
bioscience-243	241	159	d7	d7	PROPN
bioscience-243	241	160	protein	protein	NOUN
bioscience-243	241	161	that	that	PRON
bioscience-243	241	162	interact	interact	VERB
bioscience-243	241	163	with	with	ADP
bioscience-243	241	164	atoms	atom	NOUN
bioscience-243	241	165	on	on	ADP
bioscience-243	241	166	the	the	DET
bioscience-243	241	167	serotonin	serotonin	NOUN
bioscience-243	241	168	ligand	ligand	NOUN
bioscience-243	241	169	.	.	PUNCT
bioscience-243	242	1	the	the	DET
bioscience-243	242	2	chemical	chemical	ADJ
bioscience-243	242	3	bonds	bond	NOUN
bioscience-243	242	4	formed	form	VERB
bioscience-243	242	5	are	be	AUX
bioscience-243	242	6	interactions	interaction	NOUN
bioscience-243	242	7	that	that	PRON
bioscience-243	242	8	occur	occur	VERB
bioscience-243	242	9	at	at	ADP
bioscience-243	242	10	the	the	DET
bioscience-243	242	11	active	active	ADJ
bioscience-243	242	12	site	site	NOUN
bioscience-243	242	13	of	of	ADP
bioscience-243	242	14	the	the	DET
bioscience-243	242	15	d7	d7	PROPN
bioscience-243	242	16	protein	protein	NOUN
bioscience-243	242	17	binding	bind	VERB
bioscience-243	242	18	to	to	ADP
bioscience-243	242	19	the	the	DET
bioscience-243	242	20	serotonin	serotonin	NOUN
bioscience-243	242	21	test	test	NOUN
bioscience-243	242	22	ligand	ligand	NOUN
bioscience-243	242	23	.	.	PUNCT
bioscience-243	243	1	amino	amino	NOUN
bioscience-243	243	2	acid	acid	NOUN
bioscience-243	243	3	residues	residue	NOUN
bioscience-243	243	4	on	on	ADP
bioscience-243	243	5	the	the	DET
bioscience-243	243	6	active	active	ADJ
bioscience-243	243	7	site	site	NOUN
bioscience-243	243	8	of	of	ADP
bioscience-243	243	9	the	the	DET
bioscience-243	243	10	d7	d7	PROPN
bioscience-243	243	11	protein	protein	NOUN
bioscience-243	243	12	that	that	PRON
bioscience-243	243	13	bind	bind	VERB
bioscience-243	243	14	and	and	CCONJ
bioscience-243	243	15	interact	interact	VERB
bioscience-243	243	16	with	with	ADP
bioscience-243	243	17	the	the	DET
bioscience-243	243	18	serotonin	serotonin	NOUN
bioscience-243	243	19	ligand	ligand	NOUN
bioscience-243	243	20	include	include	VERB
bioscience-243	243	21	glu	glu	PROPN
bioscience-243	243	22	158	158	NUM
bioscience-243	243	23	,	,	PUNCT
bioscience-243	243	24	ile	ile	PROPN
bioscience-243	243	25	175	175	NUM
bioscience-243	243	26	,	,	PUNCT
bioscience-243	243	27	arg	arg	NOUN
bioscience-243	243	28	176	176	NUM
bioscience-243	243	29	,	,	PUNCT
bioscience-243	243	30	tyr	tyr	PROPN
bioscience-243	243	31	178	178	NUM
bioscience-243	243	32	,	,	PUNCT
bioscience-243	243	33	tyr	tyr	PROPN
bioscience-243	243	34	248	248	NUM
bioscience-243	243	35	,	,	PUNCT
bioscience-243	243	36	asp	asp	NOUN
bioscience-243	243	37	265	265	NUM
bioscience-243	243	38	,	,	PUNCT
bioscience-243	243	39	and	and	CCONJ
bioscience-243	243	40	glu	glu	PROPN
bioscience-243	243	41	268	268	NUM
bioscience-243	243	42	.	.	PUNCT
bioscience-243	244	1	the	the	DET
bioscience-243	244	2	chemical	chemical	ADJ
bioscience-243	244	3	bonds	bond	NOUN
bioscience-243	244	4	formed	form	VERB
bioscience-243	244	5	in	in	ADP
bioscience-243	244	6	the	the	DET
bioscience-243	244	7	interaction	interaction	NOUN
bioscience-243	244	8	between	between	ADP
bioscience-243	244	9	the	the	DET
bioscience-243	244	10	d7	d7	PROPN
bioscience-243	244	11	protein	protein	NOUN
bioscience-243	244	12	and	and	CCONJ
bioscience-243	244	13	the	the	DET
bioscience-243	244	14	serotonin	serotonin	NOUN
bioscience-243	244	15	ligand	ligand	NOUN
bioscience-243	244	16	include	include	VERB
bioscience-243	244	17	conventional	conventional	ADJ
bioscience-243	244	18	hydrogen	hydrogen	NOUN
bioscience-243	244	19	bonds	bond	NOUN
bioscience-243	244	20	,	,	PUNCT
bioscience-243	244	21	carbon	carbon	NOUN
bioscience-243	244	22	-	-	PUNCT
bioscience-243	244	23	hydrogen	hydrogen	NOUN
bioscience-243	244	24	bonds	bond	NOUN
bioscience-243	244	25	,	,	PUNCT
bioscience-243	244	26	π	π	PROPN
bioscience-243	244	27	-	-	PUNCT
bioscience-243	244	28	sigma	sigma	PROPN
bioscience-243	244	29	bonds	bond	NOUN
bioscience-243	244	30	,	,	PUNCT
bioscience-243	244	31	π	π	PROPN
bioscience-243	244	32	-	-	PUNCT
bioscience-243	244	33	π	π	PROPN
bioscience-243	244	34	t	t	NOUN
bioscience-243	244	35	-	-	PUNCT
bioscience-243	244	36	shaped	shape	VERB
bioscience-243	244	37	bonds	bond	NOUN
bioscience-243	244	38	,	,	PUNCT
bioscience-243	244	39	and	and	CCONJ
bioscience-243	244	40	π	π	X
bioscience-243	244	41	-	-	ADJ
bioscience-243	244	42	alkyl	alkyl	ADJ
bioscience-243	244	43	bonds	bond	NOUN
bioscience-243	244	44	.	.	PUNCT
bioscience-243	245	1	conventional	conventional	ADJ
bioscience-243	245	2	hydrogen	hydrogen	NOUN
bioscience-243	245	3	bonds	bond	NOUN
bioscience-243	245	4	are	be	AUX
bioscience-243	245	5	formed	form	VERB
bioscience-243	245	6	involving	involve	VERB
bioscience-243	245	7	several	several	ADJ
bioscience-243	245	8	amino	amino	NOUN
bioscience-243	245	9	acid	acid	NOUN
bioscience-243	245	10	residues	residue	NOUN
bioscience-243	245	11	:	:	PUNCT
bioscience-243	245	12	glu	glu	NOUN
bioscience-243	245	13	158	158	NUM
bioscience-243	245	14	,	,	PUNCT
bioscience-243	245	15	tyr	tyr	PROPN
bioscience-243	245	16	178	178	NUM
bioscience-243	245	17	,	,	PUNCT
bioscience-243	245	18	tyr	tyr	PROPN
bioscience-243	245	19	248	248	NUM
bioscience-243	245	20	,	,	PUNCT
bioscience-243	245	21	asp	asp	NOUN
bioscience-243	245	22	265	265	NUM
bioscience-243	245	23	,	,	PUNCT
bioscience-243	245	24	and	and	CCONJ
bioscience-243	245	25	glu	glu	PROPN
bioscience-243	245	26	268	268	NUM
bioscience-243	245	27	.	.	PUNCT
bioscience-243	246	1	the	the	DET
bioscience-243	246	2	carbonhydrogen	carbonhydrogen	NOUN
bioscience-243	246	3	bond	bond	NOUN
bioscience-243	246	4	formed	form	VERB
bioscience-243	246	5	involves	involve	VERB
bioscience-243	246	6	one	one	NUM
bioscience-243	246	7	amino	amino	NOUN
bioscience-243	246	8	acid	acid	NOUN
bioscience-243	246	9	residue	residue	NOUN
bioscience-243	246	10	,	,	PUNCT
bioscience-243	246	11	namely	namely	ADV
bioscience-243	246	12	arg	arg	VERB
bioscience-243	246	13	176	176	NUM
bioscience-243	246	14	.	.	PUNCT
bioscience-243	247	1	the	the	DET
bioscience-243	247	2	π	π	PROPN
bioscience-243	247	3	-	-	PROPN
bioscience-243	247	4	sigma	sigma	PROPN
bioscience-243	247	5	bond	bond	NOUN
bioscience-243	247	6	formed	form	VERB
bioscience-243	247	7	only	only	ADV
bioscience-243	247	8	involves	involve	VERB
bioscience-243	247	9	one	one	NUM
bioscience-243	247	10	amino	amino	NOUN
bioscience-243	247	11	acid	acid	NOUN
bioscience-243	247	12	residue	residue	NOUN
bioscience-243	247	13	,	,	PUNCT
bioscience-243	247	14	namely	namely	ADV
bioscience-243	247	15	ile	ile	PROPN
bioscience-243	247	16	175	175	NUM
bioscience-243	247	17	.	.	PUNCT
bioscience-243	248	1	the	the	DET
bioscience-243	248	2	π	π	PROPN
bioscience-243	248	3	-	-	PROPN
bioscience-243	248	4	π	π	PROPN
bioscience-243	248	5	t	t	NOUN
bioscience-243	248	6	-	-	PUNCT
bioscience-243	248	7	shaped	shape	VERB
bioscience-243	248	8	bond	bond	NOUN
bioscience-243	248	9	formed	form	VERB
bioscience-243	248	10	also	also	ADV
bioscience-243	248	11	involves	involve	VERB
bioscience-243	248	12	one	one	NUM
bioscience-243	248	13	amino	amino	NOUN
bioscience-243	248	14	acid	acid	NOUN
bioscience-243	248	15	residue	residue	NOUN
bioscience-243	248	16	,	,	PUNCT
bioscience-243	248	17	namely	namely	ADV
bioscience-243	248	18	tyr	tyr	PROPN
bioscience-243	248	19	178	178	NUM
bioscience-243	248	20	.	.	PUNCT
bioscience-243	249	1	the	the	DET
bioscience-243	249	2	π	π	ADJ
bioscience-243	249	3	-	-	ADJ
bioscience-243	249	4	alkyl	alkyl	ADJ
bioscience-243	249	5	bond	bond	NOUN
bioscience-243	249	6	also	also	ADV
bioscience-243	249	7	involves	involve	VERB
bioscience-243	249	8	one	one	NUM
bioscience-243	249	9	amino	amino	NOUN
bioscience-243	249	10	acid	acid	NOUN
bioscience-243	249	11	residue	residue	NOUN
bioscience-243	249	12	,	,	PUNCT
bioscience-243	249	13	namely	namely	ADV
bioscience-243	249	14	arg	arg	VERB
bioscience-243	249	15	176	176	NUM
bioscience-243	249	16	.	.	PUNCT
bioscience-243	250	1	hydrogen	hydrogen	NOUN
bioscience-243	250	2	bonds	bond	NOUN
bioscience-243	250	3	are	be	AUX
bioscience-243	250	4	formed	form	VERB
bioscience-243	250	5	between	between	ADP
bioscience-243	250	6	hydrogen	hydrogen	NOUN
bioscience-243	250	7	atoms	atom	NOUN
bioscience-243	250	8	and	and	CCONJ
bioscience-243	250	9	electronegative	electronegative	ADJ
bioscience-243	250	10	atoms	atom	NOUN
bioscience-243	250	11	.	.	PUNCT
bioscience-243	251	1	this	this	DET
bioscience-243	251	2	hydrogen	hydrogen	NOUN
bioscience-243	251	3	bond	bond	NOUN
bioscience-243	251	4	formation	formation	NOUN
bioscience-243	251	5	is	be	AUX
bioscience-243	251	6	related	relate	VERB
bioscience-243	251	7	to	to	ADP
bioscience-243	251	8	binding	bind	VERB
bioscience-243	251	9	energy	energy	NOUN
bioscience-243	251	10	(	(	PUNCT
bioscience-243	251	11	∆g	∆g	PROPN
bioscience-243	251	12	)	)	PUNCT
bioscience-243	251	13	.	.	PUNCT
bioscience-243	252	1	the	the	DET
bioscience-243	252	2	formation	formation	NOUN
bioscience-243	252	3	of	of	ADP
bioscience-243	252	4	hydrogen	hydrogen	NOUN
bioscience-243	252	5	bonds	bond	NOUN
bioscience-243	252	6	can	can	AUX
bioscience-243	252	7	release	release	VERB
bioscience-243	252	8	energy	energy	NOUN
bioscience-243	252	9	due	due	ADP
bioscience-243	252	10	to	to	ADP
bioscience-243	252	11	covalent	covalent	ADJ
bioscience-243	252	12	interactions	interaction	NOUN
bioscience-243	252	13	,	,	PUNCT
bioscience-243	252	14	resulting	result	VERB
bioscience-243	252	15	in	in	ADP
bioscience-243	252	16	a	a	DET
bioscience-243	252	17	negative	negative	ADJ
bioscience-243	252	18	change	change	NOUN
bioscience-243	252	19	in	in	ADP
bioscience-243	252	20	enthalpy	enthalpy	NOUN
bioscience-243	252	21	(	(	PUNCT
bioscience-243	252	22	∆h	∆h	PROPN
bioscience-243	252	23	)	)	PUNCT
bioscience-243	252	24	.	.	PUNCT
bioscience-243	253	1	a	a	DET
bioscience-243	253	2	negative	negative	ADJ
bioscience-243	253	3	change	change	NOUN
bioscience-243	253	4	in	in	ADP
bioscience-243	253	5	enthalpy	enthalpy	NOUN
bioscience-243	253	6	can	can	AUX
bioscience-243	253	7	occur	occur	VERB
bioscience-243	253	8	when	when	SCONJ
bioscience-243	253	9	a	a	DET
bioscience-243	253	10	protein	protein	NOUN
bioscience-243	253	11	and	and	CCONJ
bioscience-243	253	12	ligand	ligand	NOUN
bioscience-243	253	13	bind	bind	NOUN
bioscience-243	253	14	.	.	PUNCT
bioscience-243	254	1	this	this	DET
bioscience-243	254	2	result	result	NOUN
bioscience-243	254	3	can	can	AUX
bioscience-243	254	4	lead	lead	VERB
bioscience-243	254	5	to	to	ADP
bioscience-243	254	6	a	a	DET
bioscience-243	254	7	negative	negative	ADJ
bioscience-243	254	8	∆g	∆g	PROPN
bioscience-243	254	9	value	value	NOUN
bioscience-243	254	10	,	,	PUNCT
bioscience-243	254	11	meaning	mean	VERB
bioscience-243	254	12	the	the	DET
bioscience-243	254	13	binding	bind	VERB
bioscience-243	254	14	occurs	occur	VERB
bioscience-243	254	15	spontaneously	spontaneously	ADV
bioscience-243	254	16	or	or	CCONJ
bioscience-243	254	17	is	be	AUX
bioscience-243	254	18	stable	stable	ADJ
bioscience-243	254	19	[	[	X
bioscience-243	254	20	44	44	NUM
bioscience-243	254	21	]	]	PUNCT
bioscience-243	254	22	.	.	PUNCT
bioscience-243	255	1	the	the	DET
bioscience-243	255	2	interaction	interaction	NOUN
bioscience-243	255	3	between	between	ADP
bioscience-243	255	4	the	the	DET
bioscience-243	255	5	serotonin	serotonin	NOUN
bioscience-243	255	6	ligand	ligand	NOUN
bioscience-243	255	7	and	and	CCONJ
bioscience-243	255	8	protein	protein	NOUN
bioscience-243	255	9	d7	d7	PROPN
bioscience-243	255	10	involved	involve	VERB
bioscience-243	255	11	in	in	ADP
bioscience-243	255	12	hydrogen	hydrogen	NOUN
bioscience-243	255	13	bonding	bonding	NOUN
bioscience-243	255	14	consists	consist	NOUN
bioscience-243	255	15	of	of	ADP
bioscience-243	255	16	conventional	conventional	ADJ
bioscience-243	255	17	hydrogen	hydrogen	NOUN
bioscience-243	255	18	bonds	bond	NOUN
bioscience-243	255	19	.	.	PUNCT
bioscience-243	256	1	in	in	ADP
bioscience-243	256	2	conventional	conventional	ADJ
bioscience-243	256	3	hydrogen	hydrogen	NOUN
bioscience-243	256	4	bonds	bond	NOUN
bioscience-243	256	5	,	,	PUNCT
bioscience-243	256	6	hydrogen	hydrogen	NOUN
bioscience-243	256	7	is	be	AUX
bioscience-243	256	8	shared	share	VERB
bioscience-243	256	9	between	between	ADP
bioscience-243	256	10	electronegative	electronegative	ADJ
bioscience-243	256	11	atoms	atom	NOUN
bioscience-243	256	12	acting	act	VERB
bioscience-243	256	13	as	as	ADP
bioscience-243	256	14	donors	donor	NOUN
bioscience-243	256	15	(	(	PUNCT
bioscience-243	256	16	e.g.	e.g.	ADV
bioscience-243	256	17	,	,	PUNCT
bioscience-243	256	18	o	o	NOUN
bioscience-243	256	19	-	-	NOUN
bioscience-243	256	20	h	h	NOUN
bioscience-243	256	21	,	,	PUNCT
bioscience-243	256	22	n	n	CCONJ
bioscience-243	256	23	-	-	PUNCT
bioscience-243	256	24	h	h	NOUN
bioscience-243	256	25	on	on	ADP
bioscience-243	256	26	the	the	DET
bioscience-243	256	27	ligand	ligand	NOUN
bioscience-243	256	28	or	or	CCONJ
bioscience-243	256	29	protein	protein	NOUN
bioscience-243	256	30	)	)	PUNCT
bioscience-243	256	31	and	and	CCONJ
bioscience-243	256	32	acceptors	acceptor	NOUN
bioscience-243	256	33	(	(	PUNCT
bioscience-243	256	34	e.g.	e.g.	ADV
bioscience-243	256	35	,	,	PUNCT
bioscience-243	256	36	o	o	NOUN
bioscience-243	256	37	,	,	PUNCT
bioscience-243	256	38	n	n	CCONJ
bioscience-243	256	39	on	on	ADP
bioscience-243	256	40	the	the	DET
bioscience-243	256	41	protein	protein	NOUN
bioscience-243	256	42	or	or	CCONJ
bioscience-243	256	43	ligand	ligand	NOUN
bioscience-243	256	44	)	)	PUNCT
bioscience-243	257	1	[	[	X
bioscience-243	257	2	45	45	NUM
bioscience-243	257	3	]	]	PUNCT
bioscience-243	257	4	.	.	PUNCT
bioscience-243	258	1	hydrogen	hydrogen	NOUN
bioscience-243	258	2	bonds	bond	NOUN
bioscience-243	258	3	significantly	significantly	ADV
bioscience-243	258	4	influence	influence	VERB
bioscience-243	258	5	the	the	DET
bioscience-243	258	6	stability	stability	NOUN
bioscience-243	258	7	of	of	ADP
bioscience-243	258	8	the	the	DET
bioscience-243	258	9	d7	d7	PROPN
bioscience-243	258	10	protein	protein	NOUN
bioscience-243	258	11	-	-	PUNCT
bioscience-243	258	12	ligand	ligand	NOUN
bioscience-243	258	13	complex	complex	NOUN
bioscience-243	258	14	because	because	SCONJ
bioscience-243	258	15	both	both	CCONJ
bioscience-243	258	16	the	the	DET
bioscience-243	258	17	protein	protein	NOUN
bioscience-243	258	18	and	and	CCONJ
bioscience-243	258	19	ligand	ligand	NOUN
bioscience-243	258	20	contain	contain	VERB
bioscience-243	258	21	potential	potential	ADJ
bioscience-243	258	22	hydrogen	hydrogen	NOUN
bioscience-243	258	23	bond	bond	NOUN
bioscience-243	258	24	donors	donor	NOUN
bioscience-243	258	25	(	(	PUNCT
bioscience-243	258	26	like	like	ADP
bioscience-243	258	27	n	n	CCONJ
bioscience-243	258	28	-	-	PUNCT
bioscience-243	258	29	h	h	NOUN
bioscience-243	258	30	and	and	CCONJ
bioscience-243	258	31	o	o	NOUN
bioscience-243	258	32	-	-	NOUN
bioscience-243	258	33	h	h	NOUN
bioscience-243	258	34	)	)	PUNCT
bioscience-243	258	35	and	and	CCONJ
bioscience-243	258	36	acceptors	acceptor	NOUN
bioscience-243	258	37	.	.	PUNCT
bioscience-243	259	1	these	these	DET
bioscience-243	259	2	structures	structure	NOUN
bioscience-243	259	3	act	act	VERB
bioscience-243	259	4	as	as	ADP
bioscience-243	259	5	donors	donor	NOUN
bioscience-243	259	6	or	or	CCONJ
bioscience-243	259	7	acceptors	acceptor	NOUN
bioscience-243	259	8	in	in	ADP
bioscience-243	259	9	hydrogen	hydrogen	NOUN
bioscience-243	259	10	bonds	bond	NOUN
bioscience-243	259	11	.	.	PUNCT
bioscience-243	260	1	the	the	DET
bioscience-243	260	2	next	next	ADJ
bioscience-243	260	3	type	type	NOUN
bioscience-243	260	4	is	be	AUX
bioscience-243	260	5	the	the	DET
bioscience-243	260	6	π	π	PROPN
bioscience-243	260	7	-	-	PUNCT
bioscience-243	260	8	sigma	sigma	PROPN
bioscience-243	260	9	bond	bond	NOUN
bioscience-243	260	10	,	,	PUNCT
bioscience-243	260	11	which	which	PRON
bioscience-243	260	12	is	be	AUX
bioscience-243	260	13	an	an	DET
bioscience-243	260	14	interaction	interaction	NOUN
bioscience-243	260	15	involving	involve	VERB
bioscience-243	260	16	the	the	DET
bioscience-243	260	17	π	π	NOUN
bioscience-243	260	18	-	-	NOUN
bioscience-243	260	19	system	system	NOUN
bioscience-243	260	20	of	of	ADP
bioscience-243	260	21	an	an	DET
bioscience-243	260	22	aromatic	aromatic	ADJ
bioscience-243	260	23	ring	ring	NOUN
bioscience-243	260	24	and	and	CCONJ
bioscience-243	260	25	a	a	DET
bioscience-243	260	26	sigma	sigma	PROPN
bioscience-243	260	27	bond	bond	NOUN
bioscience-243	260	28	(	(	PUNCT
bioscience-243	260	29	like	like	ADP
bioscience-243	260	30	c	c	NOUN
bioscience-243	260	31	-	-	PUNCT
bioscience-243	260	32	h	h	NOUN
bioscience-243	260	33	)	)	PUNCT
bioscience-243	261	1	[	[	X
bioscience-243	261	2	46	46	NUM
bioscience-243	261	3	]	]	PUNCT
bioscience-243	261	4	.	.	PUNCT
bioscience-243	262	1	the	the	DET
bioscience-243	262	2	π	π	PROPN
bioscience-243	262	3	-	-	PROPN
bioscience-243	262	4	sigma	sigma	PROPN
bioscience-243	262	5	bond	bond	NOUN
bioscience-243	262	6	occurs	occur	VERB
bioscience-243	262	7	between	between	ADP
bioscience-243	262	8	the	the	DET
bioscience-243	262	9	amino	amino	NOUN
bioscience-243	262	10	acid	acid	NOUN
bioscience-243	262	11	ile	ile	PROPN
bioscience-243	262	12	175	175	NUM
bioscience-243	262	13	and	and	CCONJ
bioscience-243	262	14	the	the	DET
bioscience-243	262	15	ligand	ligand	NOUN
bioscience-243	262	16	.	.	PUNCT
bioscience-243	263	1	the	the	DET
bioscience-243	263	2	next	next	ADJ
bioscience-243	263	3	bond	bond	NOUN
bioscience-243	263	4	is	be	AUX
bioscience-243	263	5	a	a	DET
bioscience-243	263	6	π	π	PROPN
bioscience-243	263	7	-	-	PROPN
bioscience-243	263	8	π	π	PROPN
bioscience-243	263	9	t	t	NOUN
bioscience-243	263	10	-	-	PUNCT
bioscience-243	263	11	shaped	shape	VERB
bioscience-243	263	12	bond	bond	NOUN
bioscience-243	263	13	,	,	PUNCT
bioscience-243	263	14	which	which	PRON
bioscience-243	263	15	is	be	AUX
bioscience-243	263	16	an	an	DET
bioscience-243	263	17	electron	electron	NOUN
bioscience-243	263	18	interaction	interaction	NOUN
bioscience-243	263	19	between	between	ADP
bioscience-243	263	20	two	two	NUM
bioscience-243	263	21	aromatic	aromatic	ADJ
bioscience-243	263	22	groups	group	NOUN
bioscience-243	263	23	but	but	CCONJ
bioscience-243	263	24	in	in	ADP
bioscience-243	263	25	a	a	DET
bioscience-243	263	26	t	t	NOUN
bioscience-243	263	27	shape	shape	NOUN
bioscience-243	263	28	[	[	X
bioscience-243	263	29	47	47	NUM
bioscience-243	263	30	]	]	PUNCT
bioscience-243	263	31	.	.	PUNCT
bioscience-243	264	1	in	in	ADP
bioscience-243	264	2	this	this	DET
bioscience-243	264	3	geometry	geometry	NOUN
bioscience-243	264	4	,	,	PUNCT
bioscience-243	264	5	the	the	DET
bioscience-243	264	6	edge	edge	NOUN
bioscience-243	264	7	of	of	ADP
bioscience-243	264	8	one	one	NUM
bioscience-243	264	9	aromatic	aromatic	ADJ
bioscience-243	264	10	ring	ring	NOUN
bioscience-243	264	11	points	point	NOUN
bioscience-243	264	12	towards	towards	ADP
bioscience-243	264	13	the	the	DET
bioscience-243	264	14	face	face	NOUN
bioscience-243	264	15	of	of	ADP
bioscience-243	264	16	the	the	DET
bioscience-243	264	17	other	other	ADJ
bioscience-243	264	18	aromatic	aromatic	ADJ
bioscience-243	264	19	ring	ring	NOUN
bioscience-243	264	20	.	.	PUNCT
bioscience-243	265	1	the	the	DET
bioscience-243	265	2	last	last	ADJ
bioscience-243	265	3	interaction	interaction	NOUN
bioscience-243	265	4	is	be	AUX
bioscience-243	265	5	a	a	DET
bioscience-243	265	6	type	type	NOUN
bioscience-243	265	7	of	of	ADP
bioscience-243	265	8	π	π	PROPN
bioscience-243	265	9	-	-	ADJ
bioscience-243	265	10	alkyl	alkyl	ADJ
bioscience-243	265	11	bond	bond	NOUN
bioscience-243	265	12	,	,	PUNCT
bioscience-243	265	13	which	which	PRON
bioscience-243	265	14	is	be	AUX
bioscience-243	265	15	an	an	DET
bioscience-243	265	16	interaction	interaction	NOUN
bioscience-243	265	17	between	between	ADP
bioscience-243	265	18	electrons	electron	NOUN
bioscience-243	265	19	from	from	ADP
bioscience-243	265	20	the	the	DET
bioscience-243	265	21	aromatic	aromatic	ADJ
bioscience-243	265	22	group	group	NOUN
bioscience-243	265	23	and	and	CCONJ
bioscience-243	265	24	the	the	DET
bioscience-243	265	25	electron	electron	NOUN
bioscience-243	265	26	group	group	NOUN
bioscience-243	265	27	from	from	ADP
bioscience-243	265	28	the	the	DET
bioscience-243	265	29	alkyl	alkyl	ADJ
bioscience-243	265	30	group	group	NOUN
bioscience-243	265	31	[	[	X
bioscience-243	265	32	47	47	NUM
bioscience-243	265	33	]	]	PUNCT
bioscience-243	265	34	.	.	PUNCT
bioscience-243	266	1	conclusions	conclusion	NOUN
bioscience-243	266	2	the	the	DET
bioscience-243	266	3	molecular	molecular	ADJ
bioscience-243	266	4	docking	docking	NOUN
bioscience-243	266	5	results	result	NOUN
bioscience-243	266	6	show	show	VERB
bioscience-243	266	7	that	that	SCONJ
bioscience-243	266	8	there	there	PRON
bioscience-243	266	9	is	be	VERB
bioscience-243	266	10	an	an	DET
bioscience-243	266	11	interaction	interaction	NOUN
bioscience-243	266	12	between	between	ADP
bioscience-243	266	13	the	the	DET
bioscience-243	266	14	d7	d7	PROPN
bioscience-243	266	15	protein	protein	NOUN
bioscience-243	266	16	from	from	ADP
bioscience-243	266	17	the	the	DET
bioscience-243	266	18	salivary	salivary	ADJ
bioscience-243	266	19	gland	gland	NOUN
bioscience-243	266	20	of	of	ADP
bioscience-243	266	21	ae	ae	PROPN
bioscience-243	266	22	.	.	PUNCT
bioscience-243	267	1	aegypti	aegypti	VERB
bioscience-243	267	2	(	(	PUNCT
bioscience-243	267	3	accession	accession	NOUN
bioscience-243	267	4	number	number	NOUN
bioscience-243	267	5	p18153	p18153	VERB
bioscience-243	267	6	)	)	PUNCT
bioscience-243	267	7	and	and	CCONJ
bioscience-243	267	8	the	the	DET
bioscience-243	267	9	serotonin	serotonin	NOUN
bioscience-243	267	10	test	test	NOUN
bioscience-243	267	11	ligand	ligand	NOUN
bioscience-243	267	12	(	(	PUNCT
bioscience-243	267	13	accession	accession	NOUN
bioscience-243	267	14	number	number	NOUN
bioscience-243	267	15	5202	5202	NUM
bioscience-243	267	16	)	)	PUNCT
bioscience-243	267	17	.	.	PUNCT
bioscience-243	268	1	the	the	DET
bioscience-243	268	2	interaction	interaction	NOUN
bioscience-243	268	3	between	between	ADP
bioscience-243	268	4	the	the	DET
bioscience-243	268	5	d7	d7	PROPN
bioscience-243	268	6	protein	protein	NOUN
bioscience-243	268	7	and	and	CCONJ
bioscience-243	268	8	the	the	DET
bioscience-243	268	9	serotonin	serotonin	NOUN
bioscience-243	268	10	test	test	NOUN
bioscience-243	268	11	ligand	ligand	NOUN
bioscience-243	268	12	shows	show	VERB
bioscience-243	268	13	stability	stability	NOUN
bioscience-243	268	14	and	and	CCONJ
bioscience-243	268	15	spontaneity	spontaneity	NOUN
bioscience-243	268	16	based	base	VERB
bioscience-243	268	17	on	on	ADP
bioscience-243	268	18	the	the	DET
bioscience-243	268	19	∆g	∆g	PROPN
bioscience-243	268	20	value	value	NOUN
bioscience-243	268	21	of	of	ADP
bioscience-243	268	22	-9.25	-9.25	ADJ
bioscience-243	268	23	kcal	kcal	PROPN
bioscience-243	268	24	/	/	SYM
bioscience-243	268	25	mol	mol	PROPN
bioscience-243	268	26	.	.	PROPN
bioscience-243	268	27	based	base	VERB
bioscience-243	268	28	on	on	ADP
bioscience-243	268	29	the	the	DET
bioscience-243	268	30	∆g	∆g	PROPN
bioscience-243	268	31	parameter	parameter	NOUN
bioscience-243	268	32	,	,	PUNCT
bioscience-243	268	33	this	this	PRON
bioscience-243	268	34	indicates	indicate	VERB
bioscience-243	268	35	that	that	SCONJ
bioscience-243	268	36	the	the	DET
bioscience-243	268	37	d7	d7	PROPN
bioscience-243	268	38	protein	protein	NOUN
bioscience-243	268	39	and	and	CCONJ
bioscience-243	268	40	the	the	DET
bioscience-243	268	41	serotonin	serotonin	NOUN
bioscience-243	268	42	ligand	ligand	NOUN
bioscience-243	268	43	can	can	AUX
bioscience-243	268	44	bind	bind	VERB
bioscience-243	268	45	spontaneously	spontaneously	ADV
bioscience-243	268	46	and	and	CCONJ
bioscience-243	268	47	stably	stably	ADV
bioscience-243	268	48	.	.	PUNCT
bioscience-243	269	1	the	the	DET
bioscience-243	269	2	amino	amino	NOUN
bioscience-243	269	3	acid	acid	NOUN
bioscience-243	269	4	residues	residue	NOUN
bioscience-243	269	5	of	of	ADP
bioscience-243	269	6	protein	protein	NOUN
bioscience-243	269	7	d7	d7	PROPN
bioscience-243	269	8	that	that	PRON
bioscience-243	269	9	interact	interact	VERB
bioscience-243	269	10	with	with	ADP
bioscience-243	269	11	the	the	DET
bioscience-243	269	12	serotonin	serotonin	VERB
bioscience-243	269	13	ligand	ligand	NOUN
bioscience-243	269	14	atoms	atom	NOUN
bioscience-243	269	15	include	include	VERB
bioscience-243	269	16	glu	glu	PROPN
bioscience-243	269	17	158	158	NUM
bioscience-243	269	18	,	,	PUNCT
bioscience-243	269	19	ile	ile	PROPN
bioscience-243	269	20	175	175	NUM
bioscience-243	269	21	,	,	PUNCT
bioscience-243	269	22	arg	arg	NOUN
bioscience-243	269	23	176	176	NUM
bioscience-243	269	24	,	,	PUNCT
bioscience-243	269	25	tyr	tyr	PROPN
bioscience-243	269	26	178	178	NUM
bioscience-243	269	27	,	,	PUNCT
bioscience-243	269	28	tyr	tyr	PROPN
bioscience-243	269	29	248	248	NUM
bioscience-243	269	30	,	,	PUNCT
bioscience-243	269	31	asp	asp	NOUN
bioscience-243	269	32	265	265	NUM
bioscience-243	269	33	,	,	PUNCT
bioscience-243	269	34	and	and	CCONJ
bioscience-243	269	35	glu	glu	PROPN
bioscience-243	269	36	268	268	NUM
bioscience-243	269	37	.	.	PUNCT
bioscience-243	270	1	thus	thus	ADV
bioscience-243	270	2	,	,	PUNCT
bioscience-243	270	3	the	the	DET
bioscience-243	270	4	d7	d7	PROPN
bioscience-243	270	5	protein	protein	NOUN
bioscience-243	270	6	from	from	ADP
bioscience-243	270	7	the	the	DET
bioscience-243	270	8	salivary	salivary	ADJ
bioscience-243	270	9	gland	gland	NOUN
bioscience-243	270	10	of	of	ADP
bioscience-243	270	11	ae	ae	PROPN
bioscience-243	270	12	.	.	PUNCT
bioscience-243	271	1	aegypti	aegypti	PROPN
bioscience-243	271	2	has	have	VERB
bioscience-243	271	3	potential	potential	ADJ
bioscience-243	271	4	as	as	ADP
bioscience-243	271	5	a	a	DET
bioscience-243	271	6	new	new	ADJ
bioscience-243	271	7	agent	agent	NOUN
bioscience-243	271	8	for	for	ADP
bioscience-243	271	9	platelet	platelet	NOUN
bioscience-243	271	10	aggregation	aggregation	NOUN
bioscience-243	271	11	inhibition	inhibition	NOUN
bioscience-243	271	12	for	for	ADP
bioscience-243	271	13	drug	drug	NOUN
bioscience-243	271	14	discovery	discovery	NOUN
bioscience-243	271	15	and	and	CCONJ
bioscience-243	271	16	development	development	NOUN
bioscience-243	271	17	in	in	ADP
bioscience-243	271	18	the	the	DET
bioscience-243	271	19	fields	field	NOUN
bioscience-243	271	20	of	of	ADP
bioscience-243	271	21	health	health	NOUN
bioscience-243	271	22	and	and	CCONJ
bioscience-243	271	23	pharmacy	pharmacy	NOUN
bioscience-243	271	24	.	.	PUNCT
bioscience-243	272	1	supplementary	supplementary	ADJ
bioscience-243	272	2	table	table	NOUN
bioscience-243	272	3	s1	s1	NOUN
bioscience-243	272	4	:	:	PUNCT
bioscience-243	272	5	d7	d7	PROPN
bioscience-243	272	6	protein	protein	NOUN
bioscience-243	272	7	model	model	NOUN
bioscience-243	272	8	quality	quality	NOUN
bioscience-243	272	9	assessment	assessment	NOUN
bioscience-243	272	10	parameters	parameter	NOUN
bioscience-243	272	11	.	.	PUNCT
bioscience-243	273	1	highlights	highlight	NOUN
bioscience-243	273	2	in	in	ADP
bioscience-243	273	3	bioscience	bioscience	NOUN
bioscience-243	273	4	page	page	NOUN
bioscience-243	273	5	7	7	NUM
bioscience-243	273	6	of	of	ADP
bioscience-243	273	7	9	9	NUM
bioscience-243	273	8	may	may	PROPN
bioscience-243	273	9	2025|volume	2025|volume	NUM
bioscience-243	273	10	8	8	NUM
bioscience-243	273	11	http://bioscience.highlightsin.org/	http://bioscience.highlightsin.org/	ADV
bioscience-243	273	12	oktarianti	oktarianti	INTJ
bioscience-243	274	1	r	r	NOUN
bioscience-243	274	2	et	et	NOUN
bioscience-243	274	3	al	al	PROPN
bioscience-243	274	4	.	.	PROPN
bioscience-243	274	5	,	,	PUNCT
bioscience-243	274	6	2025	2025	NUM
bioscience-243	274	7	in	in	ADP
bioscience-243	274	8	silico	silico	NOUN
bioscience-243	274	9	study	study	NOUN
bioscience-243	274	10	of	of	ADP
bioscience-243	274	11	the	the	DET
bioscience-243	274	12	interaction	interaction	NOUN
bioscience-243	274	13	between	between	ADP
bioscience-243	274	14	serotonin	serotonin	VERB
bioscience-243	274	15	and	and	CCONJ
bioscience-243	274	16	d7	d7	PROPN
bioscience-243	274	17	protein	protein	NOUN
bioscience-243	274	18	reference	reference	NOUN
bioscience-243	274	19	1	1	NUM
bioscience-243	274	20	.	.	PUNCT
bioscience-243	274	21	wathon	wathon	PROPN
bioscience-243	274	22	s	s	PROPN
bioscience-243	274	23	,	,	PUNCT
bioscience-243	274	24	mutiah	mutiah	NOUN
bioscience-243	274	25	f	f	NUM
bioscience-243	274	26	,	,	PUNCT
bioscience-243	274	27	oktarianti	oktarianti	PROPN
bioscience-243	274	28	r	r	PROPN
bioscience-243	274	29	,	,	PUNCT
bioscience-243	274	30	senjarini	senjarini	PROPN
bioscience-243	274	31	k.	k.	PROPN
bioscience-243	274	32	purifikasi	purifikasi	PROPN
bioscience-243	275	1	protein	protein	NOUN
bioscience-243	275	2	imunogenik	imunogenik	VERB
bioscience-243	275	3	31	31	NUM
bioscience-243	275	4	dan	dan	PROPN
bioscience-243	275	5	56	56	NUM
bioscience-243	275	6	kda	kda	NOUN
bioscience-243	275	7	dari	dari	PROPN
bioscience-243	275	8	kelenjar	kelenjar	PROPN
bioscience-243	275	9	saliva	saliva	NOUN
bioscience-243	275	10	aedes	aedes	PROPN
bioscience-243	275	11	aegypti	aegypti	PROPN
bioscience-243	275	12	.	.	PUNCT
bioscience-243	276	1	jurnal	jurnal	ADJ
bioscience-243	276	2	bioteknologi	bioteknologi	PROPN
bioscience-243	276	3	dan	dan	PROPN
bioscience-243	276	4	biosains	biosains	PROPN
bioscience-243	276	5	indonesia	indonesia	PROPN
bioscience-243	276	6	.	.	PUNCT
bioscience-243	277	1	2020;7(1):59	2020;7(1):59	NUM
bioscience-243	277	2	-	-	SYM
bioscience-243	277	3	71	71	NUM
bioscience-243	277	4	.	.	NOUN
bioscience-243	278	1	2	2	NUM
bioscience-243	278	2	.	.	NUM
bioscience-243	278	3	wathon	wathon	PROPN
bioscience-243	278	4	s	s	NOUN
bioscience-243	278	5	,	,	PUNCT
bioscience-243	278	6	oktarianti	oktarianti	PROPN
bioscience-243	278	7	r	r	PROPN
bioscience-243	278	8	,	,	PUNCT
bioscience-243	278	9	senjarini	senjarini	PROPN
bioscience-243	278	10	k.	k.	PROPN
bioscience-243	278	11	kelenjar	kelenjar	PROPN
bioscience-243	278	12	saliva	saliva	NOUN
bioscience-243	278	13	aedes	aedes	PROPN
bioscience-243	278	14	aegypti	aegypti	VERB
bioscience-243	278	15	harapan	harapan	PROPN
bioscience-243	278	16	baru	baru	PROPN
bioscience-243	278	17	pengembangan	pengembangan	PROPN
bioscience-243	278	18	vaksin	vaksin	PROPN
bioscience-243	278	19	demam	demam	PROPN
bioscience-243	278	20	berdarah	berdarah	PROPN
bioscience-243	278	21	dengue	dengue	NOUN
bioscience-243	278	22	.	.	PUNCT
bioscience-243	279	1	2016	2016	NUM
bioscience-243	279	2	.	.	PUNCT
bioscience-243	280	1	3	3	X
bioscience-243	280	2	.	.	X
bioscience-243	280	3	guerrero	guerrero	PROPN
bioscience-243	280	4	d	d	PROPN
bioscience-243	280	5	,	,	PUNCT
bioscience-243	280	6	cantaert	cantaert	PROPN
bioscience-243	280	7	t	t	PROPN
bioscience-243	280	8	,	,	PUNCT
bioscience-243	280	9	missé	missé	PROPN
bioscience-243	280	10	d.	d.	PROPN
bioscience-243	280	11	aedes	aedes	PROPN
bioscience-243	280	12	mosquito	mosquito	PROPN
bioscience-243	280	13	salivary	salivary	ADJ
bioscience-243	280	14	components	component	NOUN
bioscience-243	280	15	and	and	CCONJ
bioscience-243	280	16	their	their	PRON
bioscience-243	280	17	effect	effect	NOUN
bioscience-243	280	18	on	on	ADP
bioscience-243	280	19	the	the	DET
bioscience-243	280	20	immune	immune	ADJ
bioscience-243	280	21	response	response	NOUN
bioscience-243	280	22	to	to	ADP
bioscience-243	280	23	arboviruses	arbovirus	NOUN
bioscience-243	280	24	.	.	PUNCT
bioscience-243	281	1	frontiers	frontier	NOUN
bioscience-243	281	2	in	in	ADP
bioscience-243	281	3	cellular	cellular	ADJ
bioscience-243	281	4	and	and	CCONJ
bioscience-243	281	5	infection	infection	NOUN
bioscience-243	281	6	microbiology	microbiology	NOUN
bioscience-243	281	7	.	.	PUNCT
bioscience-243	282	1	2020;10:407	2020;10:407	X
bioscience-243	282	2	.	.	PROPN
bioscience-243	282	3	4	4	X
bioscience-243	282	4	.	.	X
bioscience-243	282	5	barros	barros	PROPN
bioscience-243	282	6	ms	ms	PROPN
bioscience-243	282	7	,	,	PUNCT
bioscience-243	282	8	lara	lara	PROPN
bioscience-243	282	9	pg	pg	PROPN
bioscience-243	282	10	,	,	PUNCT
bioscience-243	282	11	fonseca	fonseca	PROPN
bioscience-243	282	12	mt	mt	PROPN
bioscience-243	282	13	,	,	PUNCT
bioscience-243	282	14	moretti	moretti	PROPN
bioscience-243	282	15	eh	eh	PROPN
bioscience-243	282	16	,	,	PUNCT
bioscience-243	282	17	filgueiras	filgueiras	PROPN
bioscience-243	282	18	lr	lr	PROPN
bioscience-243	282	19	,	,	PUNCT
bioscience-243	282	20	martins	martin	NOUN
bioscience-243	282	21	jo	jo	PROPN
bioscience-243	282	22	,	,	PUNCT
bioscience-243	282	23	et	et	PROPN
bioscience-243	282	24	al	al	PROPN
bioscience-243	282	25	.	.	PUNCT
bioscience-243	283	1	aedes	aedes	PROPN
bioscience-243	283	2	aegypti	aegypti	VERB
bioscience-243	283	3	saliva	saliva	NOUN
bioscience-243	283	4	impairs	impair	VERB
bioscience-243	283	5	m1associated	m1associate	VERB
bioscience-243	283	6	proinflammatory	proinflammatory	ADJ
bioscience-243	283	7	phenotype	phenotype	NOUN
bioscience-243	283	8	without	without	ADP
bioscience-243	283	9	promoting	promote	VERB
bioscience-243	283	10	or	or	CCONJ
bioscience-243	283	11	affecting	affect	VERB
bioscience-243	283	12	m2	m2	PROPN
bioscience-243	283	13	polarization	polarization	NOUN
bioscience-243	283	14	of	of	ADP
bioscience-243	283	15	murine	murine	ADJ
bioscience-243	283	16	macrophages	macrophage	NOUN
bioscience-243	283	17	.	.	PUNCT
bioscience-243	284	1	parasites	parasite	NOUN
bioscience-243	284	2	&	&	CCONJ
bioscience-243	284	3	vectors	vector	NOUN
bioscience-243	284	4	.	.	PUNCT
bioscience-243	285	1	2019;12:1	2019;12:1	NUM
bioscience-243	285	2	-	-	SYM
bioscience-243	285	3	15	15	NUM
bioscience-243	285	4	.	.	NOUN
bioscience-243	286	1	5	5	NUM
bioscience-243	286	2	.	.	X
bioscience-243	286	3	gavor	gavor	PROPN
bioscience-243	286	4	e	e	NOUN
bioscience-243	286	5	,	,	PUNCT
bioscience-243	286	6	choong	choong	PROPN
bioscience-243	286	7	yk	yk	PROPN
bioscience-243	286	8	,	,	PUNCT
bioscience-243	286	9	liu	liu	PROPN
bioscience-243	286	10	y	y	PROPN
bioscience-243	286	11	,	,	PUNCT
bioscience-243	286	12	pompon	pompon	PROPN
bioscience-243	286	13	j	j	PROPN
bioscience-243	286	14	,	,	PUNCT
bioscience-243	286	15	ooi	ooi	PROPN
bioscience-243	286	16	ee	ee	PROPN
bioscience-243	286	17	,	,	PUNCT
bioscience-243	286	18	mok	mok	PROPN
bioscience-243	286	19	yk	yk	PROPN
bioscience-243	286	20	,	,	PUNCT
bioscience-243	286	21	et	et	PROPN
bioscience-243	286	22	al	al	PROPN
bioscience-243	286	23	.	.	PUNCT
bioscience-243	286	24	identification	identification	NOUN
bioscience-243	286	25	of	of	ADP
bioscience-243	286	26	aedes	aedes	PROPN
bioscience-243	286	27	aegypti	aegypti	VERB
bioscience-243	286	28	salivary	salivary	ADJ
bioscience-243	286	29	gland	gland	NOUN
bioscience-243	286	30	proteins	protein	NOUN
bioscience-243	286	31	interacting	interact	VERB
bioscience-243	286	32	with	with	ADP
bioscience-243	286	33	human	human	ADJ
bioscience-243	286	34	immune	immune	ADJ
bioscience-243	286	35	receptor	receptor	NOUN
bioscience-243	286	36	proteins	protein	NOUN
bioscience-243	286	37	.	.	PUNCT
bioscience-243	287	1	plos	plos	PROPN
bioscience-243	287	2	neglected	neglect	VERB
bioscience-243	287	3	tropical	tropical	ADJ
bioscience-243	287	4	diseases	disease	NOUN
bioscience-243	287	5	.	.	PUNCT
bioscience-243	288	1	2022;16(9):e0010743	2022;16(9):e0010743	NUM
bioscience-243	288	2	.	.	NOUN
bioscience-243	288	3	6	6	NUM
bioscience-243	288	4	.	.	PUNCT
bioscience-243	288	5	chowdhury	chowdhury	PROPN
bioscience-243	288	6	a	a	PRON
bioscience-243	288	7	,	,	PUNCT
bioscience-243	288	8	modahl	modahl	NOUN
bioscience-243	288	9	cm	cm	PROPN
bioscience-243	288	10	,	,	PUNCT
bioscience-243	288	11	missé	missé	PROPN
bioscience-243	288	12	d	d	PROPN
bioscience-243	288	13	,	,	PUNCT
bioscience-243	288	14	kini	kini	PROPN
bioscience-243	288	15	rm	rm	PROPN
bioscience-243	288	16	,	,	PUNCT
bioscience-243	288	17	pompon	pompon	PROPN
bioscience-243	288	18	j.	j.	PROPN
bioscience-243	288	19	high	high	ADJ
bioscience-243	288	20	resolution	resolution	NOUN
bioscience-243	288	21	proteomics	proteomic	NOUN
bioscience-243	288	22	of	of	ADP
bioscience-243	288	23	aedes	aedes	PROPN
bioscience-243	288	24	aegypti	aegypti	VERB
bioscience-243	288	25	salivary	salivary	ADJ
bioscience-243	288	26	glands	gland	NOUN
bioscience-243	288	27	infected	infect	VERB
bioscience-243	288	28	with	with	ADP
bioscience-243	288	29	either	either	DET
bioscience-243	288	30	dengue	dengue	NOUN
bioscience-243	288	31	,	,	PUNCT
bioscience-243	288	32	zika	zika	X
bioscience-243	288	33	or	or	CCONJ
bioscience-243	288	34	chikungunya	chikungunya	NOUN
bioscience-243	288	35	viruses	virus	NOUN
bioscience-243	288	36	identify	identify	VERB
bioscience-243	288	37	new	new	ADJ
bioscience-243	288	38	virus	virus	NOUN
bioscience-243	288	39	specific	specific	ADJ
bioscience-243	288	40	and	and	CCONJ
bioscience-243	288	41	broad	broad	ADJ
bioscience-243	288	42	antiviral	antiviral	ADJ
bioscience-243	288	43	factors	factor	NOUN
bioscience-243	288	44	.	.	PUNCT
bioscience-243	289	1	scientific	scientific	ADJ
bioscience-243	289	2	reports	report	NOUN
bioscience-243	289	3	.	.	PUNCT
bioscience-243	290	1	2021;11(1):23696	2021;11(1):23696	X
bioscience-243	290	2	.	.	PUNCT
bioscience-243	291	1	7	7	X
bioscience-243	291	2	.	.	X
bioscience-243	291	3	mccracken	mccracken	PROPN
bioscience-243	291	4	m	m	PROPN
bioscience-243	291	5	,	,	PUNCT
bioscience-243	291	6	christofferson	christofferson	NOUN
bioscience-243	291	7	r	r	NOUN
bioscience-243	291	8	,	,	PUNCT
bioscience-243	291	9	grasperge	grasperge	NOUN
bioscience-243	291	10	b	b	NOUN
bioscience-243	291	11	,	,	PUNCT
bioscience-243	291	12	calvo	calvo	PROPN
bioscience-243	291	13	e	e	NOUN
bioscience-243	291	14	,	,	PUNCT
bioscience-243	291	15	chisenhall	chisenhall	PROPN
bioscience-243	291	16	d	d	PROPN
bioscience-243	291	17	,	,	PUNCT
bioscience-243	291	18	mores	mores	PROPN
bioscience-243	291	19	c.	c.	PROPN
bioscience-243	291	20	aedes	aedes	PROPN
bioscience-243	291	21	aegypti	aegypti	VERB
bioscience-243	291	22	salivary	salivary	ADJ
bioscience-243	291	23	protein	protein	NOUN
bioscience-243	291	24	aegyptin	aegyptin	CCONJ
bioscience-243	291	25	co	co	ADJ
bioscience-243	291	26	-	-	ADJ
bioscience-243	291	27	inoculation	inoculation	ADJ
bioscience-243	291	28	modulates	modulate	NOUN
bioscience-243	291	29	dengue	dengue	NOUN
bioscience-243	291	30	virus	virus	NOUN
bioscience-243	291	31	infection	infection	NOUN
bioscience-243	291	32	in	in	ADP
bioscience-243	291	33	the	the	DET
bioscience-243	291	34	vertebrate	vertebrate	ADJ
bioscience-243	291	35	host	host	NOUN
bioscience-243	291	36	.	.	PUNCT
bioscience-243	292	1	virology	virology	NOUN
bioscience-243	292	2	.	.	PUNCT
bioscience-243	293	1	2014;468:133	2014;468:133	NUM
bioscience-243	293	2	-	-	SYM
bioscience-243	293	3	9	9	NUM
bioscience-243	293	4	.	.	NOUN
bioscience-243	293	5	8	8	NUM
bioscience-243	293	6	.	.	X
bioscience-243	294	1	gulley	gulley	PROPN
bioscience-243	294	2	mm	mm	PROPN
bioscience-243	294	3	,	,	PUNCT
bioscience-243	294	4	zhang	zhang	PROPN
bioscience-243	294	5	x	x	PROPN
bioscience-243	294	6	,	,	PUNCT
bioscience-243	294	7	michel	michel	PROPN
bioscience-243	294	8	k.	k.	PROPN
bioscience-243	295	1	the	the	DET
bioscience-243	295	2	roles	role	NOUN
bioscience-243	295	3	of	of	ADP
bioscience-243	295	4	serpins	serpin	NOUN
bioscience-243	295	5	in	in	ADP
bioscience-243	295	6	mosquito	mosquito	ADJ
bioscience-243	295	7	immunology	immunology	NOUN
bioscience-243	295	8	and	and	CCONJ
bioscience-243	295	9	physiology	physiology	NOUN
bioscience-243	295	10	.	.	PUNCT
bioscience-243	296	1	journal	journal	PROPN
bioscience-243	296	2	of	of	ADP
bioscience-243	296	3	insect	insect	NOUN
bioscience-243	296	4	physiology	physiology	NOUN
bioscience-243	296	5	.	.	PUNCT
bioscience-243	297	1	2013;59(2):138	2013;59(2):138	NUM
bioscience-243	297	2	-	-	SYM
bioscience-243	297	3	47	47	NUM
bioscience-243	297	4	.	.	PUNCT
bioscience-243	298	1	9	9	X
bioscience-243	298	2	.	.	X
bioscience-243	298	3	alvarenga	alvarenga	PROPN
bioscience-243	298	4	ph	ph	PROPN
bioscience-243	298	5	,	,	PUNCT
bioscience-243	298	6	andersen	andersen	PROPN
bioscience-243	298	7	jf	jf	PROPN
bioscience-243	298	8	.	.	PUNCT
bioscience-243	299	1	an	an	DET
bioscience-243	299	2	overview	overview	NOUN
bioscience-243	299	3	of	of	ADP
bioscience-243	299	4	d7	d7	PROPN
bioscience-243	299	5	protein	protein	NOUN
bioscience-243	299	6	structure	structure	NOUN
bioscience-243	299	7	and	and	CCONJ
bioscience-243	299	8	physiological	physiological	ADJ
bioscience-243	299	9	roles	role	NOUN
bioscience-243	299	10	in	in	ADP
bioscience-243	299	11	blood	blood	NOUN
bioscience-243	299	12	-	-	PUNCT
bioscience-243	299	13	feeding	feed	VERB
bioscience-243	299	14	nematocera	nematocera	NOUN
bioscience-243	299	15	.	.	PUNCT
bioscience-243	300	1	biology	biology	NOUN
bioscience-243	300	2	.	.	PUNCT
bioscience-243	301	1	2022;12(1):39	2022;12(1):39	X
bioscience-243	301	2	.	.	NOUN
bioscience-243	301	3	10	10	NUM
bioscience-243	301	4	.	.	PUNCT
bioscience-243	302	1	martin	martin	PROPN
bioscience-243	302	2	-	-	PUNCT
bioscience-243	302	3	martin	martin	PROPN
bioscience-243	302	4	i	i	PROPN
bioscience-243	302	5	,	,	PUNCT
bioscience-243	302	6	smith	smith	PROPN
bioscience-243	302	7	lb	lb	PROPN
bioscience-243	302	8	,	,	PUNCT
bioscience-243	302	9	chagas	chagas	PROPN
bioscience-243	302	10	ac	ac	PROPN
bioscience-243	302	11	,	,	PUNCT
bioscience-243	302	12	sá	sá	PROPN
bioscience-243	302	13	-	-	PUNCT
bioscience-243	302	14	nunes	nunes	PROPN
bioscience-243	302	15	a	a	PRON
bioscience-243	302	16	,	,	PUNCT
bioscience-243	302	17	shrivastava	shrivastava	PROPN
bioscience-243	302	18	g	g	PROPN
bioscience-243	302	19	,	,	PUNCT
bioscience-243	302	20	valenzuela	valenzuela	PROPN
bioscience-243	302	21	-	-	PUNCT
bioscience-243	302	22	leon	leon	PROPN
bioscience-243	302	23	pc	pc	PROPN
bioscience-243	302	24	,	,	PUNCT
bioscience-243	302	25	et	et	PROPN
bioscience-243	302	26	al	al	PROPN
bioscience-243	302	27	.	.	PROPN
bioscience-243	303	1	aedes	aedes	PROPN
bioscience-243	303	2	albopictus	albopictus	PROPN
bioscience-243	303	3	d7	d7	PROPN
bioscience-243	303	4	salivary	salivary	ADJ
bioscience-243	303	5	protein	protein	NOUN
bioscience-243	303	6	prevents	prevent	VERB
bioscience-243	303	7	host	host	NOUN
bioscience-243	303	8	hemostasis	hemostasis	NOUN
bioscience-243	303	9	and	and	CCONJ
bioscience-243	303	10	inflammation	inflammation	NOUN
bioscience-243	303	11	.	.	PUNCT
bioscience-243	304	1	biomolecules	biomolecule	NOUN
bioscience-243	304	2	.	.	PUNCT
bioscience-243	305	1	2020;10(10):1372	2020;10(10):1372	NUM
bioscience-243	305	2	.	.	NOUN
bioscience-243	305	3	11	11	NUM
bioscience-243	305	4	.	.	PUNCT
bioscience-243	306	1	michael	michael	PROPN
bioscience-243	306	2	zm	zm	PROPN
bioscience-243	306	3	.	.	PUNCT
bioscience-243	307	1	obat	obat	PROPN
bioscience-243	307	2	penginduksi	penginduksi	PROPN
bioscience-243	307	3	pendarahan	pendarahan	PROPN
bioscience-243	307	4	.	.	PUNCT
bioscience-243	308	1	program	program	PROPN
bioscience-243	308	2	studi	studi	PROPN
bioscience-243	308	3	apoteker	apoteker	PROPN
bioscience-243	308	4	,	,	PUNCT
bioscience-243	308	5	fakultas	fakulta	VERB
bioscience-243	308	6	farmasi	farmasi	PROPN
bioscience-243	308	7	universitas	universitas	PROPN
bioscience-243	308	8	padjadjaran	padjadjaran	NOUN
bioscience-243	308	9	.	.	PUNCT
bioscience-243	309	1	2017	2017	NUM
bioscience-243	309	2	.	.	PUNCT
bioscience-243	310	1	12	12	NUM
bioscience-243	310	2	.	.	PUNCT
bioscience-243	311	1	prasetiawati	prasetiawati	NOUN
bioscience-243	311	2	r	r	PROPN
bioscience-243	311	3	,	,	PUNCT
bioscience-243	311	4	suherman	suherman	PROPN
bioscience-243	311	5	m	m	PROPN
bioscience-243	311	6	,	,	PUNCT
bioscience-243	311	7	permana	permana	PROPN
bioscience-243	311	8	b	b	PROPN
bioscience-243	311	9	,	,	PUNCT
bioscience-243	311	10	rahmawati	rahmawati	PROPN
bioscience-243	311	11	r.	r.	PROPN
bioscience-243	311	12	molecular	molecular	ADJ
bioscience-243	311	13	docking	docking	NOUN
bioscience-243	311	14	study	study	NOUN
bioscience-243	311	15	of	of	ADP
bioscience-243	311	16	anthocyanidin	anthocyanidin	NOUN
bioscience-243	311	17	compounds	compound	NOUN
bioscience-243	311	18	against	against	ADP
bioscience-243	311	19	epidermal	epidermal	ADJ
bioscience-243	311	20	growth	growth	NOUN
bioscience-243	311	21	factor	factor	NOUN
bioscience-243	311	22	receptor	receptor	NOUN
bioscience-243	311	23	(	(	PUNCT
bioscience-243	311	24	egfr	egfr	X
bioscience-243	311	25	)	)	PUNCT
bioscience-243	311	26	as	as	ADP
bioscience-243	311	27	antilung	antilung	NOUN
bioscience-243	311	28	cancer	cancer	NOUN
bioscience-243	311	29	.	.	PUNCT
bioscience-243	312	1	indonesian	indonesian	ADJ
bioscience-243	312	2	journal	journal	PROPN
bioscience-243	312	3	of	of	ADP
bioscience-243	312	4	pharmaceutical	pharmaceutical	NOUN
bioscience-243	312	5	science	science	NOUN
bioscience-243	312	6	and	and	CCONJ
bioscience-243	312	7	technology	technology	NOUN
bioscience-243	312	8	.	.	PUNCT
bioscience-243	313	1	2021;8(1):8	2021;8(1):8	PROPN
bioscience-243	313	2	-	-	SYM
bioscience-243	313	3	20	20	NUM
bioscience-243	313	4	.	.	NOUN
bioscience-243	313	5	13	13	NUM
bioscience-243	313	6	.	.	PUNCT
bioscience-243	314	1	wathon	wathon	PROPN
bioscience-243	314	2	s	s	NOUN
bioscience-243	314	3	,	,	PUNCT
bioscience-243	314	4	oktarianti	oktarianti	PROPN
bioscience-243	314	5	r	r	PROPN
bioscience-243	314	6	,	,	PUNCT
bioscience-243	314	7	senjarini	senjarini	NOUN
bioscience-243	314	8	k.	k.	PROPN
bioscience-243	314	9	molecular	molecular	ADJ
bioscience-243	314	10	docking	docking	NOUN
bioscience-243	314	11	of	of	ADP
bioscience-243	314	12	interaction	interaction	NOUN
bioscience-243	314	13	between	between	ADP
bioscience-243	314	14	d7	d7	PROPN
bioscience-243	314	15	protein	protein	NOUN
bioscience-243	314	16	from	from	ADP
bioscience-243	314	17	the	the	DET
bioscience-243	314	18	salivary	salivary	ADJ
bioscience-243	314	19	gland	gland	NOUN
bioscience-243	314	20	of	of	ADP
bioscience-243	314	21	aedes	aedes	PROPN
bioscience-243	314	22	aegypti	aegypti	VERB
bioscience-243	314	23	and	and	CCONJ
bioscience-243	314	24	leukotriene	leukotriene	NOUN
bioscience-243	314	25	a4	a4	NOUN
bioscience-243	314	26	for	for	ADP
bioscience-243	314	27	developing	develop	VERB
bioscience-243	314	28	thrombolytic	thrombolytic	ADJ
bioscience-243	314	29	agent	agent	NOUN
bioscience-243	314	30	.	.	PUNCT
bioscience-243	315	1	in	in	ADP
bioscience-243	315	2	:	:	PUNCT
bioscience-243	315	3	bio	bio	PROPN
bioscience-243	315	4	web	web	NOUN
bioscience-243	315	5	of	of	ADP
bioscience-243	315	6	conferences	conference	NOUN
bioscience-243	315	7	.	.	PUNCT
bioscience-243	316	1	vol	vol	NOUN
bioscience-243	316	2	.	.	PUNCT
bioscience-243	317	1	101	101	NUM
bioscience-243	317	2	.	.	PUNCT
bioscience-243	317	3	edp	edp	PROPN
bioscience-243	317	4	sciences	sciences	PROPN
bioscience-243	317	5	;	;	PUNCT
bioscience-243	317	6	2024	2024	NUM
bioscience-243	317	7	.	.	PUNCT
bioscience-243	318	1	p.	p.	NOUN
bioscience-243	318	2	04002	04002	NUM
bioscience-243	318	3	.	.	PUNCT
bioscience-243	319	1	14	14	NUM
bioscience-243	319	2	.	.	PUNCT
bioscience-243	319	3	consortium	consortium	PROPN
bioscience-243	319	4	u.	u.	PROPN
bioscience-243	319	5	uniprot	uniprot	PROPN
bioscience-243	319	6	:	:	PUNCT
bioscience-243	319	7	a	a	DET
bioscience-243	319	8	worldwide	worldwide	ADJ
bioscience-243	319	9	hub	hub	NOUN
bioscience-243	319	10	of	of	ADP
bioscience-243	319	11	protein	protein	NOUN
bioscience-243	319	12	knowledge	knowledge	NOUN
bioscience-243	319	13	.	.	PUNCT
bioscience-243	320	1	nucleic	nucleic	ADJ
bioscience-243	320	2	acids	acid	NOUN
bioscience-243	320	3	research	research	NOUN
bioscience-243	320	4	.	.	PUNCT
bioscience-243	321	1	2019;47(d1):d506	2019;47(d1):d506	NUM
bioscience-243	321	2	-	-	SYM
bioscience-243	321	3	15	15	NUM
bioscience-243	321	4	.	.	NOUN
bioscience-243	321	5	15	15	NUM
bioscience-243	321	6	.	.	PUNCT
bioscience-243	322	1	waterhouse	waterhouse	PROPN
bioscience-243	322	2	a	a	PRON
bioscience-243	322	3	,	,	PUNCT
bioscience-243	322	4	bertoni	bertoni	PROPN
bioscience-243	322	5	m	m	PROPN
bioscience-243	322	6	,	,	PUNCT
bioscience-243	322	7	bienert	bienert	PROPN
bioscience-243	322	8	s	s	PROPN
bioscience-243	322	9	,	,	PUNCT
bioscience-243	322	10	studer	studer	NOUN
bioscience-243	322	11	g	g	NOUN
bioscience-243	322	12	,	,	PUNCT
bioscience-243	322	13	tauriello	tauriello	NOUN
bioscience-243	322	14	g	g	NOUN
bioscience-243	322	15	,	,	PUNCT
bioscience-243	322	16	gumienny	gumienny	NOUN
bioscience-243	322	17	r	r	NOUN
bioscience-243	322	18	,	,	PUNCT
bioscience-243	322	19	et	et	PROPN
bioscience-243	322	20	al	al	PROPN
bioscience-243	322	21	.	.	PROPN
bioscience-243	322	22	swiss	swiss	PROPN
bioscience-243	322	23	-	-	PUNCT
bioscience-243	322	24	model	model	NOUN
bioscience-243	322	25	:	:	PUNCT
bioscience-243	322	26	homology	homology	NOUN
bioscience-243	322	27	modelling	modelling	NOUN
bioscience-243	322	28	of	of	ADP
bioscience-243	322	29	protein	protein	NOUN
bioscience-243	322	30	structures	structure	NOUN
bioscience-243	322	31	and	and	CCONJ
bioscience-243	322	32	complexes	complex	NOUN
bioscience-243	322	33	.	.	PUNCT
bioscience-243	323	1	nucleic	nucleic	ADJ
bioscience-243	323	2	acids	acid	NOUN
bioscience-243	323	3	research	research	NOUN
bioscience-243	323	4	.	.	PUNCT
bioscience-243	324	1	2018;46(w1):w296	2018;46(w1):w296	X
bioscience-243	324	2	-	-	SYM
bioscience-243	324	3	303	303	NUM
bioscience-243	324	4	.	.	PUNCT
bioscience-243	325	1	16	16	NUM
bioscience-243	325	2	.	.	PUNCT
bioscience-243	326	1	bienert	bienert	PROPN
bioscience-243	326	2	s	s	PROPN
bioscience-243	326	3	,	,	PUNCT
bioscience-243	326	4	waterhouse	waterhouse	PROPN
bioscience-243	326	5	a	a	DET
bioscience-243	326	6	,	,	PUNCT
bioscience-243	326	7	de	de	X
bioscience-243	326	8	beer	beer	NOUN
bioscience-243	326	9	ta	ta	PROPN
bioscience-243	326	10	,	,	PUNCT
bioscience-243	326	11	tauriello	tauriello	NOUN
bioscience-243	326	12	g	g	NOUN
bioscience-243	326	13	,	,	PUNCT
bioscience-243	326	14	studer	studer	NOUN
bioscience-243	326	15	g	g	NOUN
bioscience-243	326	16	,	,	PUNCT
bioscience-243	326	17	bordoli	bordoli	ADJ
bioscience-243	326	18	l	l	NOUN
bioscience-243	326	19	,	,	PUNCT
bioscience-243	326	20	et	et	PROPN
bioscience-243	326	21	al	al	PROPN
bioscience-243	326	22	.	.	PUNCT
bioscience-243	327	1	the	the	DET
bioscience-243	327	2	swiss	swiss	ADJ
bioscience-243	327	3	-	-	PUNCT
bioscience-243	327	4	model	model	NOUN
bioscience-243	327	5	repositorynew	repositorynew	NOUN
bioscience-243	327	6	features	feature	NOUN
bioscience-243	327	7	and	and	CCONJ
bioscience-243	327	8	functionality	functionality	NOUN
bioscience-243	327	9	.	.	PUNCT
bioscience-243	328	1	nucleic	nucleic	ADJ
bioscience-243	328	2	acids	acid	NOUN
bioscience-243	328	3	research	research	NOUN
bioscience-243	328	4	.	.	PUNCT
bioscience-243	329	1	2017;45(d1):d313	2017;45(d1):d313	NUM
bioscience-243	329	2	-	-	SYM
bioscience-243	329	3	9	9	NUM
bioscience-243	329	4	.	.	NUM
bioscience-243	329	5	17	17	NUM
bioscience-243	329	6	.	.	PUNCT
bioscience-243	330	1	wang	wang	PROPN
bioscience-243	330	2	y	y	PROPN
bioscience-243	330	3	,	,	PUNCT
bioscience-243	330	4	bryant	bryant	PROPN
bioscience-243	330	5	sh	sh	PROPN
bioscience-243	330	6	,	,	PUNCT
bioscience-243	330	7	cheng	cheng	PROPN
bioscience-243	330	8	t	t	PROPN
bioscience-243	330	9	,	,	PUNCT
bioscience-243	330	10	wang	wang	PROPN
bioscience-243	330	11	j	j	PROPN
bioscience-243	330	12	,	,	PUNCT
bioscience-243	330	13	gindulyte	gindulyte	PROPN
bioscience-243	330	14	a	a	PRON
bioscience-243	330	15	,	,	PUNCT
bioscience-243	330	16	shoemaker	shoemaker	PROPN
bioscience-243	330	17	ba	ba	PROPN
bioscience-243	330	18	,	,	PUNCT
bioscience-243	330	19	et	et	PROPN
bioscience-243	330	20	al	al	PROPN
bioscience-243	330	21	.	.	PROPN
bioscience-243	330	22	pubchem	pubchem	PROPN
bioscience-243	330	23	bioassay	bioassay	VERB
bioscience-243	330	24	:	:	PUNCT
bioscience-243	330	25	2017	2017	NUM
bioscience-243	330	26	update	update	NOUN
bioscience-243	330	27	.	.	PUNCT
bioscience-243	331	1	nucleic	nucleic	ADJ
bioscience-243	331	2	acids	acid	NOUN
bioscience-243	331	3	research	research	NOUN
bioscience-243	331	4	.	.	PUNCT
bioscience-243	332	1	2017;45(d1):d955	2017;45(d1):d955	X
bioscience-243	332	2	-	-	SYM
bioscience-243	332	3	63	63	NUM
bioscience-243	332	4	.	.	PUNCT
bioscience-243	332	5	18	18	NUM
bioscience-243	332	6	.	.	PUNCT
bioscience-243	333	1	morris	morris	PROPN
bioscience-243	333	2	gm	gm	PROPN
bioscience-243	333	3	,	,	PUNCT
bioscience-243	333	4	huey	huey	PROPN
bioscience-243	333	5	r	r	PROPN
bioscience-243	333	6	,	,	PUNCT
bioscience-243	333	7	lindstrom	lindstrom	PROPN
bioscience-243	333	8	w	w	PROPN
bioscience-243	333	9	,	,	PUNCT
bioscience-243	333	10	sanner	sanner	NOUN
bioscience-243	333	11	mf	mf	PROPN
bioscience-243	333	12	,	,	PUNCT
bioscience-243	333	13	belew	belew	NOUN
bioscience-243	333	14	rk	rk	PROPN
bioscience-243	333	15	,	,	PUNCT
bioscience-243	333	16	goodsell	goodsell	X
bioscience-243	333	17	ds	ds	PROPN
bioscience-243	333	18	,	,	PUNCT
bioscience-243	333	19	et	et	PROPN
bioscience-243	333	20	al	al	PROPN
bioscience-243	333	21	.	.	PUNCT
bioscience-243	334	1	autodock4	autodock4	PROPN
bioscience-243	334	2	and	and	CCONJ
bioscience-243	334	3	autodocktools4	autodocktools4	NOUN
bioscience-243	334	4	:	:	PUNCT
bioscience-243	334	5	automated	automate	VERB
bioscience-243	334	6	docking	docking	NOUN
bioscience-243	334	7	with	with	ADP
bioscience-243	334	8	selective	selective	ADJ
bioscience-243	334	9	receptor	receptor	NOUN
bioscience-243	334	10	flexibility	flexibility	NOUN
bioscience-243	334	11	.	.	PUNCT
bioscience-243	335	1	journal	journal	NOUN
bioscience-243	335	2	of	of	ADP
bioscience-243	335	3	computational	computational	ADJ
bioscience-243	335	4	chemistry	chemistry	NOUN
bioscience-243	335	5	.	.	PUNCT
bioscience-243	336	1	2009;30(16):2785	2009;30(16):2785	NUM
bioscience-243	336	2	-	-	SYM
bioscience-243	336	3	91	91	NUM
bioscience-243	336	4	.	.	PUNCT
bioscience-243	337	1	19	19	NUM
bioscience-243	337	2	.	.	PUNCT
bioscience-243	338	1	huey	huey	PROPN
bioscience-243	338	2	r	r	PROPN
bioscience-243	338	3	,	,	PUNCT
bioscience-243	338	4	morris	morris	PROPN
bioscience-243	338	5	gm	gm	PROPN
bioscience-243	338	6	,	,	PUNCT
bioscience-243	338	7	forli	forli	PROPN
bioscience-243	338	8	s	s	PROPN
bioscience-243	338	9	,	,	PUNCT
bioscience-243	338	10	et	et	PROPN
bioscience-243	338	11	al	al	PROPN
bioscience-243	338	12	.	.	PUNCT
bioscience-243	339	1	using	use	VERB
bioscience-243	339	2	autodock	autodock	NOUN
bioscience-243	339	3	4	4	NUM
bioscience-243	339	4	and	and	CCONJ
bioscience-243	339	5	autodock	autodock	PROPN
bioscience-243	339	6	vina	vina	NOUN
bioscience-243	339	7	with	with	ADP
bioscience-243	339	8	autodocktools	autodocktools	PROPN
bioscience-243	339	9	:	:	PUNCT
bioscience-243	339	10	a	a	DET
bioscience-243	339	11	tutorial	tutorial	NOUN
bioscience-243	339	12	.	.	PUNCT
bioscience-243	340	1	the	the	DET
bioscience-243	340	2	scripps	scripps	PROPN
bioscience-243	340	3	research	research	PROPN
bioscience-243	340	4	institute	institute	PROPN
bioscience-243	340	5	molecular	molecular	ADJ
bioscience-243	340	6	graphics	graphic	NOUN
bioscience-243	340	7	laboratory	laboratory	NOUN
bioscience-243	340	8	.	.	PUNCT
bioscience-243	341	1	2012;10550(92037):1000	2012;10550(92037):1000	ADJ
bioscience-243	341	2	.	.	PUNCT
bioscience-243	342	1	20	20	NUM
bioscience-243	342	2	.	.	PUNCT
bioscience-243	343	1	sari	sari	PROPN
bioscience-243	343	2	iw	iw	PROPN
bioscience-243	343	3	,	,	PUNCT
bioscience-243	343	4	junaidin	junaidin	VERB
bioscience-243	343	5	j	j	PROPN
bioscience-243	343	6	,	,	PUNCT
bioscience-243	343	7	pratiwi	pratiwi	NOUN
bioscience-243	343	8	d.	d.	PROPN
bioscience-243	343	9	studi	studi	PROPN
bioscience-243	343	10	molecular	molecular	ADJ
bioscience-243	343	11	docking	docking	NOUN
bioscience-243	343	12	senyawa	senyawa	NOUN
bioscience-243	343	13	flavonoid	flavonoid	PROPN
bioscience-243	343	14	herba	herba	PROPN
bioscience-243	343	15	kumis	kumis	PROPN
bioscience-243	343	16	kucing	kucing	PROPN
bioscience-243	343	17	(	(	PUNCT
bioscience-243	343	18	orthosiphon	orthosiphon	PROPN
bioscience-243	343	19	stamineus	stamineus	PROPN
bioscience-243	343	20	b.	b.	PROPN
bioscience-243	343	21	)	)	PUNCT
bioscience-243	344	1	pada	pada	PROPN
bioscience-243	344	2	reseptor	reseptor	PROPN
bioscience-243	344	3	a	a	PROPN
bioscience-243	344	4	-	-	PUNCT
bioscience-243	344	5	glukosidase	glukosidase	NOUN
bioscience-243	344	6	sebagai	sebagai	PROPN
bioscience-243	344	7	antidiabetes	antidiabete	VERB
bioscience-243	344	8	tipe	tipe	PROPN
bioscience-243	344	9	2	2	NUM
bioscience-243	344	10	.	.	PUNCT
bioscience-243	344	11	jurnal	jurnal	ADJ
bioscience-243	344	12	farmagazine	farmagazine	NOUN
bioscience-243	344	13	.	.	PUNCT
bioscience-243	345	1	2020;7(2):54	2020;7(2):54	NUM
bioscience-243	345	2	-	-	SYM
bioscience-243	345	3	60	60	NUM
bioscience-243	345	4	.	.	PUNCT
bioscience-243	346	1	21	21	NUM
bioscience-243	346	2	.	.	PUNCT
bioscience-243	347	1	sari	sari	PROPN
bioscience-243	347	2	iw	iw	PROPN
bioscience-243	347	3	,	,	PUNCT
bioscience-243	347	4	junaidin	junaidin	VERB
bioscience-243	347	5	j	j	PROPN
bioscience-243	347	6	,	,	PUNCT
bioscience-243	347	7	pratiwi	pratiwi	NOUN
bioscience-243	347	8	d.	d.	PROPN
bioscience-243	347	9	studi	studi	PROPN
bioscience-243	347	10	molecular	molecular	ADJ
bioscience-243	347	11	docking	docking	NOUN
bioscience-243	347	12	senyawa	senyawa	NOUN
bioscience-243	347	13	flavonoid	flavonoid	PROPN
bioscience-243	347	14	herba	herba	PROPN
bioscience-243	347	15	kumis	kumis	PROPN
bioscience-243	347	16	kucing	kucing	PROPN
bioscience-243	347	17	(	(	PUNCT
bioscience-243	347	18	orthosiphon	orthosiphon	PROPN
bioscience-243	347	19	stamineus	stamineus	PROPN
bioscience-243	347	20	b.	b.	PROPN
bioscience-243	347	21	)	)	PUNCT
bioscience-243	348	1	pada	pada	PROPN
bioscience-243	348	2	reseptor	reseptor	PROPN
bioscience-243	348	3	a	a	PROPN
bioscience-243	348	4	-	-	PUNCT
bioscience-243	348	5	glukosidase	glukosidase	NOUN
bioscience-243	348	6	sebagai	sebagai	PROPN
bioscience-243	348	7	antidiabetes	antidiabete	VERB
bioscience-243	348	8	tipe	tipe	PROPN
bioscience-243	348	9	2	2	NUM
bioscience-243	348	10	.	.	PUNCT
bioscience-243	348	11	jurnal	jurnal	ADJ
bioscience-243	348	12	farmagazine	farmagazine	NOUN
bioscience-243	348	13	.	.	PUNCT
bioscience-243	349	1	2020;7(2):54	2020;7(2):54	NUM
bioscience-243	349	2	-	-	SYM
bioscience-243	349	3	60	60	NUM
bioscience-243	349	4	.	.	PUNCT
bioscience-243	350	1	22	22	NUM
bioscience-243	350	2	.	.	PUNCT
bioscience-243	351	1	allinger	allinger	PROPN
bioscience-243	351	2	nl	nl	PROPN
bioscience-243	351	3	.	.	PUNCT
bioscience-243	351	4	conformational	conformational	ADJ
bioscience-243	351	5	analysis	analysis	NOUN
bioscience-243	351	6	.	.	PUNCT
bioscience-243	352	1	130	130	NUM
bioscience-243	352	2	.	.	PUNCT
bioscience-243	353	1	mm2	mm2	NOUN
bioscience-243	353	2	.	.	PUNCT
bioscience-243	354	1	a	a	DET
bioscience-243	354	2	hydrocarbon	hydrocarbon	NOUN
bioscience-243	354	3	force	force	NOUN
bioscience-243	354	4	field	field	NOUN
bioscience-243	354	5	utilizing	utilize	VERB
bioscience-243	354	6	v1	v1	NOUN
bioscience-243	354	7	and	and	CCONJ
bioscience-243	354	8	v2	v2	NOUN
bioscience-243	354	9	torsional	torsional	ADJ
bioscience-243	354	10	terms	term	NOUN
bioscience-243	354	11	.	.	PUNCT
bioscience-243	355	1	journal	journal	NOUN
bioscience-243	355	2	of	of	ADP
bioscience-243	355	3	the	the	DET
bioscience-243	355	4	american	american	PROPN
bioscience-243	355	5	chemical	chemical	PROPN
bioscience-243	355	6	society	society	NOUN
bioscience-243	355	7	.	.	PUNCT
bioscience-243	356	1	1977;99(25):8127	1977;99(25):8127	NUM
bioscience-243	356	2	-	-	SYM
bioscience-243	356	3	34	34	NUM
bioscience-243	356	4	.	.	PUNCT
bioscience-243	357	1	23	23	NUM
bioscience-243	357	2	.	.	PUNCT
bioscience-243	358	1	trott	trott	PROPN
bioscience-243	358	2	o	o	PROPN
bioscience-243	358	3	,	,	PUNCT
bioscience-243	358	4	olson	olson	PROPN
bioscience-243	358	5	aj	aj	PROPN
bioscience-243	358	6	.	.	PROPN
bioscience-243	358	7	autodock	autodock	PROPN
bioscience-243	358	8	vina	vina	PROPN
bioscience-243	358	9	:	:	PUNCT
bioscience-243	358	10	improving	improve	VERB
bioscience-243	358	11	the	the	DET
bioscience-243	358	12	speed	speed	NOUN
bioscience-243	358	13	and	and	CCONJ
bioscience-243	358	14	accuracy	accuracy	NOUN
bioscience-243	358	15	of	of	ADP
bioscience-243	358	16	docking	docking	NOUN
bioscience-243	358	17	with	with	ADP
bioscience-243	358	18	a	a	DET
bioscience-243	358	19	new	new	ADJ
bioscience-243	358	20	scoring	scoring	NOUN
bioscience-243	358	21	function	function	NOUN
bioscience-243	358	22	,	,	PUNCT
bioscience-243	358	23	efficient	efficient	ADJ
bioscience-243	358	24	optimization	optimization	NOUN
bioscience-243	358	25	,	,	PUNCT
bioscience-243	358	26	and	and	CCONJ
bioscience-243	358	27	multithreading	multithreade	VERB
bioscience-243	358	28	.	.	PUNCT
bioscience-243	358	29	journal	journal	NOUN
bioscience-243	358	30	of	of	ADP
bioscience-243	358	31	computational	computational	ADJ
bioscience-243	358	32	chemistry	chemistry	NOUN
bioscience-243	358	33	.	.	PUNCT
bioscience-243	359	1	2010;31(2):455	2010;31(2):455	NUM
bioscience-243	359	2	-	-	SYM
bioscience-243	359	3	61	61	NUM
bioscience-243	359	4	.	.	PUNCT
bioscience-243	360	1	24	24	NUM
bioscience-243	360	2	.	.	PUNCT
bioscience-243	361	1	endriyatno	endriyatno	PROPN
bioscience-243	361	2	nc	nc	PROPN
bioscience-243	361	3	,	,	PUNCT
bioscience-243	361	4	walid	walid	PROPN
bioscience-243	361	5	m.	m.	PROPN
bioscience-243	361	6	studi	studi	PROPN
bioscience-243	361	7	in	in	ADP
bioscience-243	361	8	silico	silico	NOUN
bioscience-243	361	9	kandungan	kandungan	NOUN
bioscience-243	361	10	senyawa	senyawa	PROPN
bioscience-243	361	11	daun	daun	PROPN
bioscience-243	361	12	srikaya	srikaya	PROPN
bioscience-243	361	13	(	(	PUNCT
bioscience-243	361	14	annona	annona	PROPN
bioscience-243	361	15	squamosa	squamosa	PROPN
bioscience-243	361	16	l.	l.	PROPN
bioscience-243	361	17	)	)	PUNCT
bioscience-243	361	18	terhadap	terhadap	PROPN
bioscience-243	361	19	protein	protein	NOUN
bioscience-243	361	20	dihydrofolate	dihydrofolate	NOUN
bioscience-243	361	21	reductase	reductase	NOUN
bioscience-243	361	22	pada	pada	PROPN
bioscience-243	361	23	mycobacterium	mycobacterium	PROPN
bioscience-243	361	24	tuberculosis	tuberculosis	NOUN
bioscience-243	361	25	.	.	PUNCT
bioscience-243	362	1	pharmacon	pharmacon	NOUN
bioscience-243	362	2	:	:	PUNCT
bioscience-243	362	3	jurnal	jurnal	PROPN
bioscience-243	362	4	farmasi	farmasi	PROPN
bioscience-243	362	5	indonesia	indonesia	PROPN
bioscience-243	362	6	.	.	PUNCT
bioscience-243	363	1	2022;19(1):8798	2022;19(1):8798	NUM
bioscience-243	363	2	.	.	PUNCT
bioscience-243	364	1	highlights	highlight	NOUN
bioscience-243	364	2	in	in	ADP
bioscience-243	364	3	bioscience	bioscience	NOUN
bioscience-243	364	4	page	page	NOUN
bioscience-243	364	5	8	8	NUM
bioscience-243	364	6	of	of	ADP
bioscience-243	364	7	9	9	NUM
bioscience-243	364	8	may	may	PROPN
bioscience-243	364	9	2025|volume	2025|volume	NUM
bioscience-243	364	10	8	8	NUM
bioscience-243	364	11	http://bioscience.highlightsin.org/	http://bioscience.highlightsin.org/	ADV
bioscience-243	364	12	oktarianti	oktarianti	INTJ
bioscience-243	365	1	r	r	NOUN
bioscience-243	365	2	et	et	NOUN
bioscience-243	365	3	al	al	PROPN
bioscience-243	365	4	.	.	PROPN
bioscience-243	365	5	,	,	PUNCT
bioscience-243	365	6	2025	2025	NUM
bioscience-243	365	7	in	in	ADP
bioscience-243	365	8	silico	silico	NOUN
bioscience-243	365	9	study	study	NOUN
bioscience-243	365	10	of	of	ADP
bioscience-243	365	11	the	the	DET
bioscience-243	365	12	interaction	interaction	NOUN
bioscience-243	365	13	between	between	ADP
bioscience-243	365	14	serotonin	serotonin	VERB
bioscience-243	365	15	and	and	CCONJ
bioscience-243	365	16	d7	d7	PROPN
bioscience-243	365	17	protein	protein	NOUN
bioscience-243	365	18	25	25	NUM
bioscience-243	365	19	.	.	PUNCT
bioscience-243	365	20	baroroh	baroroh	PROPN
bioscience-243	365	21	u	u	PROPN
bioscience-243	365	22	,	,	PUNCT
bioscience-243	365	23	biotek	biotek	PROPN
bioscience-243	365	24	m	m	PROPN
bioscience-243	365	25	,	,	PUNCT
bioscience-243	365	26	muscifa	muscifa	PROPN
bioscience-243	365	27	zs	zs	PROPN
bioscience-243	365	28	,	,	PUNCT
bioscience-243	365	29	destiarani	destiarani	PROPN
bioscience-243	365	30	w	w	PROPN
bioscience-243	365	31	,	,	PUNCT
bioscience-243	365	32	rohmatullah	rohmatullah	VERB
bioscience-243	365	33	fg	fg	PROPN
bioscience-243	365	34	,	,	PUNCT
bioscience-243	365	35	yusuf	yusuf	PROPN
bioscience-243	365	36	m.	m.	NOUN
bioscience-243	365	37	molecular	molecular	ADJ
bioscience-243	365	38	interaction	interaction	NOUN
bioscience-243	365	39	analysis	analysis	NOUN
bioscience-243	365	40	and	and	CCONJ
bioscience-243	365	41	visualization	visualization	NOUN
bioscience-243	365	42	of	of	ADP
bioscience-243	365	43	protein	protein	NOUN
bioscience-243	365	44	-	-	PUNCT
bioscience-243	365	45	ligand	ligand	NOUN
bioscience-243	365	46	docking	docking	NOUN
bioscience-243	365	47	using	use	VERB
bioscience-243	365	48	biovia	biovia	PROPN
bioscience-243	365	49	discovery	discovery	PROPN
bioscience-243	365	50	studio	studio	NOUN
bioscience-243	365	51	visualizer	visualizer	NOUN
bioscience-243	365	52	.	.	PUNCT
bioscience-243	366	1	indonesian	indonesian	ADJ
bioscience-243	366	2	journal	journal	PROPN
bioscience-243	366	3	of	of	ADP
bioscience-243	366	4	computational	computational	ADJ
bioscience-243	366	5	biology	biology	NOUN
bioscience-243	366	6	(	(	PUNCT
bioscience-243	366	7	ijcb	ijcb	NOUN
bioscience-243	366	8	)	)	PUNCT
bioscience-243	366	9	.	.	PUNCT
bioscience-243	367	1	2023;2(1):22	2023;2(1):22	NUM
bioscience-243	367	2	-	-	SYM
bioscience-243	367	3	30	30	NUM
bioscience-243	367	4	.	.	PUNCT
bioscience-243	368	1	26	26	NUM
bioscience-243	368	2	.	.	PUNCT
bioscience-243	369	1	wijaya	wijaya	PROPN
bioscience-243	369	2	h	h	PROPN
bioscience-243	369	3	,	,	PUNCT
bioscience-243	369	4	hasanah	hasanah	PROPN
bioscience-243	369	5	f.	f.	PROPN
bioscience-243	369	6	prediction	prediction	NOUN
bioscience-243	369	7	of	of	ADP
bioscience-243	369	8	three	three	NUM
bioscience-243	369	9	-	-	PUNCT
bioscience-243	369	10	dimensional	dimensional	ADJ
bioscience-243	369	11	structure	structure	NOUN
bioscience-243	369	12	from	from	ADP
bioscience-243	369	13	food	food	NOUN
bioscience-243	369	14	allergen	allergen	NOUN
bioscience-243	369	15	protein	protein	NOUN
bioscience-243	369	16	through	through	ADP
bioscience-243	369	17	homology	homology	NOUN
bioscience-243	369	18	method	method	NOUN
bioscience-243	369	19	using	use	VERB
bioscience-243	369	20	swiss	swiss	ADJ
bioscience-243	369	21	-	-	PUNCT
bioscience-243	369	22	model	model	NOUN
bioscience-243	369	23	program	program	NOUN
bioscience-243	369	24	.	.	PUNCT
bioscience-243	370	1	biopropal	biopropal	PROPN
bioscience-243	370	2	industry	industry	NOUN
bioscience-243	370	3	.	.	PUNCT
bioscience-243	371	1	2016;7(2):83	2016;7(2):83	NUM
bioscience-243	371	2	-	-	SYM
bioscience-243	371	3	94	94	NUM
bioscience-243	371	4	.	.	PUNCT
bioscience-243	372	1	27	27	NUM
bioscience-243	372	2	.	.	PUNCT
bioscience-243	373	1	ahmed	ahmed	PROPN
bioscience-243	373	2	mzs	mzs	PROPN
bioscience-243	373	3	.	.	PUNCT
bioscience-243	373	4	homology	homology	NOUN
bioscience-243	373	5	modeling	modeling	NOUN
bioscience-243	373	6	and	and	CCONJ
bioscience-243	373	7	structural	structural	ADJ
bioscience-243	373	8	analysis	analysis	NOUN
bioscience-243	373	9	of	of	ADP
bioscience-243	373	10	of	of	ADP
bioscience-243	373	11	the	the	DET
bioscience-243	373	12	flavanone	flavanone	NOUN
bioscience-243	373	13	3	3	NUM
bioscience-243	373	14	-	-	NOUN
bioscience-243	373	15	hydroxylase	hydroxylase	NOUN
bioscience-243	373	16	(	(	PUNCT
bioscience-243	373	17	f3h	f3h	PROPN
bioscience-243	373	18	)	)	PUNCT
bioscience-243	373	19	and	and	CCONJ
bioscience-243	373	20	flavonoid	flavonoid	NOUN
bioscience-243	373	21	3	3	NUM
bioscience-243	373	22	-	-	NOUN
bioscience-243	373	23	hydroxylase	hydroxylase	NOUN
bioscience-243	373	24	(	(	PUNCT
bioscience-243	373	25	f3h	f3h	NOUN
bioscience-243	373	26	)	)	PUNCT
bioscience-243	373	27	genes	gene	NOUN
bioscience-243	373	28	from	from	ADP
bioscience-243	373	29	ginkgo	ginkgo	NOUN
bioscience-243	373	30	biloba	biloba	NOUN
bioscience-243	373	31	(	(	PUNCT
bioscience-243	373	32	l.	l.	PROPN
bioscience-243	373	33	)	)	PUNCT
bioscience-243	373	34	.	.	PUNCT
bioscience-243	374	1	28	28	NUM
bioscience-243	374	2	.	.	PUNCT
bioscience-243	375	1	biasini	biasini	PROPN
bioscience-243	375	2	m	m	PROPN
bioscience-243	375	3	,	,	PUNCT
bioscience-243	375	4	bienert	bienert	PROPN
bioscience-243	375	5	s	s	PROPN
bioscience-243	375	6	,	,	PUNCT
bioscience-243	375	7	waterhouse	waterhouse	PROPN
bioscience-243	375	8	a	a	PRON
bioscience-243	375	9	,	,	PUNCT
bioscience-243	375	10	arnold	arnold	PROPN
bioscience-243	375	11	k	k	PROPN
bioscience-243	375	12	,	,	PUNCT
bioscience-243	375	13	studer	studer	NOUN
bioscience-243	375	14	g	g	PROPN
bioscience-243	375	15	,	,	PUNCT
bioscience-243	375	16	schmidt	schmidt	PROPN
bioscience-243	375	17	t	t	PROPN
bioscience-243	375	18	,	,	PUNCT
bioscience-243	375	19	et	et	PROPN
bioscience-243	375	20	al	al	PROPN
bioscience-243	375	21	.	.	PROPN
bioscience-243	375	22	swiss	swiss	PROPN
bioscience-243	375	23	-	-	PUNCT
bioscience-243	375	24	model	model	NOUN
bioscience-243	375	25	:	:	PUNCT
bioscience-243	375	26	modelling	model	VERB
bioscience-243	375	27	protein	protein	NOUN
bioscience-243	375	28	tertiary	tertiary	ADJ
bioscience-243	375	29	and	and	CCONJ
bioscience-243	375	30	quaternary	quaternary	ADJ
bioscience-243	375	31	structure	structure	NOUN
bioscience-243	375	32	using	use	VERB
bioscience-243	375	33	evolutionary	evolutionary	ADJ
bioscience-243	375	34	information	information	NOUN
bioscience-243	375	35	.	.	PUNCT
bioscience-243	376	1	nucleic	nucleic	ADJ
bioscience-243	376	2	acids	acid	NOUN
bioscience-243	376	3	research	research	NOUN
bioscience-243	376	4	.	.	PUNCT
bioscience-243	377	1	2014;42(w1):w252	2014;42(w1):w252	ADJ
bioscience-243	377	2	-	-	SYM
bioscience-243	377	3	8	8	NUM
bioscience-243	377	4	.	.	NOUN
bioscience-243	377	5	29	29	NUM
bioscience-243	377	6	.	.	PUNCT
bioscience-243	378	1	komari	komari	PROPN
bioscience-243	378	2	n	n	PROPN
bioscience-243	378	3	,	,	PUNCT
bioscience-243	378	4	hadi	hadi	PROPN
bioscience-243	378	5	s	s	PROPN
bioscience-243	378	6	,	,	PUNCT
bioscience-243	378	7	suhartono	suhartono	PROPN
bioscience-243	378	8	e.	e.	PROPN
bioscience-243	378	9	protein	protein	NOUN
bioscience-243	378	10	modeling	modeling	NOUN
bioscience-243	378	11	with	with	ADP
bioscience-243	378	12	homology	homology	NOUN
bioscience-243	378	13	modeling	modeling	NOUN
bioscience-243	378	14	using	use	VERB
bioscience-243	378	15	swiss	swiss	ADJ
bioscience-243	378	16	-	-	PUNCT
bioscience-243	378	17	model	model	NOUN
bioscience-243	378	18	:	:	PUNCT
bioscience-243	378	19	protein	protein	NOUN
bioscience-243	378	20	modeling	modeling	NOUN
bioscience-243	378	21	with	with	ADP
bioscience-243	378	22	homology	homology	NOUN
bioscience-243	378	23	modeling	modeling	NOUN
bioscience-243	378	24	using	use	VERB
bioscience-243	378	25	swiss	swiss	ADJ
bioscience-243	378	26	-	-	PUNCT
bioscience-243	378	27	model	model	NOUN
bioscience-243	378	28	.	.	PUNCT
bioscience-243	379	1	journal	journal	PROPN
bioscience-243	379	2	of	of	ADP
bioscience-243	379	3	mathematics	mathematics	PROPN
bioscience-243	379	4	and	and	CCONJ
bioscience-243	379	5	science	science	NOUN
bioscience-243	379	6	network	network	NOUN
bioscience-243	379	7	.	.	PUNCT
bioscience-243	380	1	2020;2(2):65	2020;2(2):65	NUM
bioscience-243	380	2	-	-	SYM
bioscience-243	380	3	70	70	NUM
bioscience-243	380	4	.	.	PUNCT
bioscience-243	381	1	30	30	NUM
bioscience-243	381	2	.	.	PUNCT
bioscience-243	382	1	kanduc	kanduc	PROPN
bioscience-243	382	2	d.	d.	PROPN
bioscience-243	382	3	homology	homology	PROPN
bioscience-243	382	4	,	,	PUNCT
bioscience-243	382	5	similarity	similarity	NOUN
bioscience-243	382	6	,	,	PUNCT
bioscience-243	382	7	and	and	CCONJ
bioscience-243	382	8	identity	identity	NOUN
bioscience-243	382	9	in	in	ADP
bioscience-243	382	10	peptide	peptide	ADJ
bioscience-243	382	11	epitope	epitope	PROPN
bioscience-243	382	12	immunodefinition	immunodefinition	NOUN
bioscience-243	382	13	.	.	PUNCT
bioscience-243	383	1	journal	journal	PROPN
bioscience-243	383	2	of	of	ADP
bioscience-243	383	3	peptide	peptide	ADJ
bioscience-243	383	4	science	science	NOUN
bioscience-243	383	5	.	.	PUNCT
bioscience-243	384	1	2012;18(8):487	2012;18(8):487	NUM
bioscience-243	384	2	-	-	SYM
bioscience-243	384	3	94	94	NUM
bioscience-243	384	4	.	.	PUNCT
bioscience-243	385	1	31	31	NUM
bioscience-243	385	2	.	.	PUNCT
bioscience-243	386	1	wu	wu	PROPN
bioscience-243	386	2	f	f	PROPN
bioscience-243	386	3	,	,	PUNCT
bioscience-243	386	4	liang	liang	PROPN
bioscience-243	386	5	t	t	PROPN
bioscience-243	386	6	,	,	PUNCT
bioscience-243	386	7	xiao	xiao	PROPN
bioscience-243	386	8	w	w	PROPN
bioscience-243	386	9	,	,	PUNCT
bioscience-243	386	10	wang	wang	PROPN
bioscience-243	386	11	t.	t.	PROPN
bioscience-243	386	12	norepinephrine	norepinephrine	NOUN
bioscience-243	386	13	in	in	ADP
bioscience-243	386	14	goaldirected	goaldirecte	VERB
bioscience-243	386	15	fluid	fluid	NOUN
bioscience-243	386	16	therapy	therapy	NOUN
bioscience-243	386	17	during	during	ADP
bioscience-243	386	18	general	general	ADJ
bioscience-243	386	19	anesthesia	anesthesia	PROPN
bioscience-243	386	20	in	in	ADP
bioscience-243	386	21	elderly	elderly	ADJ
bioscience-243	386	22	patients	patient	NOUN
bioscience-243	386	23	undergoing	undergo	VERB
bioscience-243	386	24	spinal	spinal	ADJ
bioscience-243	386	25	operation	operation	NOUN
bioscience-243	386	26	:	:	PUNCT
bioscience-243	386	27	determining	determine	VERB
bioscience-243	386	28	effective	effective	ADJ
bioscience-243	386	29	infusion	infusion	NOUN
bioscience-243	386	30	rate	rate	NOUN
bioscience-243	386	31	to	to	PART
bioscience-243	386	32	enhance	enhance	VERB
bioscience-243	386	33	postoperative	postoperative	ADJ
bioscience-243	386	34	functions	function	NOUN
bioscience-243	386	35	.	.	PUNCT
bioscience-243	387	1	current	current	ADJ
bioscience-243	387	2	genomics	genomic	NOUN
bioscience-243	387	3	.	.	PUNCT
bioscience-243	388	1	2021;22(8):620	2021;22(8):620	NOUN
bioscience-243	388	2	-	-	SYM
bioscience-243	388	3	9	9	NUM
bioscience-243	388	4	.	.	NOUN
bioscience-243	388	5	32	32	NUM
bioscience-243	388	6	.	.	PUNCT
bioscience-243	389	1	angles	angle	NOUN
bioscience-243	389	2	r	r	NOUN
bioscience-243	389	3	,	,	PUNCT
bioscience-243	389	4	arenas	arena	NOUN
bioscience-243	389	5	-	-	PUNCT
bioscience-243	389	6	salinas	salinas	PROPN
bioscience-243	389	7	m	m	PROPN
bioscience-243	389	8	,	,	PUNCT
bioscience-243	389	9	garcía	garcía	ADJ
bioscience-243	389	10	r	r	NOUN
bioscience-243	389	11	,	,	PUNCT
bioscience-243	389	12	ingram	ingram	PROPN
bioscience-243	389	13	b.	b.	PROPN
bioscience-243	390	1	an	an	DET
bioscience-243	390	2	optimized	optimize	VERB
bioscience-243	390	3	relational	relational	ADJ
bioscience-243	390	4	database	database	NOUN
bioscience-243	390	5	for	for	ADP
bioscience-243	390	6	querying	query	VERB
bioscience-243	390	7	structural	structural	ADJ
bioscience-243	390	8	patterns	pattern	NOUN
bioscience-243	390	9	in	in	ADP
bioscience-243	390	10	proteins	protein	NOUN
bioscience-243	390	11	.	.	PUNCT
bioscience-243	391	1	database	database	NOUN
bioscience-243	391	2	.	.	PUNCT
bioscience-243	392	1	2024;2024	2024;2024	NUM
bioscience-243	392	2	:	:	PUNCT
bioscience-243	392	3	baad093	baad093	PROPN
bioscience-243	392	4	.	.	PUNCT
bioscience-243	393	1	33	33	NUM
bioscience-243	393	2	.	.	PUNCT
bioscience-243	394	1	aziz	aziz	PROPN
bioscience-243	394	2	a	a	PROPN
bioscience-243	394	3	,	,	PUNCT
bioscience-243	394	4	andrianto	andrianto	NOUN
bioscience-243	394	5	d	d	PROPN
bioscience-243	394	6	,	,	PUNCT
bioscience-243	394	7	safithri	safithri	PROPN
bioscience-243	394	8	m.	m.	NOUN
bioscience-243	394	9	penambatan	penambatan	PROPN
bioscience-243	394	10	molekuler	molekuler	NOUN
bioscience-243	394	11	senyawa	senyawa	NOUN
bioscience-243	394	12	bioaktif	bioaktif	PROPN
bioscience-243	394	13	daun	daun	PROPN
bioscience-243	394	14	wungu	wungu	PROPN
bioscience-243	395	1	(	(	PUNCT
bioscience-243	395	2	graptophyllum	graptophyllum	PROPN
bioscience-243	395	3	pictum	pictum	PROPN
bioscience-243	395	4	(	(	PUNCT
bioscience-243	395	5	l	l	NOUN
bioscience-243	395	6	)	)	PUNCT
bioscience-243	395	7	griff	griff	PROPN
bioscience-243	395	8	)	)	PUNCT
bioscience-243	395	9	sebagai	sebagai	PROPN
bioscience-243	395	10	inhibitor	inhibitor	PROPN
bioscience-243	395	11	tirosinase	tirosinase	NOUN
bioscience-243	395	12	.	.	PUNCT
bioscience-243	396	1	indonesian	indonesian	ADJ
bioscience-243	396	2	journal	journal	PROPN
bioscience-243	396	3	of	of	ADP
bioscience-243	396	4	pharmaceutical	pharmaceutical	NOUN
bioscience-243	396	5	science	science	NOUN
bioscience-243	396	6	and	and	CCONJ
bioscience-243	396	7	technology	technology	NOUN
bioscience-243	396	8	.	.	PUNCT
bioscience-243	397	1	2022;9(2):96	2022;9(2):96	NUM
bioscience-243	397	2	-	-	SYM
bioscience-243	397	3	107	107	NUM
bioscience-243	397	4	.	.	PUNCT
bioscience-243	398	1	34	34	NUM
bioscience-243	398	2	.	.	PUNCT
bioscience-243	399	1	marcinkowska	marcinkowska	PROPN
bioscience-243	399	2	m	m	PROPN
bioscience-243	399	3	,	,	PUNCT
bioscience-243	399	4	kubacka	kubacka	PROPN
bioscience-243	399	5	m	m	PROPN
bioscience-243	399	6	,	,	PUNCT
bioscience-243	399	7	zagorska	zagorska	PROPN
bioscience-243	399	8	a	a	PRON
bioscience-243	399	9	,	,	PUNCT
bioscience-243	399	10	jaromin	jaromin	NOUN
bioscience-243	399	11	a	a	DET
bioscience-243	399	12	,	,	PUNCT
bioscience-243	399	13	fajkis	fajkis	ADJ
bioscience-243	399	14	-	-	PUNCT
bioscience-243	399	15	zajaczkowska	zajaczkowska	PROPN
bioscience-243	399	16	n	n	CCONJ
bioscience-243	399	17	,	,	PUNCT
bioscience-243	399	18	kolaczkowski	kolaczkowski	ADJ
bioscience-243	399	19	m.	m.	PROPN
bioscience-243	399	20	exploring	explore	VERB
bioscience-243	399	21	the	the	DET
bioscience-243	399	22	antiplatelet	antiplatelet	ADJ
bioscience-243	399	23	activity	activity	NOUN
bioscience-243	399	24	of	of	ADP
bioscience-243	399	25	serotonin	serotonin	VERB
bioscience-243	399	26	5	5	NUM
bioscience-243	399	27	-	-	PUNCT
bioscience-243	399	28	ht2a	ht2a	NOUN
bioscience-243	399	29	receptor	receptor	NOUN
bioscience-243	399	30	antagonists	antagonist	NOUN
bioscience-243	399	31	bearing	bear	VERB
bioscience-243	399	32	6	6	NUM
bioscience-243	399	33	-	-	PUNCT
bioscience-243	399	34	fluorobenzo	fluorobenzo	NOUN
bioscience-243	400	1	[	[	X
bioscience-243	400	2	d	d	X
bioscience-243	400	3	]	]	X
bioscience-243	400	4	isoxazol-3	isoxazol-3	NUM
bioscience-243	400	5	-	-	PUNCT
bioscience-243	400	6	yl	yl	NOUN
bioscience-243	400	7	)	)	PUNCT
bioscience-243	400	8	propyl	propyl	NOUN
bioscience-243	400	9	)	)	PUNCT
bioscience-243	400	10	motif	motif	NOUN
bioscience-243	400	11	–	–	PUNCT
bioscience-243	400	12	as	as	ADP
bioscience-243	400	13	potential	potential	ADJ
bioscience-243	400	14	therapeutic	therapeutic	ADJ
bioscience-243	400	15	agents	agent	NOUN
bioscience-243	400	16	in	in	ADP
bioscience-243	400	17	the	the	DET
bioscience-243	400	18	prevention	prevention	NOUN
bioscience-243	400	19	of	of	ADP
bioscience-243	400	20	cardiovascular	cardiovascular	ADJ
bioscience-243	400	21	diseases	disease	NOUN
bioscience-243	400	22	.	.	PUNCT
bioscience-243	401	1	biomedicine	biomedicine	NOUN
bioscience-243	401	2	&	&	CCONJ
bioscience-243	401	3	pharmacotherapy	pharmacotherapy	NOUN
bioscience-243	401	4	.	.	PUNCT
bioscience-243	402	1	2022;145:112424	2022;145:112424	NUM
bioscience-243	402	2	.	.	PUNCT
bioscience-243	403	1	35	35	NUM
bioscience-243	403	2	.	.	PUNCT
bioscience-243	404	1	yang	yang	PROPN
bioscience-243	404	2	d	d	PROPN
bioscience-243	404	3	,	,	PUNCT
bioscience-243	404	4	gouaux	gouaux	PROPN
bioscience-243	404	5	e.	e.	PROPN
bioscience-243	404	6	illumination	illumination	PROPN
bioscience-243	404	7	of	of	ADP
bioscience-243	404	8	serotonin	serotonin	NOUN
bioscience-243	404	9	transporter	transporter	NOUN
bioscience-243	404	10	mechanism	mechanism	NOUN
bioscience-243	404	11	and	and	CCONJ
bioscience-243	404	12	role	role	NOUN
bioscience-243	404	13	of	of	ADP
bioscience-243	404	14	the	the	DET
bioscience-243	404	15	allosteric	allosteric	ADJ
bioscience-243	404	16	site	site	NOUN
bioscience-243	404	17	.	.	PUNCT
bioscience-243	405	1	science	science	NOUN
bioscience-243	405	2	advances	advance	NOUN
bioscience-243	405	3	.	.	PUNCT
bioscience-243	406	1	2021;7(49):eabl3857	2021;7(49):eabl3857	X
bioscience-243	406	2	.	.	PUNCT
bioscience-243	407	1	36	36	NUM
bioscience-243	407	2	.	.	PUNCT
bioscience-243	408	1	kim	kim	PROPN
bioscience-243	408	2	s	s	PROPN
bioscience-243	408	3	,	,	PUNCT
bioscience-243	408	4	chen	chen	PROPN
bioscience-243	408	5	j	j	PROPN
bioscience-243	408	6	,	,	PUNCT
bioscience-243	408	7	cheng	cheng	PROPN
bioscience-243	408	8	t	t	PROPN
bioscience-243	408	9	,	,	PUNCT
bioscience-243	408	10	gindulyte	gindulyte	PROPN
bioscience-243	408	11	a	a	X
bioscience-243	408	12	,	,	PUNCT
bioscience-243	408	13	he	he	PRON
bioscience-243	408	14	j	j	PROPN
bioscience-243	408	15	,	,	PUNCT
bioscience-243	408	16	he	he	PRON
bioscience-243	408	17	s	s	PART
bioscience-243	408	18	,	,	PUNCT
bioscience-243	408	19	et	et	PROPN
bioscience-243	408	20	al	al	PROPN
bioscience-243	408	21	.	.	PUNCT
bioscience-243	408	22	pubchem	pubchem	NOUN
bioscience-243	408	23	2023	2023	NUM
bioscience-243	408	24	update	update	NOUN
bioscience-243	408	25	.	.	PUNCT
bioscience-243	409	1	nucleic	nucleic	ADJ
bioscience-243	409	2	acids	acid	NOUN
bioscience-243	409	3	research	research	NOUN
bioscience-243	409	4	.	.	PUNCT
bioscience-243	410	1	2023;51(d1):d1373	2023;51(d1):d1373	NUM
bioscience-243	410	2	-	-	SYM
bioscience-243	410	3	80	80	NUM
bioscience-243	410	4	.	.	PUNCT
bioscience-243	411	1	37	37	NUM
bioscience-243	411	2	.	.	PUNCT
bioscience-243	412	1	attique	attique	PROPN
bioscience-243	412	2	sa	sa	PROPN
bioscience-243	412	3	,	,	PUNCT
bioscience-243	412	4	hassan	hassan	PROPN
bioscience-243	412	5	m	m	PROPN
bioscience-243	412	6	,	,	PUNCT
bioscience-243	412	7	usman	usman	PROPN
bioscience-243	412	8	m	m	PROPN
bioscience-243	412	9	,	,	PUNCT
bioscience-243	412	10	atif	atif	PROPN
bioscience-243	412	11	rm	rm	PROPN
bioscience-243	412	12	,	,	PUNCT
bioscience-243	412	13	mahboob	mahboob	PROPN
bioscience-243	412	14	s	s	PROPN
bioscience-243	412	15	,	,	PUNCT
bioscience-243	412	16	al	al	PROPN
bioscience-243	412	17	-	-	PUNCT
bioscience-243	412	18	ghanim	ghanim	PROPN
bioscience-243	412	19	ka	ka	PROPN
bioscience-243	412	20	,	,	PUNCT
bioscience-243	412	21	et	et	PROPN
bioscience-243	412	22	al	al	PROPN
bioscience-243	412	23	.	.	PUNCT
bioscience-243	413	1	a	a	DET
bioscience-243	413	2	molecular	molecular	ADJ
bioscience-243	413	3	docking	docking	NOUN
bioscience-243	413	4	approach	approach	NOUN
bioscience-243	413	5	to	to	PART
bioscience-243	413	6	evaluate	evaluate	VERB
bioscience-243	413	7	the	the	DET
bioscience-243	413	8	pharmacological	pharmacological	ADJ
bioscience-243	413	9	properties	property	NOUN
bioscience-243	413	10	of	of	ADP
bioscience-243	413	11	natural	natural	ADJ
bioscience-243	413	12	and	and	CCONJ
bioscience-243	413	13	synthetic	synthetic	ADJ
bioscience-243	413	14	treatment	treatment	NOUN
bioscience-243	413	15	candidates	candidate	NOUN
bioscience-243	413	16	for	for	ADP
bioscience-243	413	17	use	use	NOUN
bioscience-243	413	18	against	against	ADP
bioscience-243	413	19	hypertension	hypertension	NOUN
bioscience-243	413	20	.	.	PUNCT
bioscience-243	414	1	international	international	ADJ
bioscience-243	414	2	journal	journal	PROPN
bioscience-243	414	3	of	of	ADP
bioscience-243	414	4	environmental	environmental	ADJ
bioscience-243	414	5	research	research	NOUN
bioscience-243	414	6	and	and	CCONJ
bioscience-243	414	7	public	public	ADJ
bioscience-243	414	8	health	health	NOUN
bioscience-243	414	9	.	.	PUNCT
bioscience-243	415	1	2019;16(6):923	2019;16(6):923	NUM
bioscience-243	415	2	.	.	PUNCT
bioscience-243	416	1	38	38	NUM
bioscience-243	416	2	.	.	PUNCT
bioscience-243	416	3	ferencz	ferencz	PROPN
bioscience-243	416	4	l	l	PROPN
bioscience-243	416	5	,	,	PUNCT
bioscience-243	416	6	muntean	muntean	PROPN
bioscience-243	416	7	dl	dl	PROPN
bioscience-243	416	8	.	.	PROPN
bioscience-243	416	9	identification	identification	NOUN
bioscience-243	416	10	of	of	ADP
bioscience-243	416	11	new	new	ADJ
bioscience-243	416	12	superwarfarintype	superwarfarintype	NOUN
bioscience-243	416	13	rodenticides	rodenticide	NOUN
bioscience-243	416	14	by	by	ADP
bioscience-243	416	15	structural	structural	ADJ
bioscience-243	416	16	similarity	similarity	NOUN
bioscience-243	416	17	.	.	PUNCT
bioscience-243	417	1	the	the	DET
bioscience-243	417	2	docking	docking	NOUN
bioscience-243	417	3	of	of	ADP
bioscience-243	417	4	ligands	ligand	NOUN
bioscience-243	417	5	on	on	ADP
bioscience-243	417	6	the	the	DET
bioscience-243	417	7	vitamin	vitamin	NOUN
bioscience-243	417	8	k	k	X
bioscience-243	417	9	epoxide	epoxide	NOUN
bioscience-243	417	10	reductase	reductase	NOUN
bioscience-243	417	11	enzymes	enzyme	VERB
bioscience-243	417	12	active	active	ADJ
bioscience-243	417	13	site	site	NOUN
bioscience-243	417	14	.	.	PUNCT
bioscience-243	418	1	acta	acta	PROPN
bioscience-243	418	2	universitatis	universitatis	PROPN
bioscience-243	418	3	sapientiae	sapientiae	PROPN
bioscience-243	418	4	,	,	PUNCT
bioscience-243	418	5	agriculture	agriculture	NOUN
bioscience-243	418	6	and	and	CCONJ
bioscience-243	418	7	environment	environment	NOUN
bioscience-243	418	8	.	.	PUNCT
bioscience-243	419	1	2015;7(1):108	2015;7(1):108	NUM
bioscience-243	419	2	-	-	SYM
bioscience-243	419	3	22	22	NUM
bioscience-243	419	4	.	.	PUNCT
bioscience-243	420	1	39	39	NUM
bioscience-243	420	2	.	.	PUNCT
bioscience-243	421	1	morris	morris	PROPN
bioscience-243	421	2	gm	gm	PROPN
bioscience-243	421	3	,	,	PUNCT
bioscience-243	421	4	goodsell	goodsell	X
bioscience-243	421	5	ds	ds	ADJ
bioscience-243	421	6	,	,	PUNCT
bioscience-243	421	7	pique	pique	NOUN
bioscience-243	421	8	me	i	PRON
bioscience-243	421	9	,	,	PUNCT
bioscience-243	421	10	huey	huey	PROPN
bioscience-243	421	11	r	r	PROPN
bioscience-243	421	12	,	,	PUNCT
bioscience-243	421	13	hart	hart	PROPN
bioscience-243	421	14	we	we	PRON
bioscience-243	421	15	,	,	PUNCT
bioscience-243	421	16	halliday	halliday	PROPN
bioscience-243	421	17	s	s	PROPN
bioscience-243	421	18	,	,	PUNCT
bioscience-243	421	19	et	et	PROPN
bioscience-243	421	20	al	al	PROPN
bioscience-243	421	21	..	..	PUNCT
bioscience-243	421	22	autodock	autodock	PROPN
bioscience-243	421	23	version	version	NOUN
bioscience-243	421	24	4.2	4.2	NUM
bioscience-243	421	25	:	:	PUNCT
bioscience-243	421	26	updated	update	VERB
bioscience-243	421	27	for	for	ADP
bioscience-243	421	28	version	version	NOUN
bioscience-243	421	29	4.2.6	4.2.6	PROPN
bioscience-243	421	30	.	.	PUNCT
bioscience-243	422	1	automated	automate	VERB
bioscience-243	422	2	docking	docking	NOUN
bioscience-243	422	3	of	of	ADP
bioscience-243	422	4	flexible	flexible	ADJ
bioscience-243	422	5	ligands	ligand	NOUN
bioscience-243	422	6	to	to	ADP
bioscience-243	422	7	flexible	flexible	ADJ
bioscience-243	422	8	receptors	receptor	NOUN
bioscience-243	422	9	;	;	PUNCT
bioscience-243	422	10	2014	2014	NUM
bioscience-243	422	11	.	.	PUNCT
bioscience-243	423	1	the	the	DET
bioscience-243	423	2	scripps	scripps	PROPN
bioscience-243	423	3	research	research	PROPN
bioscience-243	423	4	institute	institute	PROPN
bioscience-243	423	5	,	,	PUNCT
bioscience-243	423	6	la	la	PROPN
bioscience-243	423	7	jolla	jolla	PROPN
bioscience-243	423	8	,	,	PUNCT
bioscience-243	423	9	ca	ca	PROPN
bioscience-243	423	10	,	,	PUNCT
bioscience-243	423	11	usa	usa	PROPN
bioscience-243	423	12	.	.	PROPN
bioscience-243	423	13	40	40	NUM
bioscience-243	423	14	.	.	PUNCT
bioscience-243	424	1	khan	khan	PROPN
bioscience-243	424	2	t	t	PROPN
bioscience-243	424	3	,	,	PUNCT
bioscience-243	424	4	lawrence	lawrence	PROPN
bioscience-243	424	5	aj	aj	PROPN
bioscience-243	424	6	,	,	PUNCT
bioscience-243	424	7	azad	azad	PROPN
bioscience-243	424	8	i	i	PROPN
bioscience-243	424	9	,	,	PUNCT
bioscience-243	424	10	raza	raza	PROPN
bioscience-243	424	11	s	s	PROPN
bioscience-243	424	12	,	,	PUNCT
bioscience-243	424	13	khan	khan	PROPN
bioscience-243	424	14	ar	ar	PROPN
bioscience-243	424	15	.	.	PROPN
bioscience-243	424	16	molecular	molecular	ADJ
bioscience-243	424	17	docking	docking	NOUN
bioscience-243	424	18	simulation	simulation	NOUN
bioscience-243	424	19	with	with	ADP
bioscience-243	424	20	special	special	ADJ
bioscience-243	424	21	reference	reference	NOUN
bioscience-243	424	22	to	to	ADP
bioscience-243	424	23	flexible	flexible	ADJ
bioscience-243	424	24	docking	docking	NOUN
bioscience-243	424	25	approach	approach	NOUN
bioscience-243	424	26	.	.	PUNCT
bioscience-243	425	1	jsm	jsm	PROPN
bioscience-243	425	2	chemistry	chemistry	NOUN
bioscience-243	425	3	.	.	PUNCT
bioscience-243	426	1	2018;6(1):1	2018;6(1):1	NUM
bioscience-243	426	2	-	-	SYM
bioscience-243	426	3	5	5	NUM
bioscience-243	426	4	.	.	NOUN
bioscience-243	426	5	41	41	NUM
bioscience-243	426	6	.	.	PUNCT
bioscience-243	427	1	jiménez	jiménez	PROPN
bioscience-243	427	2	js	js	PROPN
bioscience-243	427	3	,	,	PUNCT
bioscience-243	427	4	benítez	benítez	PROPN
bioscience-243	427	5	mj	mj	PROPN
bioscience-243	427	6	.	.	PUNCT
bioscience-243	428	1	gibbs	gibbs	PROPN
bioscience-243	428	2	free	free	ADJ
bioscience-243	428	3	energy	energy	NOUN
bioscience-243	428	4	and	and	CCONJ
bioscience-243	428	5	enthalpy	enthalpy	NOUN
bioscience-243	428	6	–	–	PUNCT
bioscience-243	428	7	entropy	entropy	PROPN
bioscience-243	428	8	compensation	compensation	NOUN
bioscience-243	428	9	in	in	ADP
bioscience-243	428	10	protein	protein	NOUN
bioscience-243	428	11	–	–	PUNCT
bioscience-243	428	12	ligand	ligand	NOUN
bioscience-243	428	13	interactions	interaction	NOUN
bioscience-243	428	14	.	.	PUNCT
bioscience-243	429	1	biophysica	biophysica	PROPN
bioscience-243	429	2	.	.	PUNCT
bioscience-243	430	1	2024;4(2):298	2024;4(2):298	NUM
bioscience-243	430	2	-	-	SYM
bioscience-243	430	3	309	309	NUM
bioscience-243	430	4	.	.	PUNCT
bioscience-243	431	1	42	42	NUM
bioscience-243	431	2	.	.	PUNCT
bioscience-243	432	1	choma	choma	PROPN
bioscience-243	433	1	ct	ct	PROPN
bioscience-243	433	2	.	.	PUNCT
bioscience-243	434	1	characterizing	characterize	VERB
bioscience-243	434	2	binding	bind	VERB
bioscience-243	434	3	interactions	interaction	NOUN
bioscience-243	434	4	by	by	ADP
bioscience-243	434	5	itc	itc	PROPN
bioscience-243	434	6	;	;	PUNCT
bioscience-243	434	7	2006	2006	NUM
bioscience-243	434	8	.	.	PUNCT
bioscience-243	435	1	document	document	NOUN
bioscience-243	435	2	no	no	INTJ
bioscience-243	435	3	.	.	NOUN
bioscience-243	435	4	10111020706	10111020706	NUM
bioscience-243	435	5	.	.	PUNCT
bioscience-243	436	1	43	43	NUM
bioscience-243	436	2	.	.	PUNCT
bioscience-243	437	1	forouzesh	forouzesh	PROPN
bioscience-243	437	2	n	n	CCONJ
bioscience-243	437	3	,	,	PUNCT
bioscience-243	437	4	mishra	mishra	PROPN
bioscience-243	437	5	n.	n.	PROPN
bioscience-243	437	6	an	an	DET
bioscience-243	437	7	effective	effective	ADJ
bioscience-243	437	8	mm	mm	PROPN
bioscience-243	437	9	/	/	SYM
bioscience-243	437	10	gbsa	gbsa	ADJ
bioscience-243	437	11	protocol	protocol	NOUN
bioscience-243	437	12	for	for	ADP
bioscience-243	437	13	absolute	absolute	ADJ
bioscience-243	437	14	binding	binding	ADJ
bioscience-243	437	15	free	free	ADJ
bioscience-243	437	16	energy	energy	NOUN
bioscience-243	437	17	calculations	calculation	NOUN
bioscience-243	437	18	:	:	PUNCT
bioscience-243	437	19	a	a	DET
bioscience-243	437	20	case	case	NOUN
bioscience-243	437	21	study	study	NOUN
bioscience-243	437	22	on	on	ADP
bioscience-243	437	23	sars	sar	NOUN
bioscience-243	437	24	-	-	PUNCT
bioscience-243	437	25	cov-2	cov-2	NOUN
bioscience-243	437	26	spike	spike	ADJ
bioscience-243	437	27	protein	protein	NOUN
bioscience-243	437	28	and	and	CCONJ
bioscience-243	437	29	the	the	DET
bioscience-243	437	30	human	human	ADJ
bioscience-243	437	31	ace2	ace2	NOUN
bioscience-243	437	32	receptor	receptor	NOUN
bioscience-243	437	33	.	.	PUNCT
bioscience-243	438	1	molecules	molecule	NOUN
bioscience-243	438	2	.	.	PUNCT
bioscience-243	439	1	2021;26(8):2383	2021;26(8):2383	NUM
bioscience-243	439	2	.	.	PUNCT
bioscience-243	440	1	44	44	NUM
bioscience-243	440	2	.	.	PUNCT
bioscience-243	441	1	du	du	PROPN
bioscience-243	441	2	x	x	PROPN
bioscience-243	441	3	,	,	PUNCT
bioscience-243	441	4	li	li	PROPN
bioscience-243	441	5	y	y	PROPN
bioscience-243	441	6	,	,	PUNCT
bioscience-243	441	7	xia	xia	PROPN
bioscience-243	441	8	yl	yl	NOUN
bioscience-243	441	9	,	,	PUNCT
bioscience-243	441	10	ai	ai	VERB
bioscience-243	441	11	sm	sm	PROPN
bioscience-243	441	12	,	,	PUNCT
bioscience-243	441	13	liang	liang	PROPN
bioscience-243	441	14	j	j	PROPN
bioscience-243	441	15	,	,	PUNCT
bioscience-243	441	16	sang	sing	VERB
bioscience-243	441	17	p	p	PRON
bioscience-243	441	18	,	,	PUNCT
bioscience-243	441	19	et	et	PROPN
bioscience-243	441	20	al	al	PROPN
bioscience-243	441	21	.	.	PUNCT
bioscience-243	442	1	insights	insight	NOUN
bioscience-243	442	2	into	into	ADP
bioscience-243	442	3	protein	protein	NOUN
bioscience-243	442	4	–	–	PUNCT
bioscience-243	442	5	ligand	ligand	NOUN
bioscience-243	442	6	interactions	interaction	NOUN
bioscience-243	442	7	:	:	PUNCT
bioscience-243	442	8	mechanisms	mechanism	NOUN
bioscience-243	442	9	,	,	PUNCT
bioscience-243	442	10	models	model	NOUN
bioscience-243	442	11	,	,	PUNCT
bioscience-243	442	12	and	and	CCONJ
bioscience-243	442	13	methods	method	NOUN
bioscience-243	442	14	.	.	PUNCT
bioscience-243	443	1	international	international	ADJ
bioscience-243	443	2	journal	journal	NOUN
bioscience-243	443	3	of	of	ADP
bioscience-243	443	4	molecular	molecular	ADJ
bioscience-243	443	5	sciences	science	NOUN
bioscience-243	443	6	.	.	PUNCT
bioscience-243	444	1	2016;17(2):144	2016;17(2):144	NUM
bioscience-243	444	2	.	.	PUNCT
bioscience-243	445	1	45	45	NUM
bioscience-243	445	2	.	.	PUNCT
bioscience-243	446	1	mishra	mishra	PROPN
bioscience-243	446	2	kk	kk	PROPN
bioscience-243	446	3	,	,	PUNCT
bioscience-243	446	4	borish	borish	VERB
bioscience-243	446	5	k	k	PROPN
bioscience-243	446	6	,	,	PUNCT
bioscience-243	446	7	singh	singh	PROPN
bioscience-243	446	8	g	g	NOUN
bioscience-243	446	9	,	,	PUNCT
bioscience-243	446	10	panwaria	panwaria	NOUN
bioscience-243	446	11	p	p	NOUN
bioscience-243	446	12	,	,	PUNCT
bioscience-243	446	13	metya	metya	ADJ
bioscience-243	446	14	s	s	PROPN
bioscience-243	446	15	,	,	PUNCT
bioscience-243	446	16	madhusudhan	madhusudhan	PROPN
bioscience-243	446	17	ms	ms	PROPN
bioscience-243	446	18	,	,	PUNCT
bioscience-243	446	19	et	et	PROPN
bioscience-243	446	20	al	al	PROPN
bioscience-243	446	21	.	.	PUNCT
bioscience-243	446	22	observation	observation	NOUN
bioscience-243	446	23	of	of	ADP
bioscience-243	446	24	an	an	DET
bioscience-243	446	25	unusually	unusually	ADV
bioscience-243	446	26	large	large	ADJ
bioscience-243	446	27	ir	ir	ADJ
bioscience-243	446	28	red	red	ADJ
bioscience-243	446	29	-	-	PUNCT
bioscience-243	446	30	shift	shift	NOUN
bioscience-243	446	31	in	in	ADP
bioscience-243	446	32	an	an	DET
bioscience-243	446	33	unconventional	unconventional	ADJ
bioscience-243	446	34	s	s	PROPN
bioscience-243	446	35	–	–	PUNCT
bioscience-243	446	36	h	h	NOUN
bioscience-243	446	37	·	·	PUNCT
bioscience-243	446	38	·	·	PUNCT
bioscience-243	447	1	·	·	PUNCT
bioscience-243	447	2	s	s	PART
bioscience-243	447	3	hydrogen	hydrogen	NOUN
bioscience-243	447	4	-	-	PUNCT
bioscience-243	447	5	bond	bond	NOUN
bioscience-243	447	6	.	.	PUNCT
bioscience-243	448	1	journal	journal	PROPN
bioscience-243	448	2	of	of	ADP
bioscience-243	448	3	physical	physical	ADJ
bioscience-243	448	4	chemistry	chemistry	NOUN
bioscience-243	448	5	letters	letter	NOUN
bioscience-243	448	6	.	.	PUNCT
bioscience-243	449	1	2021;12(4):1228	2021;12(4):1228	NUM
bioscience-243	449	2	-	-	SYM
bioscience-243	449	3	35	35	NUM
bioscience-243	449	4	.	.	PUNCT
bioscience-243	449	5	46	46	NUM
bioscience-243	449	6	.	.	PUNCT
bioscience-243	449	7	zierkiewicz	zierkiewicz	PROPN
bioscience-243	449	8	w	w	PROPN
bioscience-243	449	9	,	,	PUNCT
bioscience-243	449	10	michalczyk	michalczyk	PROPN
bioscience-243	449	11	m	m	PROPN
bioscience-243	449	12	,	,	PUNCT
bioscience-243	449	13	scheiner	scheiner	PROPN
bioscience-243	449	14	s.	s.	PROPN
bioscience-243	449	15	noncovalent	noncovalent	PROPN
bioscience-243	449	16	bonds	bond	NOUN
bioscience-243	449	17	through	through	ADP
bioscience-243	449	18	sigma	sigma	NOUN
bioscience-243	449	19	and	and	CCONJ
bioscience-243	449	20	pi	pi	NOUN
bioscience-243	449	21	-	-	PUNCT
bioscience-243	449	22	hole	hole	NOUN
bioscience-243	449	23	located	locate	VERB
bioscience-243	449	24	on	on	ADP
bioscience-243	449	25	the	the	DET
bioscience-243	449	26	same	same	ADJ
bioscience-243	449	27	molecule	molecule	NOUN
bioscience-243	449	28	.	.	PUNCT
bioscience-243	450	1	guiding	guide	VERB
bioscience-243	450	2	principles	principle	NOUN
bioscience-243	450	3	and	and	CCONJ
bioscience-243	450	4	comparisons	comparison	NOUN
bioscience-243	450	5	.	.	PUNCT
bioscience-243	451	1	molecules	molecule	NOUN
bioscience-243	451	2	.	.	PUNCT
bioscience-243	452	1	2021;26(6):1740	2021;26(6):1740	NUM
bioscience-243	452	2	.	.	PUNCT
bioscience-243	453	1	47	47	NUM
bioscience-243	453	2	.	.	PUNCT
bioscience-243	454	1	alencar	alencar	PROPN
bioscience-243	454	2	wlm	wlm	PROPN
bioscience-243	454	3	,	,	PUNCT
bioscience-243	454	4	da	da	PROPN
bioscience-243	454	5	silva	silva	PROPN
bioscience-243	454	6	arouche	arouche	PROPN
bioscience-243	454	7	t	t	PROPN
bioscience-243	454	8	,	,	PUNCT
bioscience-243	454	9	neto	neto	PROPN
bioscience-243	454	10	afg	afg	PROPN
bioscience-243	454	11	,	,	PUNCT
bioscience-243	454	12	de	de	PROPN
bioscience-243	454	13	castro	castro	PROPN
bioscience-243	454	14	ramalho	ramalho	PROPN
bioscience-243	454	15	t	t	PROPN
bioscience-243	454	16	,	,	PUNCT
bioscience-243	454	17	de	de	PROPN
bioscience-243	454	18	carvalho	carvalho	PROPN
bioscience-243	454	19	júnior	júnior	PROPN
bioscience-243	454	20	rn	rn	PROPN
bioscience-243	454	21	,	,	PUNCT
bioscience-243	454	22	de	de	PROPN
bioscience-243	454	23	jesus	jesus	PROPN
bioscience-243	454	24	chaves	chaves	PROPN
bioscience-243	454	25	neto	neto	PROPN
bioscience-243	454	26	am	am	PROPN
bioscience-243	454	27	.	.	PUNCT
bioscience-243	454	28	interactions	interaction	NOUN
bioscience-243	454	29	of	of	ADP
bioscience-243	454	30	co	co	NOUN
bioscience-243	454	31	,	,	PUNCT
bioscience-243	454	32	cu	cu	PROPN
bioscience-243	454	33	,	,	PUNCT
bioscience-243	454	34	and	and	CCONJ
bioscience-243	454	35	non	non	ADJ
bioscience-243	454	36	-	-	ADJ
bioscience-243	454	37	metal	metal	ADJ
bioscience-243	454	38	phthalocyanines	phthalocyanine	NOUN
bioscience-243	454	39	with	with	ADP
bioscience-243	454	40	external	external	ADJ
bioscience-243	454	41	structures	structure	NOUN
bioscience-243	454	42	of	of	ADP
bioscience-243	454	43	sars	sar	NOUN
bioscience-243	454	44	-	-	PUNCT
bioscience-243	454	45	cov-2	cov-2	PART
bioscience-243	454	46	using	use	VERB
bioscience-243	454	47	docking	docking	NOUN
bioscience-243	454	48	and	and	CCONJ
bioscience-243	454	49	molecular	molecular	ADJ
bioscience-243	454	50	dynamics	dynamic	NOUN
bioscience-243	454	51	.	.	PUNCT
bioscience-243	455	1	scientific	scientific	ADJ
bioscience-243	455	2	reports	report	NOUN
bioscience-243	455	3	.	.	PUNCT
bioscience-243	456	1	2022;12(1):3316	2022;12(1):3316	NUM
bioscience-243	456	2	.	.	PUNCT
bioscience-243	457	1	highlights	highlight	NOUN
bioscience-243	457	2	in	in	ADP
bioscience-243	457	3	bioscience	bioscience	NOUN
bioscience-243	457	4	page	page	NOUN
bioscience-243	457	5	9	9	NUM
bioscience-243	457	6	of	of	ADP
bioscience-243	457	7	9	9	NUM
bioscience-243	457	8	may	may	AUX
bioscience-243	457	9	2025|volume	2025|volume	NUM
bioscience-243	457	10	8	8	NUM
bioscience-243	457	11	http://bioscience.highlightsin.org/	http://bioscience.highlightsin.org/	PRON
bioscience-243	457	12	abstract	abstract	ADJ
bioscience-243	457	13	introduction	introduction	NOUN
bioscience-243	457	14	materials	material	NOUN
bioscience-243	457	15	and	and	CCONJ
bioscience-243	457	16	methods	method	NOUN
bioscience-243	457	17	downloading	download	VERB
bioscience-243	457	18	3d	3d	NUM
bioscience-243	457	19	structure	structure	NOUN
bioscience-243	457	20	d7	d7	PROPN
bioscience-243	457	21	protein	protein	NOUN
bioscience-243	457	22	and	and	CCONJ
bioscience-243	457	23	ligand	ligand	ADJ
bioscience-243	457	24	preparation	preparation	NOUN
bioscience-243	457	25	and	and	CCONJ
bioscience-243	457	26	optimization	optimization	NOUN
bioscience-243	457	27	of	of	ADP
bioscience-243	457	28	the	the	DET
bioscience-243	457	29	3d	3d	NUM
bioscience-243	457	30	structure	structure	NOUN
bioscience-243	457	31	of	of	ADP
bioscience-243	457	32	d7	d7	PROPN
bioscience-243	457	33	protein	protein	NOUN
bioscience-243	457	34	and	and	CCONJ
bioscience-243	457	35	the	the	DET
bioscience-243	457	36	native	native	ADJ
bioscience-243	457	37	ligand	ligand	PROPN
bioscience-243	457	38	l	l	ADJ
bioscience-243	457	39	-	-	PUNCT
bioscience-243	457	40	norepinephrine	norepinephrine	ADJ
bioscience-243	457	41	validation	validation	NOUN
bioscience-243	457	42	of	of	ADP
bioscience-243	457	43	the	the	DET
bioscience-243	457	44	molecular	molecular	ADJ
bioscience-243	457	45	docking	docking	NOUN
bioscience-243	457	46	method	method	NOUN
bioscience-243	457	47	preparation	preparation	NOUN
bioscience-243	457	48	of	of	ADP
bioscience-243	457	49	3d	3d	NUM
bioscience-243	457	50	structure	structure	NOUN
bioscience-243	457	51	of	of	ADP
bioscience-243	457	52	serotonin	serotonin	NOUN
bioscience-243	457	53	test	test	NOUN
bioscience-243	457	54	ligand	ligand	NOUN
bioscience-243	457	55	molecular	molecular	ADJ
bioscience-243	457	56	docking	docking	NOUN
bioscience-243	457	57	between	between	ADP
bioscience-243	457	58	d7	d7	PROPN
bioscience-243	457	59	protein	protein	NOUN
bioscience-243	457	60	and	and	CCONJ
bioscience-243	457	61	serotonin	serotonin	VERB
bioscience-243	457	62	test	test	NOUN
bioscience-243	457	63	ligand	ligand	NOUN
bioscience-243	457	64	analysis	analysis	NOUN
bioscience-243	457	65	and	and	CCONJ
bioscience-243	457	66	visualization	visualization	NOUN
bioscience-243	457	67	of	of	ADP
bioscience-243	457	68	molecular	molecular	ADJ
bioscience-243	457	69	docking	docking	NOUN
bioscience-243	457	70	results	result	NOUN
bioscience-243	457	71	between	between	ADP
bioscience-243	457	72	d7	d7	PROPN
bioscience-243	457	73	protein	protein	NOUN
bioscience-243	457	74	and	and	CCONJ
bioscience-243	457	75	serotonin	serotonin	VERB
bioscience-243	457	76	test	test	NOUN
bioscience-243	457	77	ligand	ligand	NOUN
bioscience-243	457	78	results	result	NOUN
bioscience-243	457	79	and	and	CCONJ
bioscience-243	457	80	discussions	discussion	NOUN
bioscience-243	457	81	3d	3d	NUM
bioscience-243	457	82	structure	structure	NOUN
bioscience-243	457	83	of	of	ADP
bioscience-243	457	84	d7	d7	PROPN
bioscience-243	457	85	protein	protein	NOUN
bioscience-243	457	86	from	from	ADP
bioscience-243	457	87	ae	ae	PROPN
bioscience-243	457	88	.	.	PUNCT
bioscience-243	457	89	aegypti	aegypti	VERB
bioscience-243	457	90	salivary	salivary	ADJ
bioscience-243	457	91	gland	gland	NOUN
bioscience-243	457	92	assessment	assessment	NOUN
bioscience-243	457	93	of	of	ADP
bioscience-243	457	94	the	the	DET
bioscience-243	457	95	structural	structural	ADJ
bioscience-243	457	96	quality	quality	NOUN
bioscience-243	457	97	of	of	ADP
bioscience-243	457	98	the	the	DET
bioscience-243	457	99	ae	ae	PROPN
bioscience-243	457	100	.	.	PUNCT
bioscience-243	458	1	aegypti	aegypti	VERB
bioscience-243	458	2	salivary	salivary	ADJ
bioscience-243	458	3	gland	gland	NOUN
bioscience-243	458	4	d7	d7	PROPN
bioscience-243	458	5	protein	protein	NOUN
bioscience-243	458	6	model	model	NOUN
bioscience-243	458	7	3d	3d	PROPN
bioscience-243	458	8	structure	structure	NOUN
bioscience-243	458	9	of	of	ADP
bioscience-243	458	10	native	native	ADJ
bioscience-243	458	11	ligand	ligand	PROPN
bioscience-243	458	12	l	l	PROPN
bioscience-243	458	13	-	-	NOUN
bioscience-243	458	14	norepinephrine	norepinephrine	NOUN
bioscience-243	458	15	and	and	CCONJ
bioscience-243	458	16	test	test	NOUN
bioscience-243	458	17	ligand	ligand	NOUN
bioscience-243	458	18	serotonin	serotonin	VERB
bioscience-243	458	19	molecular	molecular	ADJ
bioscience-243	458	20	docking	docking	NOUN
bioscience-243	458	21	validation	validation	NOUN
bioscience-243	458	22	method	method	NOUN
bioscience-243	458	23	molecular	molecular	ADJ
bioscience-243	458	24	docking	docking	NOUN
bioscience-243	458	25	of	of	ADP
bioscience-243	458	26	protein	protein	NOUN
bioscience-243	458	27	d7	d7	PROPN
bioscience-243	458	28	from	from	ADP
bioscience-243	458	29	ae	ae	PROPN
bioscience-243	458	30	.	.	PUNCT
bioscience-243	459	1	aegypti	aegypti	VERB
bioscience-243	459	2	and	and	CCONJ
bioscience-243	459	3	serotonin	serotonin	VERB
bioscience-243	459	4	test	test	NOUN
bioscience-243	459	5	ligand	ligand	NOUN
bioscience-243	459	6	analysis	analysis	NOUN
bioscience-243	459	7	and	and	CCONJ
bioscience-243	459	8	visualization	visualization	NOUN
bioscience-243	459	9	of	of	ADP
bioscience-243	459	10	molecular	molecular	ADJ
bioscience-243	459	11	docking	docking	NOUN
bioscience-243	459	12	results	result	NOUN
bioscience-243	459	13	of	of	ADP
bioscience-243	459	14	ae	ae	PROPN
bioscience-243	459	15	.	.	PUNCT
bioscience-243	460	1	aegypti	aegypti	VERB
bioscience-243	460	2	d7	d7	PROPN
bioscience-243	460	3	protein	protein	NOUN
bioscience-243	460	4	with	with	ADP
bioscience-243	460	5	serotonin	serotonin	ADJ
bioscience-243	460	6	ligand	ligand	ADJ
bioscience-243	460	7	conclusions	conclusion	NOUN
bioscience-243	460	8	supplementary	supplementary	VERB