item: #1 of 465 id: isj-100 author: Faruki, S I title: Effect of pyridoxine on the reproduction of the mulberry silkworm, Bombyx mori L. (Lepidoptera: Bombycidae) date: 2005-03-30 words: 1833 flesch: 67 summary: Abstract The present investigation reports the effects of vitamin B6, also known as pyridoxine supplemented feed on the reproductive potential of Bombyx mori L. All the concentrations of the vitamin significantly reduced the fecundity. The growth and development of the silkworm, Bombyx mori L. on feed supplemented with nicotinic acid. keywords: bombyx; khan; mori; saha; silkworm cache: isj-100.pdf plain text: isj-100.txt item: #2 of 465 id: isj-101 author: Cossarizza, A; Pinti, M; Troiano, L; Cooper, E L title: Flow cytometry as a tool for analysing invertebrate cells date: 2005-04-08 words: 5878 flesch: 49 summary: ISSN 1824-307X Review Flow cytometry as a tool for analysing invertebrate cells A Cossarizza1, M Pinti1, L Troiano1, EL Cooper2 1 Department of Biomedical Sciences, University of Modena and Reggio Emilia, Modena, Italy 2 Department of Neurobiology, UCLA School of Medicine, Los Angeles, CA, USA Accepted April 8, 2005 Abstract Flow cytometry (FCM) is a powerful tool that allows analysis of thousand of cells in a few seconds, at the single cell level. Analyses have focused on functions linked to innate immunity, such as phagocytosis and natural killer cell activity, as well as on the sensitivity of invertebrate cells to a particular stress or to a toxic agent. keywords: activity; analysis; anti; cell; coelomocytes; cossarizza; dna; et al; fcm; flow; hemocytes; invertebrate; molecules; ottaviani cache: isj-101.pdf plain text: isj-101.txt item: #3 of 465 id: isj-104 author: Brivio, M F; Mastore, M; Pagani, M title: Parasite-host relationship: a lesson from a professional killer date: 2005-04-18 words: 8855 flesch: 50 summary: The chosen examples are focused on insect hosts because of their economical and medical importance and considering their susceptibility to the symbiontic complex Steinernema-Xenorhabdus commercially available as biological insecticide. The symbiosis is essential for the efficiency of the biocontrol and it enables nematodes to exploit a diverse array of insect hosts (Dunphy and Thurston, 1990). keywords: bacteria; cell; cuticle; dunphy; factors; feltiae; fig; hemocytes; hemolymph; host; immune; immunity; insect; mellonella; molecular; nematodes; parasite; propo; stage; surface; system cache: isj-104.pdf plain text: isj-104.txt item: #4 of 465 id: isj-105 author: Tagliazucchi, D; Conte, A title: Calcium/calmodulin dependence of nitric oxide synthase from Viviparus ater immunocytes date: 2005-04-18 words: 3846 flesch: 58 summary: ISSN 1824-307X Short Communication Calcium/calmodulin dependence of nitric oxide synthase from Viviparus ater immunocytes D Tagliazucchi, A Conte Department of Agricultural Sciences, University of Modena and Reggio Emilia, Italy Accepted April 18, 2005 Key words: mollusc; Viviparus ater; immunocytes; nitric oxide synthase; calcium ion dependence Introduction Immunocytes are the cells of the immune response in molluscs and other invertebrates against not-self materials. keywords: activity; calcium; dependence; immunocytes; nitric; nos; ottaviani; oxide; particulate; snail; soluble; synthase cache: isj-105.pdf plain text: isj-105.txt item: #5 of 465 id: isj-106 author: Ferrarese, R; Brivio, M; Congiu, T; Falabella, P; Grimaldi, A; Mastore, M; Perletti, G; Pennacchio, F; Sciacca, L; Tettamanti, G; Valvassori, R; de Eguileor, M title: Early suppression of immune response in Heliothis virescens larvae by the endophagous parasitoid Toxoneuron nigriceps date: 2005-04-28 words: 4503 flesch: 54 summary: Zhang G, Schmidt O, Asgari S. Novel venom peptide from an endoparasitoid wasp is required for expression of poydnavirus genes in host hemocytes. This information is largely lacking, while for the passive evasion of host immune response it appears that the egg fibrous layer may play an important role (Davies and Vinson, 1986). keywords: et al; fig; hemocytes; host; immune; insect; larvae; nigriceps; parasitoid; plasmatocytes; strand; virescens cache: isj-106.pdf plain text: isj-106.txt item: #6 of 465 id: isj-107 author: Mannello, F; Tonti, G; Papa, S title: Are matrix metalloproteinases the missing link? date: 2005-05-25 words: 5325 flesch: 53 summary: For a regulated MMP activity the presence of MMP inhibitors is fundamental, and infact one inhibitor of matrix metalloproteinases has been found in the fly (Pohar et al., 1999) and it is structurely closely related to mammalian TIMPs (Wei et al., 2003). It is possible that this IMPI is implicated during the response of G. mellonella to invading pathogens as it is released during the humoral immune response (probably stimulated by particular peptidic fragments) and is able to protect the insect from exogenous metalloproteinases of pathogen origin such as bacterial thermolysin (Wedde et al., 1998; Vilcinskas and Wedde, 2002). ... and into every nook and craggy ... Three gene products (MMP-C31, H19 and Y19) encoding matrix metalloproteinases have been found in the nematode Caenorhabditis elegans. keywords: activity; biochem; biol; cell; enzyme; et al; extracellular; mannello; matrix; metalloproteinases; mmp; mmps; sea; urchin cache: isj-107.pdf plain text: isj-107.txt item: #7 of 465 id: isj-108 author: Faruki, S I; Kundu, P K title: Sensitivity of the silkworm, Bombyx mori L. (Lepidoptera: Bombycidae) larvae to UV-irradiation date: 2005-05-31 words: 3888 flesch: 77 summary: Mean ± SE Mean ± SE Mean ± SE F-ratio 0 (Control) 1926.93 ± 15.03a 1926.93 ± 15.03a 1926.93 ± 15.03a 2 1530.86 ± 19.68b 1599.33 ± 21.74b 1670.00 ± 17.75b 4 1472.10 ± 15.63b 1703.16 ± 20.26b 1656.26 ± 24.75b Nistari-M 8 1447.53 ± 20.97b 1584.43 ± 20.68b 1653.86 ± 20.57b (a) 23.91*** (b) 5.55* 0 (Control) 1929.36 ± 20.92a 1929.36 ± 20.92a 1929.36 ± 20.92a 2 1735.73 ± 27.16b 1824.53 ± 50.29b 1917.30 ± 18.20a 4 1735.20 ± 45.49b 1726.30 ± 38.23bc 1916.70 ± 26.32a Urboshi-1 8 1710.80 ± 37.26b 1693.96 ± 31.01c 1822.76 ± 18.67a (a) 6.92* (b) 6.25* (a) = between doses, (b) = between instars; * P < 0.05, *** P < 0.001 keywords: instars; mean; mori; radiation; silkworm; weight cache: isj-108.pdf plain text: isj-108.txt item: #8 of 465 id: isj-109 author: Schmidt, O; Rahman, M M; Ma, G; Theopold, U; Sun, Y; Sarjan, M; Fabbri, M; Roberts, H title: Mode of action of antimicrobial proteins, pore-forming toxins and biologically active peptides (Hypothesis) date: 2005-07-01 words: 5054 flesch: 51 summary: Pande AH, Sumati N, Hajela N, Hajela K. Carbohydrate induced modulation of cell membrane - VII - Binding of exogenous lectin increases osmofragility of erythrocytes. A) Assemblies, consisting of lipoproteins and multimeric lectins, interact with membrane-anchored molecules, such as membrane receptors, lipid anchored glycoproteins or glycolipids molecules. keywords: cell; et al; insertion; lipid; lipophorin; membrane; molecules; peptides; pore; reactions; receptors; toxin; uptake cache: isj-109.pdf plain text: isj-109.txt item: #9 of 465 id: isj-110 author: Manduzio, H; Rocher, B; Durand, F; Galap, C; Leboulenger, F title: The point about oxidative stress in molluscs date: 2005-07-08 words: 11369 flesch: 57 summary: The reduction in the rate of reduced GSH was observed at bivalves M. galloprovincialis and Unio tumidus in correlation with the presence of PAH and PCB in the medium (Regoli and Principato, 1995; Doyotte et al., 1997; Cossu et al., 1997, 2000). Various studies showed a production NAD(P)H-dependent of ROS stimulated by contaminants (Lemaire et al., 1994; Peters et al., 1996; Lemaire and Livingstone, 1997; Livingstone et al., 2000). keywords: activity; antioxidant; biochem; biol; cat; copper; dismutase; edulis; enzymes; et al; free; galloprovincialis; glutathione; gpx; gsh; lipid; mda; metals; mussel; mytilus; oxidative; oxygen; peroxidation; production; proteins; radicals; reaction; ros; sod; species; stress; studies; superoxide cache: isj-110.pdf plain text: isj-110.txt item: #10 of 465 id: isj-111 author: Zheng, L; Zhang, L; Lin, H; McIntosh, M T; Malacrida, A R title: Toll-like receptors in invertebrate innate immunity date: 2005-08-04 words: 5181 flesch: 58 summary: TLR genes have been found in all vertebrates where they also play an important role in bridging innate and adaptive immunity, reviewed in (Pasare and Medzhitov, 2004). Phylogeny of TLR genes The numbers of extracellular LRR arrays in different TLRs are different, making sequence alignment in this region highly subjective. keywords: domain; drosophila; et al; gambiae; genes; immunity; melanogaster; receptors; tir; tlr; tlrs; toll cache: isj-111.pdf plain text: isj-111.txt item: #11 of 465 id: isj-113 author: D’Ancona Lunetta, G title: Wound repair in the marine worm Sipunculus nudus (Sipunculidae) date: 2005-09-14 words: 3574 flesch: 63 summary: Cytological and histochemical observations on connective tissue cells and cutaneous wound healing in the sea cucumber Stichopus badionotus. Fibroblast-like cells, pigment cells and numerous coelomocytes were the first cells to arrive at wound sites in the Holothuria polii and the newly formed collagen fibres were synthesized by Type II spherula cells. keywords: cells; fibres; fig; granulocytes; incision; muscle; tissue; type; wound cache: isj-113.pdf plain text: isj-113.txt item: #12 of 465 id: isj-114 author: Lorenzon, S title: Hyperglycemic stress response in Crustacea date: 2005-09-27 words: 6294 flesch: 59 summary: 5-HT has long been known (Bauchau and Mengeot, 1966) to have a potent hyperglycemic effect in several crustacean species (Lorenzon et al., 1999, 2004b; Lee et al., 132 2000; Komali et al., 2005;), while dopamine (DA) and enkephalin showed conflicting results in different species (Sarojini et al., 1995; Lorenzon et al., 1999, 2004b; Zou et al., 2003; Komali et al., 2005). These findings are in contrast with those by Lüschen et al., (1993) for Carcinus maenas, Kuo et al. keywords: blood; chh; crab; crustacean; elegans; et al; eyestalk; glucose; hemolymph; hormone; hyperglycemic; lorenzon; release; response; stress cache: isj-114.pdf plain text: isj-114.txt item: #13 of 465 id: isj-115 author: Ottaviani, E title: Insect immunorecognition date: 2005-10-14 words: 7617 flesch: 58 summary: Many insect species contain natural agglutinins (Yeaton, 1981; Ratcliffe and Rowley, 1983; Chen et al., 1993) that can be induced by antigenic stimulation (Komano et al., 1980; Ratcliffe and Rowley, 1983). Several reports have described the presence of defensins in different insect species (Bulet et al., 1999), but not in Lepidoptera. keywords: ashida; biochem; biol; cells; drosophila; et al; factor; gene; hemolymph; immune; immunity; immunocytes; immunol; innate; insect; invertebrates; molecules; mori; ottaviani; peptides; ratcliffe; recognition; rowley; system cache: isj-115.pdf plain text: isj-115.txt item: #14 of 465 id: isj-116 author: Appel, M H; Bertoni da Silveira, R; Gremski, W; Veiga, S S title: Insights into brown spider and loxoscelism date: 2005-12-27 words: 5401 flesch: 60 summary: Endotoxemic-like shock induced by Loxosceles spider venoms: pathological changes and putative mediators. Veiga SS, Feitosa L. Santos VLP, Souza GA, Ribeiro AS, Mangili OC, Porcionatto MA, Nader HB, Dietrich CP, Brentani RR, Gremski W. Effect of brown spider venom on basement membrane structures. keywords: activity; bites; brazil; brown; cell; dermonecrotic; et al; intermedia; loxosceles; recluse; silva; spider; toxicon; veiga; venom cache: isj-116.pdf plain text: isj-116.txt item: #15 of 465 id: isj-118 author: Malagoli, D; Casarini, L; Ottaviani, E title: Monitoring of the immune efficiency of Mytilus galloprovincialis in Adriatic sea mussel farms in 2005 date: 2006-01-13 words: 1363 flesch: 53 summary: However, no sudden Fig. 2 Comparison between mussel cytotoxicity immediately after being caught (A) or after a period of maintenance in the aquarium (B). Abstract The monthly evaluation of the cytotoxicity of hemolymph from the mussel Mytilus galloprovincialis revealed some variations in the percentage of cytotoxic animals during the year. keywords: cytotoxicity; galloprovincialis; hemolymph; mussel; ottaviani cache: isj-118.pdf plain text: isj-118.txt item: #16 of 465 id: isj-119 author: Shi, L; Paskewitz, S M title: Proteomics and insect immunity date: 2006-01-24 words: 9711 flesch: 52 summary: An example of a 2D-PAGE separation of hemolymph proteins is provided in Fig. Two- dimensional gel analysis of hemolymph proteins from Plasmodium-melanizing and nonmelanizing strains of Anopheles gambiae. keywords: analysis; anopheles; challenge; drosophila; et al; gambiae; gel; hemolymph; identification; immune; immunity; infection; insect; larval; levy; melanogaster; paskewitz; proteins; proteomics; responses; shi; spots; studies; vierstraete cache: isj-119.pdf plain text: isj-119.txt item: #17 of 465 id: isj-12 author: Yang, M F; Luo, S B; Sun, J N; Shi, D T; Ding, J Y; Chang, Y Q; Zhao, C title: Effects of water temperature and pH value on covering behavior of the sea urchin Glyptocidaris crenularis date: 2017-11-28 words: 2939 flesch: 54 summary: Lower pH value (pH = 7.4) significantly reduced the time to first covering (p = 0.026), while significantly decreased number of covered sea urchins (p = 0.029) and number of shells used for covering (p = 0.007) in G. crenularis. Water temperature did not significantly affect the time to first covering (p = 0.180) or number of covered sea urchins (p = 0.157), though significantly affected number of shells used for covering (p = 0.042). keywords: covering; number; sea; urchins; water cache: isj-12.pdf plain text: isj-12.txt item: #18 of 465 id: isj-120 author: Menin, A; Ballarin, L title: Exogenous IL-8 induces phagocyte activation in the compound ascidian Botryllus schlosseri date: 2006-02-28 words: 4625 flesch: 57 summary: In addition, IL-8 induces the up-regulation and activation of integrins on leucocytes required for their adhesion to both endothelial cells, prior to extravasation, and extracellular matrix, during their way to inflammation sites (Luster, 1998; Imhof and Aurrand-Lions, 2004; Casilli et al., 2005). IL-8, one of the most extensively studied vertebrate chemokine, is a key mediator in polymorphonuclear leucocyte, T lymphocyte and NK cell recruitment and activation (Baggiolini, 2001; Casilli et al., 2005; Esche et al., 2005). keywords: cells; et al; fsw; hemocytes; hril-8; il-8; immunocytes; ottaviani; phagocytosis; presence; protein cache: isj-120.pdf plain text: isj-120.txt item: #19 of 465 id: isj-121 author: Smith, L C; Rast, J P; Brockton, V; Terwilliger, D P; Nair, S V; Buckley, K M; Majeske, A J title: The sea urchin immune system date: 2006-05-10 words: 11488 flesch: 55 summary: The mammalian complement cascade is shown with the known (green circles) and predicted (green striped circles) sea urchin complement proteins mapped onto it. The gene encoding the sea urchin complement protein, SpC3, is expressed in embryos and can be upregulated by bacteria. keywords: bertheussen; cells; challenge; coelomocytes; complement; et al; expression; fig; fluid; function; genes; gross; immunol; pathway; phagocytes; phagocytosis; proteins; response; sea; sea urchin; smith; smith et; spc3; system; type; urchin cache: isj-121.pdf plain text: isj-121.txt item: #20 of 465 id: isj-122 author: Canesi, L; Betti, M; Ciacci, C; Lorusso, L C; Pruzzo, C; Gallo, G title: Cell signalling in the immune response of mussel hemocytes date: 2006-05-24 words: 7232 flesch: 50 summary: Our data support the hypothesis that components of NF-kB signalling are present in Mytilus hemocytes and that their activity may be modulated by heterologous TNFα. 4 Signalling pathways involved in the immune response of Mytilus hemocytes. keywords: activation; canesi; cell; components; effects; et al; hemocytes; immune; kinase; mapks; mussel; mytilus; pathways; phosphorylation; response; role; signalling cache: isj-122.pdf plain text: isj-122.txt item: #21 of 465 id: isj-123 author: Ottaviani, E title: Molluscan immunorecognition date: 2006-06-15 words: 8635 flesch: 57 summary: It is interesting to note that the carbohydrate component of the natural agglutinin contains N-acetylmuramic acid, typical of prokariotes, and not sialic acid as expected for eukariotes (Ottaviani et al., 1990a). Planorbarius corneus IL-1α,β, IL-2, IL-6, TNF-α, Ottaviani et al. (1993b), PDGF-AB, TGF-β1 Franchini et al. (1996) Viviparus ater IL-1α,β ,IL-2, IL-6, TNF-α, Ottaviani et al. (1993b), PDGF-AB, TGF-β1 Franchini et al. (1996) Biomphalaria glabrata IL-1, TNF-α Granath et al. (1994), Owe-Missi-Oukem-Boyer et al. (1994) Viviparus contectus PDGF-AB, TGF-β1 Franchini et al. (1996) Lymnaea stagnalis PDGF-AB, TGF-β1, EGF, Franchini et al. (1996), neurotrophic factor Hermann et al. (2000), Fainzilber et al. (1996) Mytilus edulis IL-1α,β, IL-6, TNF-α Hughes et al. (1990, 1991, 1992), Stefano et al. (1991), Paeman et al. (1992) Mytilus galloprovincialis IL-8, PDGF-AB, TGF-β1 Franchini et al. (1996), Ottaviani et al. (2000) Crassostrea gigas TGF-β Lelong et al. (2000) __________________________________________________________________________________________ keywords: cell; corneus; et al; franchini; immune; immunocytes; immunol; invertebrate; molecules; neuroendocrine; ottaviani; ottaviani et; peptides; response; snail; system; tissue; type cache: isj-123.pdf plain text: isj-123.txt item: #22 of 465 id: isj-124 author: Candia Carnevali, M D title: Regeneration in Echinoderms: repair, regrowth, cloning date: 2006-06-16 words: 9948 flesch: 38 summary: As is the case for all other regenerating systems, the basic goal in echinoderm regeneration research is to answer a few crucial questions regarding how regeneration processes are initiated, which sets of genes are activated (or reactivated), what is the origin of the cells involved in reconstruction or repair of the damaged or lost structure, and which factors (morphogens and/or mitogens) regulate growth, morphogenesis and differentiation at the right time and at the correct place to ensure a complete re- establishment of anatomical pattern and functional integrity (Carlson, 1998; Arm regeneration in feather stars represents the most thoroughly explored model in echinoderm regeneration studies (Candia Carnevali and Bonasoro, 2001b). keywords: arm; arms; aspects; bonasoro; candia; carnevali; cells; echinoderms; et al; factors; larvae; mechanisms; new; phenomenon; potential; processes; regeneration; stages; terms; thorndyke cache: isj-124.pdf plain text: isj-124.txt item: #23 of 465 id: isj-125 author: Kida, A; Matsuoka, T title: Cyst wall formation in the ciliated protozoan Colpoda cucullus: cyst wall is not originated from pellicle membranes date: 2006-07-18 words: 3488 flesch: 57 summary: Figs 4C, D: v, vacuole containing presumed precursor for endocyst layer (en-1); arrowhead, a point where toluidine blue-stained substance (TBS) was being released. Inset, A highly magnified picture of endocyst showing that endocyst layers are composed of fine fibrous materials. keywords: ectocyst; electron; endocyst; fig; figs; layer cache: isj-125.pdf plain text: isj-125.txt item: #24 of 465 id: isj-126 author: Reza, A M S; Parween, S title: Differential preference of colored surface in Tribolium castaneum (Herbst) date: 2006-07-28 words: 2836 flesch: 71 summary: Abstract Insects show color preferences mostly to those which resembles the color of foliage, flower or even their hosts. Key words: color preference; Tribolium castaneum _____________________________________________________________________________________________________________________ Introduction Insect traps are used either for population sampling or for management of pest species. keywords: adults; color; instar; larvae; pink; yellow cache: isj-126.pdf plain text: isj-126.txt item: #25 of 465 id: isj-127 author: Nakanishi, Y; Shiratsuchi, A title: Mechanisms and roles of phagocytosis in Drosophila and Caenorhabditis elegans date: 2006-09-19 words: 6735 flesch: 49 summary: The externalization of phosphatidylserine occurs also in Drosophila cells during apoptosis, but whether or not phosphatidylserine serves as a phagocytosis marker remains to be determined. Upon the binding of target cells, the intracellular portion of phagocytosis receptors activates a signaling pathway, which in most cases leads to rearrangement of the actin cytoskeleton. keywords: bacteria; cells; drosophila; elegans; et al; immunity; innate; microbes; phagocytes; phagocytosis; proteins; receptors; surface cache: isj-127.pdf plain text: isj-127.txt item: #26 of 465 id: isj-128 author: Kamaruzzaman, A H M; Reza, A M S; Mondal, K A M S H; Parween, S title: Morphological abnormalities in Tribolium castaneum (Herbst) and Tribolium confusum Duval due to cyromazine and pirimiphos-methyl treatments alone or in combination date: 2006-11-03 words: 2904 flesch: 62 summary: Parween S. Distribution and food consumption of larval and adult Tribolium castaneum Herbst on Baycidal treated medium. Effects of methylquinone, aggregation pheromone and pitrimiphos-methyl on Tribolium castaneum Herbst larvae. keywords: castaneum; cyromazine; larvae; methyl; pirimiphos; species; tribolium cache: isj-128.pdf plain text: isj-128.txt item: #27 of 465 id: isj-129 author: Goto, A; Kurata, S title: The multiple functions of the PGRP family in Drosophila immunity date: 2006-11-13 words: 5667 flesch: 57 summary: 1 Extracellular recognition by PGRP family. They also demonstrated that long transcripts of the same types of PGRP family, PGRP-LA or PGRP– LD, are not involved in phagocytosis (Ramet et al., 2002). keywords: activation; bacteria; drosophila; et al; family; gram; imd; innate; pathway; peptidoglycan; pgrp; protein; recognition; toll cache: isj-129.pdf plain text: isj-129.txt item: #28 of 465 id: isj-13 author: Wang, M; Wang, B; Liu, M; Jiang, K; Wang, L title: Sequence features, expression profiles and biochemical characteristics of a sigma class glutathione S-transferase gene (AiGSTσ) from bay scallop Argopecten irradians date: 2017-12-05 words: 5833 flesch: 58 summary: (Wang et al., 2009), peroxiredoxin (PRX) (Li et al., 2011) and superoxide dismutase (SOD) (Bao et al., 2008, 2009a, b, 2010), however, no information about GST genes was available in bay scallop till now. Therefore, organisms employ the antioxidant system to maintain ROI and ROS at the normal physiological levels (Zhang et al., 2017a, b). keywords: aigstσ; class; et al; expression; fig; gene; glutathione; gsts; hemocytes; mrna; pcr; protein; scallop; sequence; sigma; wang; zhang cache: isj-13.pdf plain text: isj-13.txt item: #29 of 465 id: isj-130 author: Franchini, A; Marchetti, M title: The effects of okadaic acid on Enchytraeus crypticus (Annelida: Oligochaeta) date: 2006-11-29 words: 2907 flesch: 52 summary: At the highest OA dose (400 nM), a general cell suffering was found, i.e. the extended, irregularly shaped chloragogenous tissue cells embedded clumped coelomocytes (Figs 2D, E), the epithelial cell layer of the medio-posterior intestine increased in surface area (Fig. 2F), nephridia appeared disorganized in structure, and the ventral nerve cord comprising wrinkled nerve cells presented fewer neuronal cell bodies as a result of the invasion of expanding chloragogenous tissue (Figs 3A, D). These molecules have been found to act as endogenous regulators of inflammatory cell signalling (Shanley et al., 2001), and to play a role in the control and stimulation of proinflammatory cytokine gene expression by murine mononuclear phagocytes and other cell types (Falk et al., 1994; Tebo and Hamilton, 1994; Wakiya and Shibuya, 1999; Feng et al., 2006). keywords: acid; cells; crypticus; okadaic; tissue cache: isj-130.pdf plain text: isj-130.txt item: #30 of 465 id: isj-131 author: Fagotti, A; Simoncelli, F; Di Rosa, I; Pascolini, R title: Cytoskeletal proteins and morphogenesis in planarians date: 2006-11-29 words: 4555 flesch: 49 summary: Moreover, BrdU labelling experiments of neoblasts confirmed that planarian stem cells contribute to the regeneration process through an active migration towards the wound region (Newmark and Sànchez Alvarado, 2000). Reddien PW, Oviedo NJ, Jenning JR, Jenkin JC, Sánchez Alvarado A. SMEDWI-2 is a PIWI-like protein that regulates planarian stem cells. keywords: actin; anti; blastema; cell; et al; muscle; pascolini; planarian; regeneration; wound cache: isj-131.pdf plain text: isj-131.txt item: #31 of 465 id: isj-132 author: Zaniolo, G; Manni, L; Ballarin, L title: Colony specificity in Botrylloides leachi. I. Morphological aspects date: 2006-12-20 words: 4335 flesch: 56 summary: Bar = 250 µm. 130 Fig. 5 a) light micrograph of the contact region between non-fusible colonies in CAA. Megaloampullae (M) in contact region between non-fusible colonies (a) and dark, cytotoxic spots in the contact area (b). keywords: ampullae; cells; colonies; contact; fusion; non; tunic cache: isj-132.pdf plain text: isj-132.txt item: #32 of 465 id: isj-133 author: Leonardi, M G; Caccia, S; Giordana, B title: Brush border membrane vesicles from dipteran midgut: a tool for studies on nutrient absorption date: 2006-12-20 words: 5068 flesch: 59 summary: Similar SDS-PAGE patterns, with numerous distinct bands, were detected for both B. oleae and M. domestica BBMV. The vesicles were then used to describe the functional properties of amino acid uptake in this dipteran larva. keywords: acid; amino; bbmv; domestica; larvae; leucine; membrane; midgut cache: isj-133.pdf plain text: isj-133.txt item: #33 of 465 id: isj-135 author: Malagoli, D; Casarini, L; Ottaviani, E title: Monitoring of the immune efficiency of Mytilus galloprovincialis in Adriatic sea mussel farms in 2006: regular changes of cytotoxicity during the year date: 2007-02-01 words: 2046 flesch: 41 summary: 1 Course of mussel cytotoxicity during 2005 and 2006 in the of Cesenatico area. Concluding, mussel cytotoxicity is an activity that changes over the year with a regular time course, meaning that normal levels can be predicted for a given period. keywords: activity; cytotoxicity; hemolymph; malagoli; mussel; ottaviani cache: isj-135.pdf plain text: isj-135.txt item: #34 of 465 id: isj-136 author: Etebari, K; Matindoost, L; Mirhoseini, S Z; Turnbull, M W title: The effect of BmNPV infection on protein metabolism in silkworm (Bombyx mori) larva date: 2007-02-09 words: 3674 flesch: 52 summary: Biabani MR, Mirhoseini SZ, Etebari K, Matindoost L. The Effects of Nuclear Polyhedrosis Virus Infection in 9 commercial Hybrids of Silkworm (Bombyx mori L.) XXth Congress of the International Sericultural Commission, 15-18 Dec. 2005 Bangalore, India, 2005. Infectivity of Serratia marcescens to the silkworm, Bombyx mori L. (Lep.: Bombycidae), and its effect on certain biochemical constituents in the haemolymph and gut. keywords: activity; biochemical; bmnpv; bombyx; changes; hemolymph; infection; larvae; mori; protein; silkworm cache: isj-136.pdf plain text: isj-136.txt item: #35 of 465 id: isj-137 author: Ponnuvel, K M; Mohana Sundari, B; Saravana Kumar, R; Sinha, R K; Kamble, C K title: Identification of a putative RNAse III (dicer homolog) gene in silkworm Bombyx mori date: 2007-02-26 words: 3614 flesch: 58 summary: No 44, Thally Road, Hosur 635 109, India Accepted February 26, 2007 Abstract Like other invertebrates, silkworms also encounter a problem from microbial infection including from RNA viruses. Especially in Drosophila, it is proved that dicer mediated RNA interference directs innate immunity against RNA viruses. keywords: dicer; gene; iii; mori; rna; rnase; sequence; silkworm; virus cache: isj-137.pdf plain text: isj-137.txt item: #36 of 465 id: isj-138 author: Oreste, U; Coscia, M R title: VIIIth scientific meeting of the Italian Association for Developmental and Comparative Immunology (IADCI), 1 and 2 March 2007, Area della Ricerca, CNR, Naples, Italy date: 2007-03-02 words: 10077 flesch: 35 summary: The results obtained with heterologous SFC support the hypothesis that common pathways involved in modulating activity, differentiation and proliferation 26 of immune cells are shared by invertebrates and vertebrates. Haemocytes of the cockle Cerastoderma glaucum: cell types and involvement in immune responses V Matozzo, MG Marin Department of Biology, University of Padua, Padua, Italy For the first time, morpho-functional characterisation of haemocytes from the cockle Cerastoderma glaucum was performed to identify circulating cell types and to study their involvement in immune responses. keywords: activity; anti; bass; biology; cells; complement; cytokines; department; expression; fish; haemocytes; italy; lectins; molecules; naples; presence; present; protein; receptors; sea; sequences; species; specific; system; teleost; university cache: isj-138.pdf plain text: isj-138.txt item: #37 of 465 id: isj-14 author: Majeed, M Z; Naveed, M; Riaz, M A; Ma, C S; Afzal, M title: Differential impact of pesticides and biopesticides on edaphic invertebrate communities in a citrus agroecosystem date: 2018-01-08 words: 4931 flesch: 54 summary: In this study, the effect of most commonly used pesticides viz; bifenthrin (a synthetic pyrethroid), spinosad (a bio-insecticide), Aliette (a synthetic fungicide) and Trichoderma harzianum formulation (30x106 cells mL-1; a bio-fungicide) was assessed on soil invertebrate fauna in a citrus agroecosystem. To achieve these objectives, different pesticides were applied according their label- recommended dose rates on the under canopy area of citrus plants and pre- and post-application data regarding soil invertebrate fauna was collected for different time intervals up to two months. keywords: abundance; bio; citrus; effects; fauna; groups; insecticide; invertebrates; mites; pesticides; population; soil cache: isj-14.pdf plain text: isj-14.txt item: #38 of 465 id: isj-141 author: Pestarino, M; Oliveri, D; Parodi, M; Candiani, S title: The amphioxus immune system date: 2007-03-19 words: 4455 flesch: 50 summary: Danchin et al., 2004; Dong et al., 2005). Innate immunity and humoral immune responses Macrophage migration inhibitory factor (MIF), a cytokine involved in host defenses and autoimmune diseases, has been found in B. belcheri in which unusually the MIF gene is present in multi-copy per haploid genome (Du et al., 2004). keywords: adaptive; amphioxus; class; et al; evolution; genes; immunity; immunol; like; mhc; region; system; vertebrate cache: isj-141.pdf plain text: isj-141.txt item: #39 of 465 id: isj-142 author: Mandrioli, M; Malagoli, D; Ottaviani, E title: Evolution game: which came first, the receptor or the ligand? date: 2007-04-24 words: 2490 flesch: 41 summary: The gene/genome duplications at the boundary between invertebrates and vertebrates are responsible for the presence of more genes coding 52 Genome duplication Receptor specialization for a unique ligand Duplication of receptor gene brings to the presence of different receptors allowing the specialization of a receptor towards a single ligand. CO-EVOLUTION OF LIGAND AND RECEPTORS R1 L1 L2 L3 R1 R1R1 R1a R1b R1c Genome duplication Receptor specialization for a unique ligand Duplication of receptor gene brings to the presence of different receptors allowing the specialization of a receptor towards a single ligand. keywords: evolution; genome; invertebrates; ligand; ottaviani; receptor cache: isj-142.pdf plain text: isj-142.txt item: #40 of 465 id: isj-143 author: Parrinello, N; Arizza, V; Vazzana, M; Cammarata, M; Giaramita, F T; Di Bella, M L; Vizzini, A; Parrinello, D title: Separated hemocyte populations from the ascidian Ciona intestinalis contain and release in vitro opsonizing Ca2+-independent and β-galactoside specific lectins date: 2007-06-14 words: 7760 flesch: 52 summary: Key words: hemocyte lectins; hemagglutinins: β-galactosides; phagocytosis; opsonization; hemocytes; tunicates; Ciona intestinalis Introduction Animal lectins, usually revealed by their hemagglutinating activity, are components of a well- conserved protein-carbohydrate recognition mechanism that function in a variety of biological systems (Feizi, 2000; Sharon and Lis, 2003, 2004). In invertebrates, the defence responses are mainly based on hemocyte types that release humoral factors, including lectins, lysins, clotting and antibacterial proteins (Loker et al., 2004), or display cell-linked activities (Parrinello, 1996; Parrinello et al., 2003). keywords: activity; amoebocytes; cells; erythrocytes; hemagglutinating; hemocyte; hls; lectins; lysate; medium; n.i; parrinello; phls; supernatant; yeast cache: isj-143.pdf plain text: isj-143.txt item: #41 of 465 id: isj-145 author: Malagoli, D; Marchetti, M; Gobba, F title: Detection of HSP27-like molecules in the annelid Enchytraeus japonensis after exposure to extremely low frequency magnetic fields (50 Hz) date: 2007-07-09 words: 3093 flesch: 47 summary: As small HSPs exert their cytoprotective role via antioxidant, antiapoptotic and actin-stabilizing properties during cell stress (Ciocca et al., 1993; De Franco et al., 2004; Franklin et al., 2005), we can conclude that a single 2 h exposure to 400 μT ELF-MF is not able to influence significantly cell integrity and HSP27 expression in the pot worm E. japonensis. After the pioneering work performed by Goodman’s group (1976) on the slime mold Physarum polycephalum, studies were subsequently carried out on the insects Sciara coprophila and Drosophila melanogaster, the molluscs Cepea nemoralis and Mytilus galloprovincialis and the nematode Caenorhabditis elegans (Kavaliers et al., 1991; Goodman et al., 1995; Junkersdorf et al., 2000; Miyakawa et al., 2001; Ottaviani et al., 2002; Gobba et al., 2003; Malagoli et al., 2003, 2004, 2006). keywords: animals; effects; elf; exposure; fields; hsp27; japonensis; malagoli; mfs cache: isj-145.pdf plain text: isj-145.txt item: #42 of 465 id: isj-146 author: Rajabi Kanafi, R; Ebadi, R; Mirhosseini, S Z; Seidavi, A R; Zolfaghari, M; Etebari, K title: A review on nutritive effect of mulberry leaves enrichment with vitamins on economic traits and biological parameters of silkworm Bombyx mori L. date: 2007-08-02 words: 4693 flesch: 52 summary: Das S, Medda A. Effect of cyanocobalamine on protein and nucleic acid contents of ovary of silkworm, Bombyx mori L., during larval, pupal and adult stages of development. Performance of silkworm (Bombyx mori L.) fed with vitamin and mineral supplement. keywords: acid; bombyx; effect; growth; leaves; mori; mulberry; silkworm; vitamin; weight cache: isj-146.pdf plain text: isj-146.txt item: #43 of 465 id: isj-147 author: Malagoli, D title: A full-length protocol to test hemolytic activity of palytoxin on human erythrocytes date: 2007-09-18 words: 2620 flesch: 50 summary: Red cell suspensions (1 ml of final volume) were incubated with an aqueous solution (Taniyama et al., 2003) of PTX standard, from 10-3 to 103 ng/ml. As it has been observed from a long time (Habermann and Chhatwal, 1982), PTX effects on human erythrocytes are completely reverted by the glycoside ouabain (Taniyama et al., 2001). keywords: activity; erythrocytes; hemolysis; palytoxin; ptx; taniyama cache: isj-147.pdf plain text: isj-147.txt item: #44 of 465 id: isj-148 author: Gerber, S; Cadet, P; Sheehan, M; Stefano, G B; Mantione, J J title: Vertebrate interleukins originated in invertebrates? date: 2007-10-30 words: 3053 flesch: 44 summary: Tumor necrosis factor (TNF)-like molecules present TNFRSF11A Tumor necrosis factor receptor superfamily, member 11a, activator of NFKB TNFRSF25; KIAA0720 Tumor necrosis factor receptor superfamily, member 25; putative NFKB activating protein Interleukins-like molecules present IL16 Interleukin 16 (lymphocyte chemoattractant factor) SDFR1 Stromal cell derived factor receptor 1 C17 Cytokine-like protein C17 EPOR Erythropoietin receptor CSF2RB Colony stimulating factor 2 receptor, beta, low-affinity (granulocyte-macrophage) ACVR2B Activin A receptor, type IIB NRP1 Neuropilin 1 PBEF1 Pre-B-cell colony enhancing factor 1 OBRGRP; LEPR Leptin receptor gene-related protein; Leptin receptor TLT4 TREM-like transcript 4 LOC392255 Similar to growth differentiation factor 16 aforementioned molecules upon stimulation with a neuroimmune effecter using microarray, ganglia were incubated at 4 °C in filtered seawater or treated with 1 μM morphine for 18 h. Applied Biosystems expression array analysis Applied Biosystems Human Genome Survey Arrays were used to analyze the transcriptional profiles of RNA samples. keywords: cell; chemokine; factor; genes; interleukin; molecules; motif; receptor; stefano; tumor cache: isj-148.pdf plain text: isj-148.txt item: #45 of 465 id: isj-149 author: Negrão-Corrêa, D; Pereira, C A J; Rosa, F M; Martins-Souza, R L; Andrade, Z A; Coelho, P M Z title: Molluscan response to parasite: Biomphalaria and Schistosoma mansoni interaction date: 2007-11-07 words: 8083 flesch: 48 summary: Phagocytosis of latex beads by Biomphalaria glabrata hemocytes is modulated in a strain-specific manner by absorbed plasma components. Nevertheless, some authors (Matricon- Gondran, 1990; Souza and Andrade, 2006) demonstrated that B. glabrata hemocytes may present multi-centric origin, and sites with proliferation of hemocytes were detected also at the saccular portion of the renal tubules and in the ventricular cavity of the heart (Fig. 1B). keywords: bayne; biomphalaria; biomphalaria glabrata; et al; glabrata; hemocytes; hemolymph; infection; mansoni; parasite; s. mansoni; schistosoma; snail; species; sporocysts; taim; tenagophila cache: isj-149.pdf plain text: isj-149.txt item: #46 of 465 id: isj-15 author: Chen, X; Zhen, H; Wu, S; Lu, Q; Pang, Q; Zhao, B title: RNAi of CNS-expressed gene DjSlk induces morphogenetic malformation and death in planarian Dugesia japonica date: 2016-12-13 words: 3240 flesch: 62 summary: Quantitative real-time PCR Quantitative real-time PCR was used to monitor the quantitative expression of the DjSlk as described previously (Yu et al., 2015) in intact planarians, regenerating trunk fragments， and regenerating trunk fragments of RNAi-treated planarians at different times after amputation. In intact planarians, DjSlk was expressed in central nervous system which possesses an inverted U-shaped pair of cephalic ganglia and two longitudinal ventral nerve cords that project posteriorly along the worm (Cebrià et al., 2002; Cebrià, 2007; Agata and Umesono, 2008) (Fig. 3B). keywords: animals; cell; djslk; expression; fig; kinase; planarian; regeneration; rnai; ste20 cache: isj-15.pdf plain text: isj-15.txt item: #47 of 465 id: isj-150 author: Salvioli, S; Tieri, P; Castellani, G; Capri, M; Barbi, C; Santoro, A; Altilia, S; Invidia, L; Pierini, M; Bellavista, E; Monti, D; Franceschi, C title: Longevity genes across species: conservation versus evolvability date: 2007-11-11 words: 5932 flesch: 56 summary: A possible positive role in longevity for specific somatic mutations of the mtDNA has also been postulated basing on studies on humans (Zhang et al., 2003; Niemi et al., 2005; Rose et al., 2007). ISJ 4: xxx-yyy, 2007 ISJ 4: 112-118, 2007 ISSN 1824-307X REVIEW Longevity genes across species: conservation versus evolvability S Salvioli1,2,3, P Tieri1,2, G Castellani2,4, M Capri1, C Barbi1, A Santoro1,2, Serena Altilia1,2, L Invidia1,2, M Pierini1,2, E Bellavista1,2, D Monti5, C Franceschi1,2,3,6 1 Department of Experimental Pathology, University of Bologna, 40126 Bologna, Italy 2 Interdepartmental Center “L. Galvani” (C.I.G.), University of Bologna, 40126 Bologna, Italy 3 ER-GenTech laboratory, 44100 Ferrara, Italy 4 DIMORFIPA, University of Bologna,, 40064 Ozzano dell'Emilia, Italy 5 Department of Experimental Pathology and Oncology, University of Florence, 50134 Florence, Italy 6 Department of Gerontological Science, Italian National Research Centre on Aging (INRCA), 60131 Ancona, Italy Accepted November 11, 2007 Abstract The search for longevity genes has greatly developed in recent years basing on the idea that a consistent part of longevity is determined by genetics. keywords: aging; animals; et al; genes; genetics; humans; life; longevity; models; mtdna; span; species; studies cache: isj-150.pdf plain text: isj-150.txt item: #48 of 465 id: isj-151 author: Cermenati, G; Corti, P; Caccia, S; Giordana, B; Casartelli, M title: A morphological and functional characterization of Bombyx mori larval midgut cells in culture date: 2007-11-12 words: 5857 flesch: 57 summary: Columnar cells displayed a well developed cytoskeletal arrangement, with actin filaments highly organized within the thick brush border and distributed in faint filaments in the cell cytoplasm. Key words: Bombyx mori larval midgut; stem cells; columnar cells in culture; cytoskeletal scaffolding; digestive enzymes; protein uptake Introduction The lepidopteran midgut is formed by a folded epithelial cells monolayer, separated from underlying muscles and tracheae by a thin basal membrane and composed by three main cell types, goblet, columnar, stem cells (Cioffi, 1979; Baldwin and Hakim, 1991), and by fewer endocrine cells. keywords: cells; columnar; columnar cells; culture; differentiation; epithelium; fig; insect; midgut; min; mori; stem cache: isj-151.pdf plain text: isj-151.txt item: #49 of 465 id: isj-152 author: Bowden, L; Dheilly, N M; Raftos, D A; Nair, S V title: New immune systems: pathogen-specific host defence, life history strategies and hypervariable immune-response genes of invertebrates date: 2007-12-14 words: 6430 flesch: 52 summary: However, based on their expression patterns, 185/333 proteins appear to be involved in immune responses. The frequency of 185/333 mRNAs increases 70-fold during bacterial infections, and 185/333 transcripts can comprise more than 60 % of the mRNA specifically induced by immune responses (Nair et al., 2005). keywords: 185/333; diversity; et al; families; gene; immunity; invertebrates; pathogen; proteins; responses; selection; smith; specific; systems cache: isj-152.pdf plain text: isj-152.txt item: #50 of 465 id: isj-153 author: Manaboon, M; Iga, M; Sakurai, S title: Nongenomic and genomic actions of an insect steroid coordinately regulate programmed cell death of anterior silk glands of Bombyx mori date: 2008-02-04 words: 8412 flesch: 55 summary: Abstract The insect steroid hormone 20-hydroxyecdysone (20E) induces programmed cell death of larva- specific tissues at pupal metamorphosis. Although 20E elicits early gene activation, an additional 20E stimulus is required for completion of cell death. keywords: 20e; activation; bombyx; ca2; camkii; caspase-3; cell; cell death; death; dna; drosophila; ecr; et al; glands; insect; nongenomic; nuclear; pathway; protein; receptor; silk; steroid cache: isj-153.pdf plain text: isj-153.txt item: #51 of 465 id: isj-154 author: Adamo, S A title: Norepinephrine and octopamine: linking stress and immune function across phyla date: 2008-02-08 words: 5841 flesch: 60 summary: The consistent connection between acute stress, NE (vertebrates and molluscs) or OA (insects) and immune function suggests that modulating immune function during acute stress serves an important adaptive function. In molluscs, acute stress transiently suppresses immune function and increases susceptibility to bacterial infection (Table 1). keywords: acute; adamo; effects; et al; function; hypothesis; immune; immunosuppression; infection; insect; octopamine; response; stress cache: isj-154.pdf plain text: isj-154.txt item: #52 of 465 id: isj-155 author: Zibaee, A; Sendi, J J; Alinia, F; Etebari, K title: A study on biochemical differences among five different groups of rice striped stem borer Chilo suppressalis Walker (Lepidoptera: Pyralidae) date: 2008-02-21 words: 5604 flesch: 55 summary: Because in Go area those varieties were planted that was more susceptible to rice stem borer than those in Ba, hence, type of planted variety caused differences among these five different groups. 26 Fig. 5 Hierarchical cluster of five populations of rice striped stem borer based on all biochemical parameters. 0.0000 Sheikhmahale (Sh) 12.864 0.0000 Rasht (Ra) 6.1312 9.0180 0.0000 Baboul (Ba) 12.785 15.186 10.314 0.0000 Amoul (Am) 13.149 6.0702 7.5441 6.9349 0.0000 Table 3 Genetic distance among five different populations of rice striped stem borer based on non-enzymatic compounds Populations Go Sh Ra Ba Am Gourabzarmikh (Go) 0.0000 Sheikhmahale (Sh) 5.8316 0.0000 Rasht (Ra) 6.8027 keywords: activity; borer; enzyme; groups; iran; larvae; population; rice; silkworm; stem; study cache: isj-155.pdf plain text: isj-155.txt item: #53 of 465 id: isj-156 author: de Eguileor, M; Grimaldi, A; Tettamanti, G; Valvassori, R title: IXth scientific meeting of the Italian Association of Developmental and Comparative Immunobiology (IADCI), 27 - 29 February 2008, Biological Departments, University of Insubria, Varese, Italy date: 2008-02-29 words: 8867 flesch: 35 summary: After 10-15 min, as a transitory plug of floccular and colloidal material formed in the lumen of the siphon by exocytosis of some SGC, other ones with engulfed bacteria crossed the epidermis of the siphon reaching the siphonal sinus; cells of the cytotoxic blood cell line (morula cells) were drawn and crowded into the siphonal sinus, where most of them were positive to anti- TNF-α and anti-CD57 antibodies and degranulated stimulating, after this time and until 12 h, large scavenger phagocytes. A novel rhamnose-binding lectin from the colonial ascidian Botryllus schlosseri N Franchi, F Gasparini, B Spolaore1, L Ballarin Department of Biology, University of Padua, Padua, Italy 1CRIBI, University of Padua, Padua, Italy Lectins are carbohydrate-binding proteins which agglutinate cells and/or precipitate glycoconjugates. keywords: activity; analysis; bacteria; bass; biology; cd4; cells; department; expression; genes; hemocytes; immune; italy; molecules; number; padua; present; responses; results; sea; species; system; teleost; university cache: isj-156.pdf plain text: isj-156.txt item: #54 of 465 id: isj-157 author: Zappavigna, V title: Developed to cull: how a master control gene of development turned into a regulator of innate immune homeostasis date: 2008-03-13 words: 1760 flesch: 38 summary: The reason for this selective exclusion of AMP gene expression was found in the specific repressive action of the Caudal (Cad) homeodomain transcription factor, as Ryu et al. (2008) elegantly demonstrate. A911 bacteria were furthermore found to be sensitive to AMPs, whereas G707 bacteria were much less so, thus explaining their rise in number in Cad knock-down AMP- expressing Drosophila guts. keywords: commensal; drosophila; gene; gut; innate cache: isj-157.pdf plain text: isj-157.txt item: #55 of 465 id: isj-158 author: Barcia, R; Ramos-Martinez, J I title: Effects of interleukin-2 on nitric oxide production in molluscan innate immunity date: 2008-04-29 words: 4350 flesch: 51 summary: Their morphological features include an irregular shape, a small nucleus in relation to cell size and presence of numerous granules (Krupa et al., 1977; Joky et al., 1983; Ottaviani and Franchini, 1988; Ottaviani et al., 1998a; Cao et al., 2003). In the particular case of Mytilus galloprovincialis, both cell types seem to correspond to two maturation stages of the same cell (Ottaviani et al., 1998a). keywords: barcia; cell; et al; galloprovincialis; hemocytes; immune; mytilus; nitric; ottaviani; oxide; production; synthesis cache: isj-158.pdf plain text: isj-158.txt item: #56 of 465 id: isj-159 author: Malagoli, D; Casarini, L; Fiori, F; Ottaviani, E title: Cytotoxic activity by the mussel Mytilus galloprovincialis and the Venus clam Chamelea gallina in the Adriatic sea in 2007 date: 2008-05-13 words: 2302 flesch: 56 summary: ISJ 5: 50-xx, 2008 ISJ 5: 50-53, 2008 ISSN 1824-307X SHORT COMMUNICATION Cytotoxic activity by the mussel Mytilus galloprovincialis and the Venus clam Chamelea gallina in the Adriatic sea in 2007 D Malagoli, L Casarini, F Fiori1, E Ottaviani Department of Animal Biology, University of Modena and Reggio Emilia, Modena, Italy 1COOP M.A.R.E. Soc. To verify whether our considerations could also be extended to other bivalves, we here present data concerning the fluctuations of cytotoxic activity in both M. galloprovincialis and the Venus clam, Chamelea gallina, during 2007. keywords: activity; gallina; galloprovincialis; malagoli; mussel cache: isj-159.pdf plain text: isj-159.txt item: #57 of 465 id: isj-16 author: Gagné, F; Gélinas, M; Fortier, M; Fournier, M title: The effects of cyanobacterial blooms on the immune system of Elliptio complanata in urban and agricultural areas in the Yamaska River watershed date: 2018-02-06 words: 7929 flesch: 46 summary: The number of blue-green algae increased considerably during the fall at CHO site exclusively (Table 1). No toxins were detected at any site in the summer, but during just one month in September at CHO site. keywords: activity; blooms; boi; cho; difference; fall; gst; hemocyte; levels; lsp; mussels; phagocytosis; production; ros; site; summer; urban; yam cache: isj-16.pdf plain text: isj-16.txt item: #58 of 465 id: isj-160 author: Ballarin, L title: Immunobiology of compound ascidians, with particular reference to Botryllus schlosseri: state of art date: 2008-05-29 words: 15723 flesch: 54 summary: This event induces selective crowding of MCs inside the ampullae of the growing edge, their migration through the epithelium of the ampullar tips into the tunic, and their final degranulation, with the consequent release of their vacuolar content (Taneda and Watanabe, 1982a; Sabbadin et al., 1992; Saito et al., 1994; Rinkevich et al., 1998; Cima et al., 2006c), in particular, the enzyme PO and its polyphenol substrata, which contribute to inducing the observed cytotoxicity (Fig. 6; Ballarin et al., 1995, 1998; Cima et al., 2004, 2006c). In colonial botryllid ascidians, especially in the species Botryllus schlosseri, hemocytes have been particularly investigated for their role in immunity (Ballarin et al., 1993, 1995; Cima et al., 1996, 2001; Ballarin and Cima, 2005). keywords: activity; allorecognition; ascidian; ballarin; ballarin et; biol; blood; botryllus; botryllus schlosseri; burighel; cells; cima; cima et; colonial; colonies; colony; compound; dev; et al; fig; fusion; hemocytes; immunol; mcs; molecules; phagocytes; phagocytosis; reaction; recognition; rinkevich; sabbadin; schlosseri; species; tunic; tunicate; watanabe; zool cache: isj-160.pdf plain text: isj-160.txt item: #59 of 465 id: isj-161 author: Tasiemski, A title: Antimicrobial peptides in annelids date: 2008-06-11 words: 5720 flesch: 49 summary: ISJ 5: xx-yy, 2008 ISJ 5: 75-82, 2008 ISSN 1824-307X REVIEW Antimicrobial peptides in annelids A Tasiemski Laboratoire de Neuroimmunologie des Annélides (LNA), CNRS FRE2933, «Groupe signaux de danger, voies de signalisation et effecteurs», Université de Lille1, France Accepted June 11, 2008 Abstract Gene encoded antimicrobial peptides (AMPs) are widely distributed among living organisms including plants, invertebrates and vertebrates. Key words: antimicrobial peptides; annelids; lophotrochozoan; immunity Introduction Numerous studies on the effectors of the innate immune system have demonstrated the contribution of AMP to the host defense (Zasloff, 2002). keywords: activity; amps; annelids; bacteria; cells; cysteine; et al; gene; gram; hedistin; immunity; leech; neuromacin; peptide; response; theromacin cache: isj-161.pdf plain text: isj-161.txt item: #60 of 465 id: isj-162 author: Parrinello, N; Arizza, V; Cammarata, M; Vazzana, M; Vizzini, A title: II scientific meeting of the Italian Ascidiologists, 30 June – 1 July 2008, Department of Animal Biology, University of Palermo, Palermo, Italy date: 2008-07-01 words: 12140 flesch: 28 summary: With series of thick (1 µm) and thin sections we have evidenced that two kind of sensory cells are present in the oral siphon of pyrosomes. Collocytes with secretory activity, sensory cells and columnar axial cells come into sight also in C. intestinalis papillae. keywords: activity; analysis; ascidian; biology; cells; ciona; ciona intestinalis; department; development; expression; genes; genome; intestinalis; italy; larvae; like; molecules; neurons; palermo; papillae; presence; role; species; swimming; system; tbt; university; vertebrates cache: isj-162.pdf plain text: isj-162.txt item: #61 of 465 id: isj-163 author: Ghadamyari, M; Sendi, J J title: Resistance mechanisms to oxydemeton-methyl in Tetranychus urticae Koch (Acari: Tetranychidae) date: 2008-07-21 words: 3903 flesch: 57 summary: Resistant strain has high potential to develop cross-resistance to parathion since the AChE from resistant strain showed 7.8-fold insensitivity to ethyl paraoxon and this strain had no previous exposure to parathion. The kinetic characteristics acetylcholinesterase (AChE) showed that the AChE of resistant strain had lower affinity to artificial substrates; acetylthiocholine and butyrylthiocholine than that of susceptible strain. keywords: ache; activity; methyl; mite; oxydemeton; resistant; spider; strain; tetranychus; urticae cache: isj-163.pdf plain text: isj-163.txt item: #62 of 465 id: isj-164 author: Brehélin, M; Roch, P title: Specificity, learning and memory in the innate immune response date: 2008-07-29 words: 4530 flesch: 57 summary: Consequently, the observed specificity of D. melanogaster immune responses may be related to the selection of specific isoforms of receptors (Agaisse, 2007), as also suggested for molluscs (Zhang et al., 2004), or to synergism between receptors (Schulenburg et al., 2007). This is exactly what differentiates between innate and adaptive immunity and has led some authors to speculate on adaptive aspects of immune responses in invertebrates (Flajnik and Du Pasquier, 2004; Agaisse, 2007; Kurtz, 2005; Kvell et al., 2007; Pham et al., 2007). keywords: et al; immune; immunity; invertebrates; learning; melanogaster; memory; pathogen; response; specificity cache: isj-164.pdf plain text: isj-164.txt item: #63 of 465 id: isj-165 author: Sheehan, D; McDonagh, B title: Oxidative stress and bivalves: a proteomic approach date: 2008-09-03 words: 9698 flesch: 48 summary: Protein identification is achieved either by peptide mass mapping (or fingerprinting) (Thiede et al., 2003) or by peptide sequencing (Wu et al., 2006). Rapid interrogation/analysis of sequence databases is made possible with powerful bioinformatics programs (Wu et al., 2006; Palagi et al., 2006; Domon and Aebersold, 2006b). keywords: analysis; approach; biochem; biomarkers; bivalves; edulis; electrophoresis; environmental; et al; gel; identification; marine; mass; mussels; mytilus; oxidative; pollution; proteins; proteomics; redox; response; ros; sheehan; species; stress; studies cache: isj-165.pdf plain text: isj-165.txt item: #64 of 465 id: isj-166 author: Fuller-Espie, S L; Goodfield, L; Hill, K; Grant, K; DeRogatis, N title: Conservation of cytokine-mediated responses in innate immunity: a flow cytometric study investigating the effects of human proinflammatory cytokines on phagocytosis in the earthworm Eisenia hortensis date: 2008-09-12 words: 7052 flesch: 54 summary: Preincubation of earthworm coelomocytes in vitro with either interleukin-1 beta (IL-1 beta), granulocyte-macrophage colony stimulating factor (GM- CSF), interleukin-2 (IL-2), or tumor necrosis factor-alpha (TNF-alpha) followed by subsequent bacterial challenge was carried out to investigate whether human proinflammatory cytokines would induce a state of enhanced responsiveness in phagocytic cells derived from the coelomic cavity of E. hortensis. 1 Typical scatter profile of earthworm coelomocytes using flow cytometry. keywords: alpha; beta; coelomocytes; csf; cytokines; earthworms; il-1; phagocytosis; r t; t t; tnf cache: isj-166.pdf plain text: isj-166.txt item: #65 of 465 id: isj-167 author: Fabbri, E; Valbonesi, P; Franzellitti, S title: HSP expression in bivalves date: 2008-09-26 words: 21377 flesch: 60 summary: These relationships are presently under active investigation in mammals, and initial findings suggest that they may also apply to bivalves (Lacoste et al., 2001a). 135 mailto:elena.fabbri@unibo.it The terminology used is in accordance with the following criteria: capital letters are used to refer to whole HSP or the whole family (e.g., HSP70). The response was rapid and transient, according to the duration of the stress exposure (Lacoste et al., 2001c). keywords: bands; biol; bivalves; cell; conditions; domain; edulis; effects; et al; exposure; expression; family; galloprovincialis; gene; gigas; gills; heat; heat shock; hofmann; hsp70; hsp70 expression; human; inducible; induction; kda; levels; mussels; mytilus; organisms; oyster; piano; protein; response; role; sequence; shock; shock response; species; stress; stress response; temperature cache: isj-167.pdf plain text: isj-167.txt item: #66 of 465 id: isj-168 author: Zhao, X F; Wang, J X title: The antimicrobial peptides of the immune response of shrimp date: 2008-10-23 words: 10824 flesch: 60 summary: Similarly, these lysozymes had been reported in several shrimps, such as L. vannamei (Sotelo-Mundo et al., 2003; de-la-Re- Vega et al., 2006; Burge et al., 2007; Xing et al., in press), M. japonicus (Hikima et al., 2003), P. monodon, (Xing et al., in press), P. semisulcatus (Xing et al., in press) and F. chinensis (Bu et al., 2008). Yepiz- Plascencia et al., 1998; Jimenez-Vega et al., 2002; Roux et al., 2002; Sritunyalucksana et al., 2002; Romo-Figueroa et al., 2004; Cheng et al., 2005; Du et al., 2007; Lin et al., 2008) and the C-type lectins (Luo et al., 2006; Liu et al., 2007; Sun et al., 2008). keywords: activities; activity; alf; amps; anti; bacteria; chinensis; crustin; cysteine; domain; et al; expression; functions; gram; hemocytes; immunol; litopenaeus; lva; lysozyme; microbial; monodon; penaeid; peptides; protein; shrimp; swd; type; vannamei; wap cache: isj-168.pdf plain text: isj-168.txt item: #67 of 465 id: isj-169 author: Zibaee, A; Bandani, A R; Ramzi, S title: Lipase and invertase activities in midgut and salivary glands of Chilo suppressalis (Walker) (Lepidoptera, Pyralidae), rice striped stem borer [For this article an Erratum has been published] date: 2008-11-04 words: 5321 flesch: 64 summary: The enzyme activity was reduced by addition of NaCl, KCl, MgCl2, SDS, urea and plant extracts from Artemisia annua, but not by CaCl2 which enhanced enzyme activity. Hence, characterization of insect digestive enzymes, especially examination of inhibition effects on enzyme activity, could be useful in developing new strategies for pest control. keywords: activity; borer; control; enzyme; insect; invertase; lipase; midgut; min; rice; salivary cache: isj-169.pdf plain text: isj-169.txt item: #68 of 465 id: isj-17 author: Liu, X; Wang, M; Shao, J; Wang, B; Jiang, K; Liu, M; Wang, L title: Molecular cloning and characterization of Rheb from white shrimp (Litopenaeus vannamei) date: 2018-02-11 words: 5234 flesch: 62 summary: So, we injected shrimps which were deprived of food for three days with leucine, arginine or rapamycin alone or leucine and rapamycin combination to explore the regulation of Rheb expression related to mTOR pathway under these circumstances. The mRNA expression profiles of Rheb in muscle after the stimulation with rapamycin were promoted, which further proved that Rheb protein could be a feedback regulator to mTOR signaling pathway. keywords: acid; amino; cell; control; et al; expression; mrna; mtor; mtorc1; pcr; rapa; rheb; sequence; signaling cache: isj-17.pdf plain text: isj-17.txt item: #69 of 465 id: isj-170 author: Zibaee, A; Bandani, A R; Ramzi, S title: Erratum to: Lipase and invertase activities in midgut and salivary glands of Chilo suppressalis (Walker) (Lepidoptera, Pyralidae), rice striped stem borer [5: 180-189, 2008] date: 2008-12-04 words: 237 flesch: 62 summary: In the above article Table 2 was reproduced incorrectly, the table and caption should have appeared as below: Table 2 Relative activity of C. suppressalis invertase towards different compounds Compounds Concentration (mmol/l) Relative activity (midgut) Relative activity (salivary gland) Control - 100 100 NaCl 5 83.33 152.63* 10 63.88* 121.05* 20 41.66* 94.7* 40 10* 52.63* CaCl2 5 25.83* 78.94* 10 66.66* keywords: activity cache: isj-170.pdf plain text: isj-170.txt item: #70 of 465 id: isj-171 author: Ballarin, L; Cammarata, M; Cima, F; Grimaldi, A; Lorenzon, S; Malagoli, D; Ottaviani, E title: Immune-neuroendocrine biology of invertebrates: a collection of methods date: 2008-12-05 words: 19004 flesch: 54 summary: The percentage of stained cells is then determined and expressed as the GSH index. a) schematic drawing of a culture chamber with a drop of cell suspension in the center A: upper view; B: side view. keywords: activity; anti; assay; blue; buffer; cells; coverslips; et al; fig; fsw; hemocytes; hemolymph; immunocytes; incubation; invertebrate; light; microscope; min; mixture; ottaviani; pbs-3; reaction; schlosseri; serum; sigma; slides; solution; water cache: isj-171.pdf plain text: isj-171.txt item: #71 of 465 id: isj-172 author: Ottaviani, E; Malagoli, D title: Around the word stress: its biological and evolutive implications date: 2009-01-07 words: 4188 flesch: 57 summary: Kew Words: stressors; stress response; vertebrates; invertebrates; evolution Eustress and distress, not simply “stress” Among the general public, the word stress evokes a concept of negativity, which is maintained even among those that have, or should have, knowledge of biology. The present paper aims to provide a correct interpretation of the concept of stress, and especially to emphasize the importance of its positivity, i.e., the role played by stress response in the survival of all animal species on the Earth and maintained during evolution. keywords: cells; et al; immune; level; malagoli; molecules; neuroendocrine; ottaviani; response; stress; stress response; system cache: isj-172.pdf plain text: isj-172.txt item: #72 of 465 id: isj-173 author: Dunn, S R title: Immunorecognition and immunoreceptors in the Cnidaria [For this article an Erratum has been published] date: 2009-01-29 words: 5361 flesch: 53 summary: Key Words: Cnidaria; immunity; symbiosis; pathogen; Symbiodinium; PAMP; PRR Introduction Gene function and cellular pathways in higher vertebrates, including humans, have increasingly shown to be highly conserved through metazoan evolution from the discovery of homologues in basal metazoans, such as sponges and cnidarians (Kortschak et al., 2003; Kuo et al., 2004; Kusserow et al., 2005; Dunn et al., 2006; Hemmerich et al., 2007). These particular peptides have been shown to have important therapeutic qualities as potent antibiotics against drug resistant human pathogens (Bosch et al., in press). keywords: bosch; cell; cnidarians; complement; coral; death; domain; et al; host; hydra; pathways; peptides; receptors; response; symbiosis; tlr cache: isj-173.pdf plain text: isj-173.txt item: #73 of 465 id: isj-174 author: Drago, F; Malagoli, D; Pezzino, F M; D’Urso, V; Sammartano, F title: Presence of a low molecular weight lectin in the coelomic fluid of the sea urchin Paracentrotus lividus date: 2009-02-01 words: 3627 flesch: 57 summary: Lectins have been retrieved in almost all forms of life, and animal lectins, though fulfilling a variety of functions, have been implicated in defense against pathogens, immune regulation and prevention of autoimmunity (Kilpatrick, 2002). Animal lectins: a historical introduction and overview. keywords: fluid; hemagglutinating; kda; lectin; lividus; sea cache: isj-174.pdf plain text: isj-174.txt item: #74 of 465 id: isj-175 author: Dunn, S R title: Erratum to: Immunorecognition and immunoreceptors in the Cnidaria [6: 7-14, 2009] date: 2009-02-03 words: 89 flesch: 38 summary: [6: 7-14, 2009] SR Dunn Center for Marine Studies, University of Queensland, Australia In the above article Affiliation was reproduced incorrectly, and it should have appeared as below: SR Dunn Center for Marine Studies and ARC Centre for Excellence for Coral Reef Studies, The University of Queensland, St Lucia, Brisbane, QLD 4072, Australia 21 Gene function and cellular pathways in higher vertebrates, including humans, have increasingly shown to be highly conserved thr ISJ 6: 21, 2009 keywords: studies cache: isj-175.pdf plain text: isj-175.txt item: #75 of 465 id: isj-176 author: Betti, M; Balsamo, M; Papa, S title: Xth scientific meeting of the Italian Association of Developmental and Comparative Immunobiology (IADCI), 18 - 20 February 2009, Department of Human, Environmental and Natural Sciences, University of Urbino “Carlo Bo”, Urbino, Italy date: 2009-02-20 words: 7843 flesch: 34 summary: When analysing transcripts from fish challenged with Phda, proinflammatory peptides IL-1 and Cox-2 showed a potent stimulation at 6 h after challenge, whereas T cell genes were only slightly upregulated after boosting. The results support the hypothesis that common pathways involved in modulating activity, proliferation and differentiation of immune cells are conserved from molluscs to mammals. keywords: activity; analysis; biology; cells; department; effects; environmental; expression; fish; genes; hemocytes; human; immune; italy; molecules; proteins; response; results; sea; structure; university; urbino cache: isj-176.pdf plain text: isj-176.txt item: #76 of 465 id: isj-177 author: Hatanaka, R; Sekine, Y; Hayakawa, T; Takeda, K; Ichijo, H title: Signaling pathways in invertebrate immune and stress response date: 2009-03-04 words: 8346 flesch: 61 summary: In fact, the genetic evidence that the stress-responsive MAPK pathways play pivotal roles not only in stress response but also in innate immunity was first revealed in analyses using these more rudimentary animals models (Boutros et al., 2002; Kim et al., 2002). The mitogen-activated protein kinase (MAPK) pathways, especially those converging on two subgroups of stress-responsive MAPKs, JNK and p38, are the major players in a wide variety of response to these stressors (Widmann et al., 1999; Kyriakis and Avruch, 2001). keywords: caenorhabditis; cell; daf-16; daf-2; drosophila; elegans; et al; genes; immune; immunity; insulin; jnk; kinase; mapk; pathways; pgrp; protein; recognition; response; signaling; stress; toll cache: isj-177.pdf plain text: isj-177.txt item: #77 of 465 id: isj-178 author: Ciacci, C; Fabbri, R; Betti, M; Roch, P; Canesi, L title: Seasonal changes in functional parameters of the hemolymph of Mytilus galloprovincialis date: 2009-04-07 words: 3235 flesch: 51 summary: Key Words: Mytilus; hemocytes; lysosomal membrane stability; phagocytosis; lysozyme; immune parameters; seasonal variation Introduction Bivalves (such are mussels, clams and oysters) possess both cellular and humoral defence mechanisms that co-operate to kill and eliminate invading bacteria (Mitta et al., 2000; Canesi et al., 2002). Hemocytes are responsible for cell-mediated immunity through phagocytosis and various cytotoxic reactions, such as the release of lysosomal enzymes and antimicrobial peptides, and the production of oxygen metabolites (Mitta et al., 2000, Canesi et al., 2002). keywords: activity; canesi; et al; galloprovincialis; hemocytes; lysosomal; mytilus; parameters; values cache: isj-178.pdf plain text: isj-178.txt item: #78 of 465 id: isj-179 author: Sokolova, I M title: Apoptosis in molluscan immune defense date: 2009-04-20 words: 7794 flesch: 37 summary: Protein kinase A (but not protein kinase C) also appears to be involved in molluscan hemocyte apoptosis; in the case of noradrenaline-induced apoptosis, inhibition of PKA but not PKC activity attenuated apoptosis levels (Lacoste et al., 2002). Given that the study of molluscan apoptosis is still in its infancy, I will draw on relevant examples from vertebrate literature to illustrate molecular mechanisms and possible immunological roles of apoptosis in protection against parasites, pathogens, and tumors in mollusks. keywords: activation; apoptosis; caspase; cell; cell death; death; defense; et al; hemocytes; host; immune; mechanisms; molluscan; molluscs; parasites; pathogens; pathways; role; studies; system cache: isj-179.pdf plain text: isj-179.txt item: #79 of 465 id: isj-18 author: Malagoli, D title: Going beyond a static picture: the apple snail Pomacea canaliculata can tell us the life history of molluscan hemocytes date: 2018-02-27 words: 3298 flesch: 50 summary: Recently, a few organ-specific transcriptomes have been published (Yang et al., 2017; Zhou et al., 2016), and the Sánchez Alvarado group at the Stowers Institute for Medical Research (Kansas City, MO, USA) is developing an extensive database that includes organ-specific transcriptomes of many adult organs and the transcriptomes of many embryonic stages (Accorsi, personal communication). Advances in the understanding of both regeneration and immune responses are especially interesting, and in the past few years, many researchers have been trying to elucidate the deep relationships between regeneration abilities and characteristics of the immune system by comparing different vertebrate and invertebrate model systems with varying regenerative abilities and types of immune systems (Godwin et al., 2017; Neves et al., 2016; Tasiemski and Salzet, 2017). keywords: accorsi; apple; canaliculata; et al; hemocytes; immune; malagoli; pomacea; system cache: isj-18.pdf plain text: isj-18.txt item: #80 of 465 id: isj-180 author: Kawabata, S; Koshiba, T; Shibata, T title: The lipopolysaccharide-activated innate immune response network of the horseshoe crab date: 2009-05-20 words: 12470 flesch: 54 summary: Brown J, O’callaghan CA, Marshall ASJ, Gilbert RJC, Siebold C, Gordon S, et al. Structure of the fungal β-glucan-binding immune receptor dectin-1: Fujitani N, Kawabata S, Osaki T, Kumaki Y, Demura M, Nitta K, et al. Structure of the antimicrobial peptide tachystatin A. J. Biol. keywords: activity; bacteria; binding; biol; chem; coagulation; complement; crab; domain; et al; factor; factor c; fig; gram; hemocytes; hemolymph; horseshoe; horseshoe crab; iwanaga; kawabata; lps; plasma; protein; recognition; structure; system; tachyplesin; terminal cache: isj-180.pdf plain text: isj-180.txt item: #81 of 465 id: isj-182 author: Parrinello, N title: II° Scientific meeting of the Italian Ascidiologists: dedicated to Professor Giuseppe Reverberi date: 2009-03-13 words: 768 flesch: 24 summary: The genome of some solitary species (Ciona intestinalis, Ciona savignyi, Halocynthia roretzi) has been fully or partially sequenced, analyzed and annotated and can be validated by gene expression patterns for several specific biological properties and activities. The 2008 meeting has been dedicated to the memory of Prof Giuseppe Reverberi who, in the second half of the past century, was devoted to study of ascidian developmental biology. keywords: biology; palermo; university cache: isj-182.pdf plain text: isj-182.txt item: #82 of 465 id: isj-183 author: De Bernardi, F title: Professor Giuseppe Reverberi and the ascidian school in Palermo date: 2009-03-13 words: 4058 flesch: 49 summary: For the above mentioned reasons, I wish to speak about the monumental scientific activity of professor Reverberi, which lasted more than 50 years, and of his outstanding human personality. I was very impressed by the friendly terms between professor Reverberi and all those distinguished embryologists. keywords: ascidians; biology; blastomeres; cells; development; egg; eggs; larvae; results; reverberi cache: isj-183.pdf plain text: isj-183.txt item: #83 of 465 id: isj-184 author: Voskoboynik, A title: Chimerism a natural ability to tolerate kin, evolutionary traits connecting mammalian and protochordates date: 2009-03-13 words: 8750 flesch: 60 summary: Fagan and Weissman, 1997; Pancer et al., 1993, 1996a, b, c, 1997; Muller et al., 1994; Khalturin et al., 2003; De Tomaso et al., 2005; Nyholm et al., 2006). In a few cases, a complete takeover of donor genotype occurred and the whole mass of gonads in the chimeric colony expressed solely the donor’s genotype (Sabbadin and Zaniolo 1979; Pancer et al., 1995; Stoner and Weissman 1996; Stoner et al., 1999). keywords: biol; blood; botryllus; cells; chimeric; chimerism; colonial; colonies; colony; et al; fusion; host; immunol; maternal; parasitism; pregnancy; proc; rejection; rinkevich; sabbadin; schlosseri; sci; stem; tolerance; weissman cache: isj-184.pdf plain text: isj-184.txt item: #84 of 465 id: isj-185 author: Gissi, C; Griggio, F; Iannelli, F title: Evolutionary mitogenomics of Chordata: the strange case of ascidians and vertebrates date: 2009-03-13 words: 5818 flesch: 50 summary: Although the tunicate taxon sampling is still insufficient to draw definitive conclusions, the current data suggest that the tunicate tRNA gene number could vary in a species-specific manner. In spite of the scarce data, it is evident that ascidian mtDNAs possess several unusual features compared to other chordates, such as a fast nucleotide substitution rate (Yokobori et al., 1999, 2005), gene orders that are extremely variable both within the class and compared to other metazoans (Gissi et al., 2004; Yokobori et al., 2005; Iannelli et al., 2007a), and a variable number of tRNA genes (Gissi and Pesole, 2003; Gissi et al., 2004; Iannelli et al., 2007a). keywords: et al; evol; gene; genome; gissi; mitochondrial; mtdna; number; species; strand; table; trna; tunicates; vertebrates cache: isj-185.pdf plain text: isj-185.txt item: #85 of 465 id: isj-186 author: Zega, G; Pennati, R; Candiani, S; Pestarino, M; De Bernardi, F title: Solitary ascidians embryos (Chordata, Tunicata) as model organisms for testing coastal pollutant toxicity date: 2009-03-13 words: 3215 flesch: 39 summary: Moreover, the ultrastructure of sarcomeres and muscle mitochondria appeared completely compromised (Gianguzza et al., 1996) (Table 2). As a consequence, neurulation was blocked (Dolcemascolo et al., 2005) (Table 2). keywords: ascidians; bellas; compounds; development; effects; embryos; intestinalis; larvae; toxicity cache: isj-186.pdf plain text: isj-186.txt item: #86 of 465 id: isj-187 author: Locascio, A; Ristoratore, F; Spagnuolo, A; Zanetti, L; Branno, M title: Genetic perspectives on the ascidian central nervous system date: 2009-03-13 words: 8244 flesch: 49 summary: Regulatory gene expressions in the ascidian ventral sensory vesicle: evolutionary relationships with the vertebrate hypothalamus. The use of comprehensive microarrays has revealed extensive temporal patterns of gene activity (Azumi et al., 2007a) and assisted in the determination of spatial patterns of gene expression within individual blastomeres in sequentially staged embryos (Yamada et al., 2005). keywords: ascidian; biol; cell; chordate; ciona; cns; development; differentiation; et al; expression; gene; intestinalis; pigment; regulatory; sensory; studies; system; vertebrate cache: isj-187.pdf plain text: isj-187.txt item: #87 of 465 id: isj-188 author: Parrinello, N title: Focusing on Ciona intestinalis (Tunicata) innate immune system. Evolutionary implications date: 2009-03-13 words: 9678 flesch: 49 summary: Botryllids provided of allorecognition reaction (De Tomaso and Weissman, 2004; De Tomaso et al. 2005; Ballarin , 2008; Gasparini et al., 2008) and Ciona intestinalis which displays acute inflammatory responses (Parrinello, 1981; Parrinello and Patricolo, 1984; Parrinello et al., 1984) are model organisms for studying chordate evolution. The C. intestinalis TNFα-like cDNA (CiTNFα) has been cloned from the pharynx excised at 4 h after LPS inoculation (Parrinello et al., 2008). keywords: cell; ciona; collagen; complement; components; domain; et al; evolution; expression; genes; genome; hemocytes; human; immune; immunity; immunol; intestinalis; lectin; lps; mhc; molecules; parrinello; receptors; recognition; self; system; type; vertebrate cache: isj-188.pdf plain text: isj-188.txt item: #88 of 465 id: isj-189 author: Arizza, V; Parrinello, D title: Inflammatory hemocytes in Ciona intestinalis innate immune response date: 2009-03-13 words: 6456 flesch: 47 summary: Hyaline amebocytes, with the above characters described for circulating cells, have not been observed in the inflamed tunic tissue, although the possibility exists that infiltrated cells undergo morpho-functional differentiation. Granulocytes characterized by the size and number of their granules They are large cells (ranging from 5.0 to 11.0 µm) with a cytoplasm, partially or almost entirely occupied by great granules containing materials of various density and refractile properties (Rowley, 1981). keywords: activity; amebocytes; cells; ciona; electron; et al; granular; granules; granulocytes; hemocytes; intestinalis; lps; parrinello; tunic cache: isj-189.pdf plain text: isj-189.txt item: #89 of 465 id: isj-19 author: Zdybicka-Barabas, A; Bulak, P; Polakowski, C; Bieganowski, A; Waśko, A; Cytryńska, M title: Immune response in the larvae of the black soldier fly Hermetia illucens date: 2016-12-16 words: 4892 flesch: 57 summary: Electrophoretic analysis of H. illucens hemolymph proteins. Electrophoretic analysis of hemolymph proteins indicated that, despite induction of defense peptides, the bacterial challenge of H. illucens larvae led to appearance of an additional protein with molecular mass approx. keywords: activity; coli; et al; gram; hemolymph; illucens; immune; insect; larvae; peptides cache: isj-19.pdf plain text: isj-19.txt item: #90 of 465 id: isj-190 author: Cattaneo, A G; Gornati, R; Chiriva-Internati, M; Bernardini, G title: Ecotoxicology of nanomaterials: the role of invertebrate testing date: 2009-06-15 words: 14195 flesch: 52 summary: This toxicity apparently is not linked to the residual solvent as, in the absence of fullerene, traces of THF were not toxic (Lovern and Kapler, 2006; Oberdörster et al., 2006a; Zhu et al., 2006; Lovern et al., 2007; Spohn et al., 2009; Zhu et al., 2009). (Lovern and Klaper, 2006; Oberdörster et al., 2006, Zhu et al., 2006; Baun et al., 2008). keywords: acute; bioaccumulation; carbon; chem; daphnia; days; ecotoxicology; effects; environ; environment; et al; exposure; food; freshwater; invertebrates; lc50; magna; nanomaterials; nanoparticles; oberdörster; oberdörster et; oecd; organisms; ppm; reproduction; sci; sediments; size; species; studies; test; testing; tio2; toxicity; toxicol; water cache: isj-190.pdf plain text: isj-190.txt item: #91 of 465 id: isj-191 author: Cammarata, M; Parrinello, N title: The ascidian prophenoloxidase activating system date: 2009-03-13 words: 6544 flesch: 49 summary: A similar cascade has been reported in other invertebrates (Beschin et al., 1998; Parrinello et al., 2001; Luna- Gonzales et al., 2003). Phagocytosis, cytotoxicity, encapsulation and tissue damage (Wright and Cooper, 1983; Parrinello and Patricolo, 1984; Parrinello et al., 1984, 2001, 2007; Ballarin et al., 2008) in inflammatory responses, as well as in inflammatory events linked to allorecognition responses, have been shown (Sabbadin, 1982; Rinkevich, 1992; Raftos et al., 1988). keywords: activation; activity; ascidian; biol; cammarata; cell; et al; hemocytes; intestinalis; molecular; parrinello; parrinello et; phenoloxidase; propo; reaction; smith; system; söderhäll; tunic cache: isj-191.pdf plain text: isj-191.txt item: #92 of 465 id: isj-193 author: Damiani, F; Gianguzza, M; Dolcemascolo, G title: Effects of tributyltin chloride in ascidian embryos: modulation of kinase-mediated signalling pathways date: 2009-03-13 words: 5384 flesch: 56 summary: Different stressors such as heavy metals, pro- oxidants and pollutants are known to stimulate tyrosine kinase signalling (Rahman et al., 1993; Nakashima et al., 1994; Katano et al., 1995; Burlando et al., 2006). TBT effects have been studied in many marine organisms including ascidians, in which immunotoxic effects such as decreasing of phagocytic activity and phenoloxidase activity have been observed (Cooper et al., 1995; Cima et al., 1998; Cima and Ballarin, 2000; Tujula et al., 2001; Arizza et al., 1995; Cima et al., 1995). keywords: ascidian; cell; chloride; control; effects; embryos; erk; et al; intestinalis; kinase; levels; phosphorylation; protein; signalling; tbt; tyrosine; µm tbt cache: isj-193.pdf plain text: isj-193.txt item: #93 of 465 id: isj-194 author: Mandrioli, M title: Insect-symbiont: the key relationship to get in-depth insight on the host choice of bacteria date: 2009-06-26 words: 2570 flesch: 55 summary: The efficient capacity of Asaia of colonizing adults and larvae of A. stephensi and the discovery of this bacterium in other insect vectors (i.e., other Anopheles species and Scaphoideus titanus) rise the question of whether this bacterium can cross- colonize different insect hosts. Key Words: symbiosis; host choice; symbiont genome degeneration; insect-bacteria interaction Introduction Insects are undoubtedly one of the most successful animal group in nature in view of the high number of species and the high number of individuals observed in insect population. keywords: asaia; bacteria; genome; host; insect; moran; symbiosis cache: isj-194.pdf plain text: isj-194.txt item: #94 of 465 id: isj-195 author: Ottaviani, E; Malagoli, D; Franceschi, C title: The invertebrate blueprint of the connection between aging and immune neuroendocrine responses date: 2009-07-13 words: 2698 flesch: 55 summary: These activities share cells and mediators from vertebrates to invertebrates, suggesting a common origin (Ottaviani et al., 2007). These findings offer a molecular and genetic basis for our hypothesis that the immune response and stress (neuroendocrine response) are both highly interconnected and conserved over the course of evolution (Ottaviani and Franceschi, 1997; Ottaviani et al., 2007). keywords: aging; cell; elegans; et al; immune; immunity; neuroendocrine; ottaviani cache: isj-195.pdf plain text: isj-195.txt item: #95 of 465 id: isj-196 author: Altincicek, B title: The innate immunity in the cnidarian Hydra vulgaris date: 2009-07-29 words: 4815 flesch: 52 summary: Several animal species that we examined for immune inducible genes to further understanding of the evolution of innate immunity are written in gray (Altincicek and Vilcinskas, 2007a, b, c, 2008b, c; Altincicek et al., 2008). This is in line with recent observations that the Hydra innate immune system senses tissue injury itself or along with bacterial contamination from the environment to induce the massive production of antimicrobial peptides along 108 with further potential bactericidal or bacteriostatic molecules (Altincicek and Vilcinskas, 2008a; Jung et al., 2008; Bosch et al., 2009). keywords: altincicek; animals; biol; bosch; cell; dev; et al; hydra; immune; immunity; innate; model; regeneration; system; vulgaris cache: isj-196.pdf plain text: isj-196.txt item: #96 of 465 id: isj-197 author: Xylander, W E R title: Hemocytes in Myriapoda (Arthropoda): a review date: 2009-08-05 words: 4989 flesch: 55 summary: The number of hemocyte types investigated differs according to the subtaxon of Arthropoda. Transmission electron microscopy (TEM) investigations have described hemocyte types of chilopods and diplopods directly taken from the haemolymph, after in vitro preparation and partly during immune defense reactions (Nevermann et al., 1991, 1996; Nevermann, 1996; Nevermann and Xylander, 1996, 2006; Hilken et al., 2003). keywords: electron; figs; grana; granular; hemocytes; myriapoda; nevermann; plasmatocytes; type; virgator; vitro; xylander cache: isj-197.pdf plain text: isj-197.txt item: #97 of 465 id: isj-198 author: Vafopoulou, X title: Mechanisms of wound repair in crayfish date: 2009-09-08 words: 8223 flesch: 56 summary: Based on this system, hemocytes have been characterized in several crayfish such as Astacus astacus (Smith and Söderhäll, 1983a), Procambarus zonangulus (Cárdenas et al., 2000), Pacifastacus leniusculus (Wang et al., 2001a), Procambarus clarkii (Vafopoulou et al., 2007) and Astacus leptodactylus (Giulianini et al., 2007). A Drosophila salivary gland mucin is also expressed in immune cells: evidence for a function in coagulation and the entrapment of bacteria. keywords: animals; cells; crayfish; ecdysteroid; ecr; et al; fig; healing; hemocytes; hemolymph; immune; plateau; regeneration; repair; system; söderhäll; wound cache: isj-198.pdf plain text: isj-198.txt item: #98 of 465 id: isj-199 author: Vetvicka, V; Sima, P title: Origins and functions of annelide immune cells: the concise survey date: 2009-10-13 words: 3971 flesch: 44 summary: Cell types differ in morphology among various annelide species. A second population of free cells within a polychaete celom is represented by the eleocytes (Rosa, 1896), the relatively large cells (appr. keywords: amoebocytes; annelids; cells; celomocytes; cooper; eleocytes; roch; sima; species; types cache: isj-199.pdf plain text: isj-199.txt item: #99 of 465 id: isj-20 author: Bhagat, J; Sarkar, A; Deepti, V; Singh, V; Raiker, L; Ingole, B S title: An integrated approach to study the biomarker responses in marine gastropod Nerita chamaeleon environmentally exposed to polycyclic aromatic hydrocarbons date: 2016-12-28 words: 8653 flesch: 58 summary: Shrimp Norco, USA Soft tissue Total PAH 7.18-10.86 Oberdorster et al., 1999 Penaeus japonicus Shrimp Gulf of Suez Muscle tissue 16 2.01 Ali et al., 2014 Sepia species Cuttlefish Gulf of Suez Muscle tissue 16 4.09 Ali et al., 2014 Portunus pelagicus Crab Gulf of Suez Muscle tissue 16 8.10 Ali et al., 2014 Nephrops norvegicus Lobster Adriatic Sea, Italy Soft tissue 13 0.015 Studies with GST in aquatic organisms exposed to environmental or anthropogenic contaminants has shown increase (Zheng et al., 2013; Cabecinhas et al., 2014), unaltered (Bianco et al., 2013; Rivadeneira et al., 2013) or decrease (Ma et al., 2014; Ali et al., 2015) enzyme activities. keywords: activity; arambol; biomarker; cat; damage; dna; dona; environ; et al; goa; gst; ibr; pah; paula; response; sinquerim; sites; snails; sod; tissue; values cache: isj-20.pdf plain text: isj-20.txt item: #100 of 465 id: isj-200 author: Gagné, F; André, C; Blaise, C; Pellerin, J; Sherry, J; Talbot, A title: An investigation on the disruptive effect of pollution in cold- and warm- adapted clam populations date: 2009-10-27 words: 6528 flesch: 51 summary: In warm-adapted clams, temperature dependent MDH activity was higher by pollution with decreased lipid content in the gonad tissues which was independent of gonad maturation and size. The impacts of pollution in clams from cold water site increased MDH activity at 25 oC and MET temperature-dependence which would favor the formation of NADH in the cytosol for the production of lipids and steroidogenesis. keywords: activity; clams; ct+p; energy; gonad; lipid; malate; mdh; pollution; reference; site; temperature; water cache: isj-200.pdf plain text: isj-200.txt item: #101 of 465 id: isj-201 author: Ballarin, L; Kawamura, K title: The hemocytes of Polyandrocarpa mysakiensis: morphology and immune-related activities date: 2009-10-20 words: 5352 flesch: 55 summary: Separation and labeling of specific subpopulations of Botryllus blood cells. Conversely, when blood cells were incubated in a suspension of yeast in ASW, the resulting enzyme activity of the medium was significantly (p < 0.001) increased and reached the value of 63.3 ± 10.9 RU/mg protein. keywords: activity; ascidians; ballarin; biol; blood; botryllus; cells; et al; hemocytes; kawamura; phagocytes; polyandrocarpa; schlosseri cache: isj-201.pdf plain text: isj-201.txt item: #102 of 465 id: isj-202 author: Silverman, N; Paquette, N; Aggarwal, K title: Specificity and signaling in the Drosophila immune response date: 2009-12-07 words: 8413 flesch: 62 summary: Some of these AMPs appear to be unique to insects, e.g., Diptericin, while others have homologs in mammals, e.g., Defensins, Cecropins and Drosomycin (Lee et al., 1989; Simon et al., 2008). Several reports have argued that JNK signaling actually down-modulates AMP gene expression (Kim et al., 2005, 2007), while another report has argued that JNK signaling is required for AMP induction (Delaney et al., 2006). keywords: activation; bacteria; binding; dap; drosophila; et al; gram; imd; pathway; peptidoglycan; pgn; pgrp; protein; receptor; recognition; relish; response; signaling; toll; type cache: isj-202.pdf plain text: isj-202.txt item: #103 of 465 id: isj-203 author: Malagoli, D; Sacchi, S; Ottaviani, E title: Lectins and cytokines in celomatic invertebrates: two tales with the same end date: 2009-12-18 words: 6709 flesch: 57 summary: Furthermore, using the anti-rDHF antibody, the macrophage-like Drosophila embryonic hemocytes (SL2 cell line) have been found to promote the secretion of DHF following exposure to heat-inactivated bacteria and after the administration of the recombinant peptide rDHF (Malagoli et al., submitted). This hypothesis was reinforced not only by the data on CCF, but also by the absence of molecular evidence (immunoblot or PCR-derived data (Beschin et al., 2004) supporting the existence of invertebrate cytokines. keywords: biochem; biol; cell; characterization; comp; cytokines; dev; drosophila; et al; factor; immune; immunol; invertebrate; lectins; melanogaster; molecular; molecules; ottaviani; purification; sea; type; vasta cache: isj-203.pdf plain text: isj-203.txt item: #104 of 465 id: isj-204 author: Koutsogiannaki, S; Kaloyianni, M title: Signaling molecules involved in immune responses in mussels date: 2009-12-22 words: 6763 flesch: 50 summary: [(stress-activated p38 mitogen-activated protein kinase (MAPK)], c-Jun N-terminal kinase (JNK), extracellular signal-regulated kinase (ERK), signal transducer and activator of transcription (STAT)- 5, STAT 3, nuclear factor kappa B (NF-kB), PKC, cyclic adenosine monophosphate (cAMP) dependent PKA (cAMP/PKA), PI-3 K, ROS and NO (Ottaviani et al., 2000; Canesi et al., 2006; Cao et al., 2007; Novas et al., 2007; Barcia and Ramos- Martinez, 2008; Garcia-Garcia et al., 2008; Malagoli et al., 2008). (TGF-β) are present in M. gallorovincialis hemocytes involved in many cellular functions such as phagocytosis and cell motility (Ottaviani et al., 1997a; Kletsas et al., 1998). keywords: adhesion; biol; cell; collagen; et al; galloprovincialis; hemocytes; immune; kinase; koutsogiannaki; matrix; migration; mytilus; ottaviani; receptors; responses; value cache: isj-204.pdf plain text: isj-204.txt item: #105 of 465 id: isj-205 author: Gagné, F; Gélinas, M; Gagnon, C; André, C; Blaise, C title: Change in metallothionein phosphorylation state in Mya arenaria clams: implication in metal metabolism and oxidative stress date: 2010-01-04 words: 6274 flesch: 56 summary: At present, the function of MT phosphorylation is unclear despite its apparent involvement in PKC signaling and possible ubiquitinylation proteasome tagging. This indicates that MT phosphorylation follows the formation of oxidized (metal-releasing) MT at the expense of the metal-binding (reduced) fraction of MT. keywords: activity; binding; clams; levels; metal; p<0.05; p>0.1; phosphate; phosphorylation; protein; sites; species; tissue; total cache: isj-205.pdf plain text: isj-205.txt item: #106 of 465 id: isj-206 author: Reumer, A; Van Loy, T; Schoofs, L title: The complexity of Drosophila innate immunity date: 2010-01-11 words: 8588 flesch: 56 summary: The roles of JAK/STAT signaling in Drosophila immune responses. The physiological relevance of JNK signaling in the innate immune response remains elusive although it has been suggested to be involved in the control of the expression of some AMPs, and to regulate wound healing and melanization (Boutros et al., 2002; Igaki et al., 2002; Silverman et al., 2003; Kim et al., 2005) keywords: activation; cell; components; drosophila; et al; fig; fungal; hoffmann; imd; immune; immunity; immunol; infection; jak; pathway; pgrp; protein; recognition; response; signaling; stat; system; toll; viral cache: isj-206.pdf plain text: isj-206.txt item: #107 of 465 id: isj-207 author: Bogaerts, A; Beets, I; Schoofs, L; Verleyen, P title: Antimicrobial peptides in Caenorhabditis elegans date: 2010-01-19 words: 6279 flesch: 50 summary: We summarise the current knowledge of the different families of C. elegans antimicrobial peptides, comprising NLPs, caenacins, ABFs, caenopores, and a recently discovered group with antifungal activity among which thaumatin- like proteins. C. elegans has a tremendous variety of chemosensory receptors to detect both interesting and harmful bacteria, the latter provoking pathogen avoiding behaviour (Zhang et al., 2005; Pradel et al., 2007; Schulenburg and Ewbank, 2007). keywords: amps; bacteria; c. elegans; caenorhabditis; elegans; et al; expression; genes; infection; innate; kato; nematode; peptides; protein; response cache: isj-207.pdf plain text: isj-207.txt item: #108 of 465 id: isj-208 author: Fusetani, N title: Antifungal peptides in marine invertebrates date: 2009-12-21 words: 6382 flesch: 56 summary: Tachyplesins I and II isolated from T. tridentatus are composed of 17 amino acids and contain 2 intramolecular disulfide bonds as shown in Table 4 (Nakamura et al., 1988; 60 Table 2 Amino acid sequences of antifungal peptides retrieved in worms Arenicin 1: RWCVYAYVRVRGVLVRYRRCW Arenicin 2: RWCVYAYVRIRGVLVRYRRCW Perinerin: FNKLKQGSSKRTCAKCFRKIMPSVHELDERRRGANRWAAGFRKCVSSICRY Only a small number of works have been done on AMPs in echinoderms, although antibacterial activity of their coelomocytes were reported; cationic, defensin-like AMPs have been 61 Table 4 Amino acid sequences of antifungal peptides from horseshoe crabs Tachyplesin I: KWCFRVCYRGICYRRCR-NH2 Tachyplesin II RWCFRVCYRGICYRKCR-NH2 Polyphemusin I: RRWCFRVCYRGFCYRKCR-NH2 Polyphemusin II: RRWCFRVCYKGFCYRKCR-NH2 Tachystatin A: YSRCQLQGFNCVVRSYGLPTIPCCRGLTCRSYFPGSTYGRCQRY TachystatinB1: YVSCLFRGARCRVYSGRSCCFGYYCRRDFPGSIFGTCSRRNF Tachystatin C: DYDWSLRGPPKCATYGQKCRTWSPRNCCWNLRCKAFRCRPR Tachycitin: keywords: acids; activity; albicans; amino; amps; antibacterial; antifungal; chem; et al; fig; hemocytes; horseshoe; invertebrates; marine; peptides; sponges; structure cache: isj-208.pdf plain text: isj-208.txt item: #109 of 465 id: isj-209 author: Erskine, S; Beach, D G; Rouleau, C; Hellou, J title: Fate and distribution of pyrene in Ilyanassa obsoleta exposed through the diet date: 2010-02-02 words: 7751 flesch: 57 summary: The behavioural response of this species towards contaminated sediments and seawater was previously examined in our laboratory (Hellou et al., 2009a; Marklevitz et al., 2008a, b). This standardization prior to exposure helped to interpret the avoidance/preference response of snails relative to spiked seawater or to single spiked sediment (Hellou et al., 2009a). keywords: animals; beach; biotransformation; environ; et al; exposure; fish; food; hellou; levels; metabolites; pah; polycyclic; pyrene; snails; species; tissue cache: isj-209.pdf plain text: isj-209.txt item: #110 of 465 id: isj-21 author: Chatterjee, A; Thilagaraj, R; Gobi, M title: Effect of heavy metals on four different earthworm’s species specific autofluorescing eleocytes date: 2017-01-11 words: 5207 flesch: 52 summary: Riboflavin content in autofluorescent earthworm coelomocytes is species-specific. Sulik P, Klimek M, Talik P, Kruk J, Morgan AJ, Plytycz B. Searching for external sources of the riboflavin stored in earthworm eleocytes. keywords: analysis; autofluorescent; cells; celomic; celomocytes; content; earthworm; eleocytes; fluid; fluorescence; metal; plytycz; riboflavin; soil; species cache: isj-21.pdf plain text: isj-21.txt item: #111 of 465 id: isj-210 author: Jayaraj, S S; Thiagarajan, R; Arumugam, M; Vincent, S title: Physico-chemical characterization of bacterial and hemagglutinins from the serum of the mud crab Scylla serrata date: 2010-02-15 words: 5748 flesch: 50 summary: A serum sample (300 µl) concurrently dialysed against, TBS containing 10 mM CaCl2 (TBS-I) was also tested for the hemagglutinating activity against rabbit RBC in TBS-I. pH and thermal stability The stability of serum HA activity (in duplicates) at different pH was examined by dialyzing (24 h, 4 °C) 300 μl serum samples against the following buffers at pH ranging from 3 to 12 (Lillie, 1954; Pearse, 1968): 0.2 M acetate buffer (pH 3 to 6), 0.2 M tris-HCl buffer (pH 7 to 9) and 0.1 M glycine- NaOH buffer (pH 10 to 12). HA-inhibition assays Several carbohydrates were tested for their ability to inhibit serum HA activity. keywords: activity; agglutinins; characterization; crab; et al; rabbit; rbc; serrata; serum; tbs; yeast cache: isj-210.pdf plain text: isj-210.txt item: #112 of 465 id: isj-211 author: Fuller-Espie, S L; Nacarelli, T; Blake, E L; Bearoff, F M title: The effect of oxidative stress on phagocytosis and apoptosis in the earthworm Eisenia hortensis date: 2010-02-17 words: 10485 flesch: 53 summary: 2 Phagocytosis is enhanced by pretreating earthworm coelomocytes with H202. Effects of exogenous H202 on phagocytosis Having established the data analysis protocol, we studied the effect of H202 at concentrations ranging from 0.26 - 8.4 mM on the phagocytosis of E. coli/GFP by earthworm coelomocytes. keywords: amoebocytes; annexin; apoptosis; apoptotic; assay; caspase; cell; coelomocytes; control; dna; earthworm; fitc; fl-1; flow; h202; mm h202; oxidative; phagocytosis; samples cache: isj-211.pdf plain text: isj-211.txt item: #113 of 465 id: isj-212 author: Ottaviani, E; Malagoli, D title: XIth scientific meeting of the Italian Association of Developmental and Comparative Immunobiology (IADCI), 24 - 26 February 2010, Department of Animal Biology, University of Modena and Reggio Emilia, Modena, Italy date: 2010-02-26 words: 9351 flesch: 33 summary: Direct injection of live bacteria into the hemolymph induced different hemocyte responses. Deeply studied cytokines are interferons (IFNs), which may induce vertebrate cells into an antiviral state. keywords: activity; animal; asaia; bacteria; biology; cells; department; expression; gene; hemocytes; human; italy; leech; modena; mytilus; padua; palermo; protein; responses; results; role; species; splendidus; system; university; urbino cache: isj-212.pdf plain text: isj-212.txt item: #114 of 465 id: isj-213 author: Shi, X Z; Li, X C; Wang, S; Zhao, X F; Wang, J X title: Transcriptome analysis of hemocytes and hepatopancreas in red swamp crayfish, Procambarus clarkii, challenged with white spot syndrome virus date: 2010-03-22 words: 7381 flesch: 52 summary: In crustaceans, -1,3-glucan binding protein (BGBP) and lipopolysaccharide and -1,3-glucan binding protein (LGBP) serve as pattern recognition receptors to recognize cell wall components of bacteria and fungi, such as -1,3-glucans and lipopolysaccharide. Unigenes were assembled into different functional classes with Clusters of Orthologous Groups of proteins (COGs) (http://www.ncbi.nlm.nih.gov/COG/). keywords: analysis; binding; cdna; crayfish; ests; et al; genes; hemocytes; hepatopancreas; immune; immunol; library; protease; protein; rna; serine; shrimp; unigenes; virus; wang; white; wssv cache: isj-213.pdf plain text: isj-213.txt item: #115 of 465 id: isj-214 author: Li, C; Haug, T; Stensvåg, K title: Antimicrobial peptides in Echinoderms date: 2010-05-05 words: 5928 flesch: 55 summary: The prosequences of strongylocins and SpStrongylocins are negatively charged sequences which may neutralize the positive charges of the mature sequences (Li et al., 2008; Li et al., 2010a, b). Canicatti and Roch, 1989; Canicatti, 1990; Canicatti and D´Ancona, 1990; Gerardi et al., 1990; Stabili et al., 1994; Stabili and Canicatti, 1994; Stabili and Pagliara, 1994, 2009; Shimizu et al., 1999; Bachali et al., 2004; Cong et al., 2009) (Table 1). keywords: activity; amps; antibacterial; biochem; cell; celomic; celomocytes; echinoderms; et al; fluid; immunol; lysozyme; peptides; proteins; sea; urchin cache: isj-214.pdf plain text: isj-214.txt item: #116 of 465 id: isj-215 author: Mantione, K J; Cadet, P; Casares, F; Zhu, W; Stefano, G B title: Seasonal variations in mu opiate receptor signaling in the nervous system of the blue mussel, Mytilus edulis: temperature controls physiological processes date: 2010-05-13 words: 3003 flesch: 63 summary: As demonstrated in this report, this same phenomenon involves NO release, which is coupled to opiate receptor activation, namely via μ3 ( Liu and Stefano, 1996; Liu et al., 1996; Magazine et al., 1996; Stefano and Scharrer, 1996; Stefano et al., 1996). In the case of Mytilus, if bacteria, viruses can’t survive or have a decreased infectious characteristic, why have a full functioning immune process with the activation of cytokines and opiate components at low temperature ( Stefano and Scharrer, 1994; Stefano and Salzet, 1999; Stefano et al., 2000, 2008; Stefano and Kream, 2008). keywords: edulis; morphine; opiate; receptor; release; stefano; temperature cache: isj-215.pdf plain text: isj-215.txt item: #117 of 465 id: isj-216 author: Malagoli, D title: Cytokine network in invertebrates: the very next phase of comparative immunology date: 2010-05-20 words: 1813 flesch: 50 summary: Even though there are several clues on the conservation of structure, receptors and signaling activities of invertebrate cytokines, if these molecules fail to constitute complex networks, should they still be called cytokines? No more than 6 years ago, the knowledge on invertebrate cytokines was limited and based on indirect evidence (Ottaviani et al., 2004), and the very existence of possible counterparts of vertebrate cytokines was disputed (Beschin et al., 2004). keywords: cytokines; et al; invertebrate; malagoli cache: isj-216.pdf plain text: isj-216.txt item: #118 of 465 id: isj-217 author: Girón-Pérez, M I title: Relationships between innate immunity in bivalve molluscs and environmental pollution date: 2010-05-25 words: 4269 flesch: 40 summary: Gagné et al., 2006 151 PAHs Benzo[a]pyrene, and phenanthrene Granulocyte cell (%) ↑ Cell mortality, esterase and lysosome-positive cells ↓ Crassostrea gigas Gagnaire et al., 2006 Benzo[a]pyrene Benzo[a]pyrene Phenanthrene Phenanthrene Hemocytes viability ↓ Lysozyme activity ↓ Phagocytic activity ↓ Adhesion capability ↓ Hemocyte mortality ↑ Phagocytic cells ↓ Superoxide generation ↓ Hemocyte number ↑ Cell membrane stability↓ Phagocytosis↓ Mytilus galloprovincialis Chamelea gallina Cerastoderma edule Pecten maximus Gómez-Mandikute et al., 2003 Matozzo et al., 2009 Wootton et al., 2003 Hannam et al., 2010 PCB PCB 77 lysosome-positive cells ↓ Crassostrea gigas Gagnaire et al., 2006 Pesticides 2.4D Cell mortality ↑ Crassostrea gigas Gagnaire et al., 2006 Paroxon Esterase and lysosome positive- cell (%) ↓ Crassostrea gigas Gagnaire et al., 2006 ROS positive-cell (%) ↑ Chlorothalonil Cell mortality and granulocyte (%)↑ Crassostrea gigas Gagnaire et al., 2006 Pesticide mixture (atrazine, gliphosate, alachlor, metalachlor, fosetyl- aluminum, terbuthilazine, diuron, carbaryl) Phagocytosis ↓ Cell mortality, and ROS production ↑ Genes relationship with immune response (e.g., lyzozyme, defensines) ↓ Crassostrea gigas Gagnaire et al., 2007 Susceptibility to bacteria challenge ↑ Paraquat Other Hemocytes viability Mytilus galloprovincialis Gómez-Mandikute et al., 2003 Fuel Oil No. 6 Cellular viability↓ Pinctada imbricate Nusseti, et al. 2004 GST and CAT↑ 4-Nonylphenol GPx ↓ Lysozyme concentration ↓ Apoptitic Index ↑ Tapes philippinarum Matozzo, et al. 2005 Elliptio complanata Gangé et al., 2008 NO2 - ↑ Estrogenic substances Nonylphenol, monoethoxilate carboxylate, and 17α-ethynyl estradiol 17β-estradiol Pharmaceutical drugs Lysosomal enzyme release ↑ Phagocytosis ↑↓ Phagocytosis ↓ Mytilus galloprovincialis Corbicula fluminea Canesi et al., 2007 Champeau et al., 2006 Benzafibrinate, gembibrozil, and trimetophin Phagocytosis ↑ keywords: activity; cell; effect; et al; exposure; hemocytes; molluscs; oyster; phagocytosis; results; studies cache: isj-217.pdf plain text: isj-217.txt item: #119 of 465 id: isj-218 author: Arenas Díaz, G title: Defensins and cystein rich peptides: two types of antimicrobial peptides in marine molluscs date: 2010-06-03 words: 5300 flesch: 52 summary: The resulting fractions are collected, lyophilized, reconstituted in ultra-pure water (UPW ) and frozen at -20 °C until antimicrobial activity testing (Bulet et al., 1991; Charlet et al., 1996; Mercado et al., 2005). The small size and ease of synthesis of C10C enables its biotechnology development (Roch et al., 2008). keywords: activity; amps; bacteria; charlet; defensin; disulfide; et al; galloprovincialis; hemocytes; mitta; myticin; n.a; peptides cache: isj-218.pdf plain text: isj-218.txt item: #120 of 465 id: isj-219 author: Armstrong, P B title: Role of α2-macroglobulin in the immune responses of invertebrates date: 2010-06-30 words: 11755 flesch: 55 summary: This suggested the presence of α2-macroglobulin in the hemolymph of this invertebrate (Quigley et al., 1982). Additionally, humans have two newly identified and incompletely characterized members of the family, CD109, which is linked to the cell surface by GPI-bonding (Lin et al., 2002), and CPAMD8, an acute-phase protein expressed by kidney, brain, and testis (Li et al., 2004), and the settlement-inducing protein of the barnacle Balanus amphitrite is an α2-macroglobulin (Dreanno et al., 2006). keywords: armstrong; binding; biochem; biol; characterization; chem; clearance; domain; ester; et al; family; function; hemolymph; human; inhibitors; jensen; limulus; macroglobulin; members; molecular; protease; protein; quigley; receptor; sottrup; system; thiol cache: isj-219.pdf plain text: isj-219.txt item: #121 of 465 id: isj-22 author: Scapigliati, G; Fausto, A M; Mazzini, M; Romano, N; Buonocore, F; Picchietti, S; Belardinelli, M C title: XVIIIth scientific meeting of the Italian Association of Developmental and Comparative Immunobiology (IADCI), 8 - 10 February 2017, Department for Innovation in Biological, Agro-food and Forest systems (DIBAF), University of Tuscia, Viterbo, Italy date: 2017-02-10 words: 8388 flesch: 31 summary: In fact, in tumor tissues the detectable cross-talk between cancer cells and the surrounding tumor microenvironment is based on these aspects. Further, similar to Vertebrates these cells are driven toward a leukocyte, endothelial or myogenic, differentiation pathway, as a function of the time course of VEGF release to target cells. keywords: cells; department; domain; fish; genes; hemocytes; immune; immunity; injection; invertebrate; italy; leech; life; model; processes; protein; response; results; role; ros; sciences; species; study; system; university cache: isj-22.pdf plain text: isj-22.txt item: #122 of 465 id: isj-220 author: Ryu, K H; Park, J W; Kurokawa, K; Matsushita, M; Lee, B L title: The molecular activation and regulation mechanisms of proteolytic Toll signaling cascade in insect innate immunity date: 2010-09-02 words: 7689 flesch: 55 summary: Recently, our group determined the activation and regulation mechanisms of Tenebrio Toll signaling cascade by approaching biochemical methods using a large beetle, Tenebrio molitor (Kim et al., 2008; Jiang et al., 2009; Roh et al., 2009). To date, several cascade reactions including Drosophila Toll signaling cascade have been hypothesized to be regulated by a single “bottleneck” protease. keywords: activation; cascade; drosophila; et al; kda; msp; pathway; pgrp; protein; recognition; signaling; spätzle; tenebrio; toll cache: isj-220.pdf plain text: isj-220.txt item: #123 of 465 id: isj-221 author: Grdisa, M title: Mechanism of wound healing in annelids date: 2010-09-15 words: 4033 flesch: 52 summary: The molecular mechanisms for regeneration process have not been yet completed. The annelids regeneration is thought to occur primarily by cellular dedifferentiation and redifferentiation, without the contribution of totipotent cells (Thouveny and Tassava, 1998), but lately more date point on the involvement of stem cells (totipotent cells) in regeneration process (Grimaldi et al. 2008, 2010). keywords: annelids; cells; cellular; collagen; et al; healing; new; process; regeneration; repair; tissue; wound cache: isj-221.pdf plain text: isj-221.txt item: #124 of 465 id: isj-222 author: Nappi, A J title: Cellular immunity and pathogen strategies in combative interactions involving Drosophila hosts and their endoparasitic wasps date: 2010-09-17 words: 5233 flesch: 47 summary: Immune suppressive factors (ISF) in the venom of virulent wasps block host cellular immune response. Insects and other invertebrates rely exclusively on innate immune responses, which many authors regard as the first line of defense. keywords: carton; cell; drosophila; encapsulation; et al; fig; host; immune; innate; insect; molecules; nappi; response cache: isj-222.pdf plain text: isj-222.txt item: #125 of 465 id: isj-223 author: Ramírez-Gómez, F; García-Arrarás, J E title: Echinoderm immunity date: 2010-09-27 words: 7716 flesch: 58 summary: Amebocyte roles include: graft rejection, chemotaxis, reactive oxygen species production, encapsulation, cytotoxicity, immune gene expression, agglutination and clotting reactions (Gross et al., 1999, 2000; Beck et al., 2001; Coteur et al., 2001; Lin et al., 2001; Furthermore, interleukin-like molecules were identified in the sea star, e.g., a protein with IL-1 activity and an IL-6 like molecule ( Beck et al., 1989, 1993; Beck and Habicht, 1991a, 1991b, 1996). keywords: biol; cell; celomocytes; complement; cucumber; dev; echinoderm; et al; fluid; genes; gomez; immune; immunol; present; protein; ramirez; sea; sea urchin; smith; star; urchin cache: isj-223.pdf plain text: isj-223.txt item: #126 of 465 id: isj-224 author: Ballarin, L; Del Favero, M title: Identification and preliminary characterization of a Ca2+-dependent hemagglutinin in the celomic fluid of Sipunculus nudus date: 2010-10-05 words: 4314 flesch: 55 summary: In the last two decades, the study of animal lectins has greatly increased and today we know that lectin activity in animals is found in association with a wide variety of primary structures which enable us to distinguish at least 12 families of sugar-binding proteins and a series of orphan lectins belonging to either some unknown lectin family or well-established protein families with the majority of the members unable to ___________________________________________________________________________ Biology of animal lectins. keywords: activity; cells; celomic; cfcf; fluid; lectins; min; nudus; yeast cache: isj-224.pdf plain text: isj-224.txt item: #127 of 465 id: isj-225 author: Tsakas, S; Marmaras, V J title: Insect immunity and its signalling: an overview date: 2010-10-21 words: 8137 flesch: 46 summary: Nappi et al., 2004; Lamprou et al., 2005; Mavrouli et al., 2005; Sideri et al., 2007). However, these haemocyte types are not common in all insect species (Lavine and Strand 2002; Meister and Lagueux, 2003; Lamprou et al., 2007). keywords: bacteria; body; cell; drosophila; et al; fat; gram; hemocytes; immune; immunity; innate; insect; melanization; pathway; peptides; phagocytosis; proteins; recognition; response; signalling cache: isj-225.pdf plain text: isj-225.txt item: #128 of 465 id: isj-226 author: Blanco, G A title: Cell death and the immune responses of the sipunculan worm Themiste petricola date: 2010-10-25 words: 7574 flesch: 54 summary: Thus programmed cell death in celomic cells may not only occur through classic apoptosis due to external insults such as oxidative stress or toxic substances, but 247 may have peculiar cell death mechanisms tailored to efficiently and simultaneously achieve a hemostatic and immune purpose. Thus celomic cells can reach the dermis and they can be found interspersed between a felt of fine fibres and connective-tissue cells (Fig. 1). keywords: activation; apoptosis; blanco; bodies; cell; cell death; clot; death; et al; fluid; granulocytes; immune; lgls; lunetta; particles; sipunculan; type cache: isj-226.pdf plain text: isj-226.txt item: #129 of 465 id: isj-227 author: Zibaee, I; Bandani, A R; Sendi, J J; Talaei-Hassanloei, R; Kouchaki, B title: Effects of Bacillus thuringiensis var. kurstaki and medicinal plants on Hyphantria cunea Drury (Lepidoptera: Arctiidae) date: 2010-11-02 words: 6178 flesch: 58 summary: It is clear that botanical insecticides and microbes such as B. thuringiensis affect insect physiology in different ways including decrease of digestive enzyme activities. Therefore one would expect that such damage to the midgut would cause a decrease in digestive enzyme activities (Eguchi et al., 1972; Mathavan et al., 1989; Smirle et al., 1996; Senthil Nathan et al., 2006). keywords: activities; activity; annua; cunea; digestive; enzyme; extract; larvae; mulberry; plant; stoechas; sycamore; thuringiensis cache: isj-227.pdf plain text: isj-227.txt item: #130 of 465 id: isj-228 author: Rosa, R D; Barracco, M A title: Antimicrobial peptides in crustaceans date: 2010-11-09 words: 16696 flesch: 52 summary: 268 Penaeidins Penaeidins are unquestionably the most well- characterized family of antimicrobial peptides described in crustaceans so far and have been the subject of many review articles (Bachère et al., 2000, 2004; Destoumieux et al., 2000a; Cuthbertson et al., 2008; Tassanakajon et al., 2010). To date, the genes encoding ALFs have been only identified in decapod crustaceans, such as penaeid shrimps (Tassanakajon et al., 2010), freshwater prawns (Rosa et al., 2008; Lu et al., 2009), crayfish (Liu et al., 2006), lobster (Beale et al., 2008) and crabs (Imjongjirak et al., 2007; keywords: activity; amino; amps; antimicrobial; bacteria; cationic; characterization; comp; crab; crayfish; crustacean; crustin; cysteine; domain; et al; expression; family; gene; gram; hemocytes; immune; immunol; kda; monodon; penaeidins; peptides; proteins; residues; sequence; shrimp; single; species; structure; type; vannamei cache: isj-228.pdf plain text: isj-228.txt item: #131 of 465 id: isj-229 author: Ottaviani, E title: Immunocyte: the invertebrate counterpart of the vertebrate macrophage date: 2010-12-15 words: 2477 flesch: 50 summary: Another notable example is the classification of immune cells in insects. Indeed the different species of Planorbids and Lymnaea palustris (Kinoti, 1971; Lie et al., 1975; Rachford, 1976; Jeong et al., 1983; Ottaviani, 1988) in which a hemopoietic organ is present, it is insufficient to produce the quantity of immune cells that need to the animals, and the majority of the cells comes from the hemolymph. keywords: amebocytes; cells; hemocytes; invertebrate; ottaviani; system; types cache: isj-229.pdf plain text: isj-229.txt item: #132 of 465 id: isj-23 author: Mousavi, S F; Hosseini Moghaddam, S H; Ghavi Hossein-Zadeh, N; Mirhosseini, S Z title: Gene expression of HSP90 and HSP70 in four silkworm hybrids (Bombyx mori L.) in response to severe thermal shock date: 2017-03-06 words: 4096 flesch: 64 summary: Impact of heat shock on heat shock proteins expression, biological and commercial traits of Bombyx mori. Huang LH, Kang L. Cloning and interspecific altered expression of heat shock protein genes in two leaf miner species in response to thermal stress. keywords: 103×104; 107×110; expression; gene; heat; hsp70; hybrids; mortality; parents; shock; silkworm cache: isj-23.pdf plain text: isj-23.txt item: #133 of 465 id: isj-230 author: Tettamanti, G; Cao, Y; Feng, Q; Grimaldi, A; de Eguileor, M title: Autophagy in Lepidoptera: more than old wine in new bottle date: 2010-12-17 words: 8157 flesch: 57 summary: The molecular base of autophagy Bioinformatics analysis performed by Zhang and colleagues (Zhang et al., 2009) revealed that in the B. mori genome there are homologs of most of the ATG genes originally identified in yeast and subsequently in higher eukaryotes. The expression levels of BmATG8 and BmATG12 in silk gland show a progressive increase, reaching a plateau at pre-pupal stage, when autophagic features become evident (Zhang et al., 2009). keywords: apoptosis; autophagy; biol; body; bombyx; cell; cell death; death; et al; fat; genes; insect; larval; lepidoptera; metamorphosis; midgut; mori; process; programmed; tettamanti; tissues cache: isj-230.pdf plain text: isj-230.txt item: #134 of 465 id: isj-231 author: Furuta, E; Yamaguchi, K title: Transplant rejection in terrestrial molluscs date: 2010-12-20 words: 2924 flesch: 51 summary: The destruction of tissue allografts in mammals is thought to be mediated primarily by cellular immune mechanisms, an interpretation supported by histological observations of the dense infiltration of recipient cells into the organs to be rejected. Electron microscopic examination of the graft tissue revealed autophagic degeneration of epithelial cells, mucous cells, pigment cells, fibroblasts, and muscle cells. keywords: cells; furuta; graft; skin; tissue; transplantation cache: isj-231.pdf plain text: isj-231.txt item: #135 of 465 id: isj-232 author: Nonaka, M title: The complement C3 protein family in invertebrates date: 2011-01-11 words: 8229 flesch: 58 summary: In addition to C3-1 and C3-2 genes identified from sea anemone species, Haliplanella lineate (Fujito et al., 2010) and Nematostella vectensis (Kimura et al., 2009), the C3 genes have been reported from two coral species, Swifta exserta (Dishaw et al., 2005) and Acropora millepora (Miller et al., 2007). Azumi et al., 2003), mannan-binding lectin (MBL) (Bonura et al., 2009), ficolin (Kenjo et al., 2001), complement receptor 3 (CR3) alpha (Miyazawa et al., 2001) and beta (Miyazawa et al., 2001) and glucose binding lectin (GBL) lacking the collagen domain as a possible functional substitute for MBL (Sekine et al., 2001). keywords: cd109; cnidaria; complement; complement system; domain; et al; family; genes; human; immunol; nonaka; sea; structure; system; tep; thioester cache: isj-232.pdf plain text: isj-232.txt item: #136 of 465 id: isj-233 author: Ballarin, L; Cima, F; Matozzo, V; Venier, P title: XIIth scientific meeting of the Italian Association of Developmental and Comparative Immunobiology (IADCI), 16 - 18 February 2011, Hotel S. Marco, Monteortone, Padua, Italy date: 2011-02-18 words: 11176 flesch: 29 summary: As such, this novel pheromone might function as a self- recognition signal not for a single cell type, but for a population of different and interbreeding cell types, and ensure that mating pairs are formed only between different cell types of the same population. One copy would retain the ancestral state as multi-allelic locus deputed to control the synthesis of pheromones which are specific for each cell type, while the new copy would be manifested as mono-allelic locus deputed to control the synthesis of a pheromone which is shared in common by a group of different, but mutually interbreeding cell types. keywords: activity; antarctic; biology; cells; data; department; effects; environmental; evolution; expression; fish; genes; hemocytes; immune; immunity; italy; molecules; mussels; number; padua; peptides; production; proteins; response; sea; sequence; species; stress; system; teleost; university cache: isj-233.pdf plain text: isj-233.txt item: #137 of 465 id: isj-234 author: Coyne, V E title: The importance of ATP in the immune system of molluscs date: 2011-03-08 words: 5818 flesch: 51 summary: Indeed, a continuous supply of ATP is required for F-actin polymerisation from G-actin, and to maintain the activity of non- muscle myosin ATPases that assist in actin and membrane recruitment, and provide motor activity around the phagocytic cup (García-García and Rosales, 2002; Kuiper et al., 2008). Because protein kinase cascades amplify signals by serially phosphorylating target kinases, it is likely that ATP utilization in phosphorylation reactions is quite significant (Krauss et al., 2001). keywords: actin; adenylate; atp; biol; cell; energy; et al; hemocytes; immune; immunol; kinase; membrane; molluscs; oxidative; oyster; phagocytosis; pkc; response; role; suzuki; system cache: isj-234.pdf plain text: isj-234.txt item: #138 of 465 id: isj-235 author: Barcia, R; Ramos-Martínez, J I title: Stress-based modulation of the immune response in molluscan hemocytes: a two-receptor model date: 2011-03-23 words: 1952 flesch: 57 summary: A common intermediation of some protein kinases related to stress (MAPK) in phagocytosis and in synthesis of thermal shock proteins has been reported in Mytilus hemocytes incubated with toxins and bacteria (Canesi et al., 2002; Gaitanaki et al., 2004; Kefaloyianni et al., 2005), and MAPK is known to mediate processes activated through G protein receptors. Also, the signals of LPS and other bacterial factors involve the activation of stress kinases, such as p38-MAPK, JNK o ERK (Canesi et al., 2002, Betti et al., 2006, Ciacci et al., 2010). keywords: hemocytes; immune; mytilus; response; stress cache: isj-235.pdf plain text: isj-235.txt item: #139 of 465 id: isj-236 author: Tanaka, H; Yamakawa, M title: Regulation of the innate immune responses in the silkworm, Bombyx mori date: 2011-04-18 words: 8720 flesch: 60 summary: Cecropin (Morishima et al., 1990; Taniai et al., 1992; Kato et al., 1993; Yamano et al., 1994; Kim et al., 1998; Yang et al., 1999; Cheng et al., 2006; Hong et al., 2008), Attacin (Sugiyama et al., 1995), Lebocin (Hara and Yamakawa, 1995a; Chowdhury et al., 1995; Furukawa et al., 1997), Moricin (Hara and Yamakawa, 1995b; Furukawa et al., 1999), Gloverin (Cheng et al., 2006; Kaneko et al., 2007; Kawaoka et al., 2008), and Defensin (Kaneko et al., 2008; Wen et al., 2009) (Table 1). Recently, we identified up-regulated and down-regulated host genes from a silkworm cell line in response to B. mori NPV infection (Sagisaka et al., 2010). keywords: activation; amp; biochem; biol; bombyx; bombyx mori; drosophila; et al; expression; genes; immune; immunity; insect; mori; peptide; proteins; recognition; silkworm; tanaka; tanaka et; toll cache: isj-236.pdf plain text: isj-236.txt item: #140 of 465 id: isj-237 author: Matozzo, V; Marin, M G title: Bivalve immune responses and climate changes: is there a relationship? date: 2011-05-02 words: 5274 flesch: 52 summary: Numerous studies have demonstrated that temperature can influence markedly immune responses of molluscs, even if temperature effects differ among species. Perkinsus marinus susceptibility and defense-related activities in eastern oysters Crassostrea virginica: temperature effects. keywords: activity; effects; et al; hemocytes; hemolymph; immune; oysters; parameters; phagocytic; salinity; temperature cache: isj-237.pdf plain text: isj-237.txt item: #141 of 465 id: isj-239 author: Li, H; Parisi, M G; Parrinello, N; Cammarata, M; Roch, P title: Molluscan antimicrobial peptides, a review from activity-based evidences to computer-assisted sequences date: 2011-05-16 words: 10056 flesch: 51 summary: The same nonapeptide was also found to be anti protozoa (Trypanosoma brucei and Leishmania major) and preventing the in vitro infection by virus HIV-1, but non-cytotoxic for human MAGIC-5B cells (Roch et al., 2004). It resembles the CS-αβ motif of defensin MGD-1, involving the same pattern of cysteine bonding (Roch et al., 2008). keywords: activity; amps; cdna; defensin; et al; expression; galloprovincialis; gene; gigas; hemocytes; hplc; mitta; mussel; mytilin; mytilus; nucleotides; oyster; peptide; sequence; species cache: isj-239.pdf plain text: isj-239.txt item: #142 of 465 id: isj-24 author: Tedeschi, R; Monti, M; Gonella, E; Melchiori, G; Alma, A; Mandrioli, M title: Molecular and cellular analysis of immunity in the phytoplasma vector Euscelidius variegatus: exploiting immunity to improve biological control strategies date: 2017-03-08 words: 5727 flesch: 53 summary: This result was not unexpected since defensins form a family of antibacterial peptides that is widely distributed in insects (Bulet et al., 1999; Lamberty et al., 1999), including the presence of defensins expressed in insect cell lines (Fallon and Sun, 2000). Insect defensins are active mainly against Gram-positive bacteria, even if some insect defensins are also active against the Gram-negative Escherichia coli and some fungi. keywords: amplification; biol; cell; defensin; et al; fig; immune; immunity; immunocytes; insect; mandrioli; pcr; response; system; variegatus cache: isj-24.pdf plain text: isj-24.txt item: #143 of 465 id: isj-240 author: Bearoff, F M; Fuller-Espie, S L title: Alteration of mitochondrial membrane potential (∆Ψm) and phosphatidylserine translocation as early indicators of heavy metal-induced apoptosis in the earthworm Eisenia hortensis date: 2011-06-03 words: 6612 flesch: 55 summary: T T* - - T* T* T* T* 0.69 Strong EW-JA3 - - T T T* keywords: apoptosis; cadmium; caspase; cells; celomocytes; control; copper; ews; membrane; t t; translocation; ∆ψm cache: isj-240.pdf plain text: isj-240.txt item: #144 of 465 id: isj-241 author: Rosales, C title: Phagocytosis, a cellular immune response in insects date: 2011-06-20 words: 16137 flesch: 54 summary: D. melanogaster Rämet et al., 2001 EGF-like repeat- containing Receptors Eater E. coli, S. aureus S. marcescens D. melanogaster Charroux et al., 2009b; Defaye et al., 2009; Kocks et al. 2005; Nehme et al., 2011 Nimrod E. coli, S. aureus D. melanogaster Kurucz et al., 2007 Draper Apoptotic cells, axon pruning, severed axons, S. aureus CD91 (LRP) D. melanogaster Awasaki et al., 2006; Freeman et al., 2003; Hashimoto et al., 2009; MacDonald et al., 2006; Manaka et al., 2004 Six-microns-under (SIMU) Apoptotic cells, by glia in the nervous system D. melanogaster Kurant et al., 2008 Peptidoglycan Recognition Proteins PGRP-SC1a S. aureus Mammalian PGRP* D. melanogaster Garver et al., 2006 PGRP-LC E. coli D. melanogaster Kurata, 2010; Rämet et al., 2002 PGRP-LE L. monocitogenes D. melanogaster Moreover, the system has also identified molecules involved in hemocyte interaction with microorganisms such as E. coli (Rämet et al., 2002), S. aureus (Stuart et al., 2005a), Mycobacterium fortuitum (Philips et al., 2005), Listeria monocytogenes (Agaisse et al., 2005; Cheng et al., 2005), and Candida albicans (Stroschein-Stevenson et al., 2006; Stroschein- Stevenson et al., 2009). keywords: activation; apoptotic; aureus; bacteria; biol; cell; coli; draper; drosophila; et al; fig; gram; hemocytes; immune; immunity; immunol; infection; innate; insect; kinases; mammalian; medfly; melanogaster; membrane; microorganisms; molecules; pathways; peptidoglycan; pgrp; phagocytic; phagocytosis; protein; receptors; recognition; responses; role; signaling; system; toll cache: isj-241.pdf plain text: isj-241.txt item: #145 of 465 id: isj-242 author: Ranjbar, M; Sendi, J J; Zibaee, A title: Proteolytic activity in the midgut of Ectomyelois ceratoniae Zeller (Lepidoptera: Pyralidae), Pomegranate carob moth date: 2011-07-11 words: 5275 flesch: 53 summary: Protease activities in the larval midgut of Heliothis virescens: evidence of trypsin and chymotrypsin-like enzymes. The partial purification and characterization of serine protease activity in the midgut of larval Helicoverpa armigera. keywords: activity; ceratoniae; enzyme; insect; midgut; min; proteases; proteolytic cache: isj-242.pdf plain text: isj-242.txt item: #146 of 465 id: isj-243 author: Nava-Castro, K; Muñiz-Hernández, S; Hernández-Bello, R; Morales-Montor, J title: The neuroimmunoendocrine network during worm helminth infections date: 2011-07-25 words: 6250 flesch: 47 summary: This is clearly evident during various parasitic diseases including malaria (Cernetich et al., 2006), schistosomiasis (Morales-Montor et al., 2008), toxoplasmosis (Henriquez et al., 2009), cysticercosis (Larralde et al., 1995), trypanosomiasis (Brazão et al., 2009), leishmaniasis (Snider et al., 2009), where strong hormonal regulation of the immune response has been described. The disproportionately high intensity and prevalence of schistosome infection in children, compared with adults, has been documented for decades, so understanding the mechanisms of this naturally occurring protection may guide efforts to develop a vaccine for schistosomiasis (Kurtis et al., 2006). keywords: changes; et al; hormones; host; immune; infection; male; mice; montor; morales; parasite; response; sex; system; th2 cache: isj-243.pdf plain text: isj-243.txt item: #147 of 465 id: isj-244 author: Rinkevich, B title: The ‘immunology trap’ of anthozoans date: 2011-08-08 words: 7042 flesch: 50 summary: Corresponding author: Buki Rinkevich National Institute of Oceanography, Tel Shikmona P.O. Box 8030, Haifa 31080, Israel E-mail: buki@ocean.org.il 1996; Koh, 1997; Kim et al., 2000a, b; Petes et al., 2003; Ritchie, 2006; Mydlarz and Harvell, 2007; Couch et al., 2008; Gochfeld and Aeby, 2008; Kvennefors et al., 2008; Palmer et al., 2008; Dunn, 2009; Mydlarz et al., 2009). Likewise, cnidarian ‘chemical warfare’ against microbes (Koh, 1997), cytotoxicity of the secreted mucus (Ding et al., 1994), the expression of chitinolytic enzymes (Douglas et al., 2007), and the emancipating of non-specific antifungal and antimicrobial compounds (Jensen, 1996; Kim et al., 2000a, b; Ritchie, 2006; Gochfeld and Aeby, 2008) should all be considered as responses associated with non-immunological defenses (Lesser et al., 2007; Parker et al., 2011), unless proven otherwise (being an integral participant of immunity, part of the effector arm). keywords: anthozoan; biol; cells; cnidarian; coral; disease; ecol; et al; harvell; host; immune; immunity; innate; interactions; invertebrates; mar; mydlarz; non; reef; research; responses; rinkevich cache: isj-244.pdf plain text: isj-244.txt item: #148 of 465 id: isj-245 author: Cooper, D M; Mitchell-Foster, K title: Death for survival: what do we know about innate immunity and cell death in insects? date: 2011-08-16 words: 8115 flesch: 59 summary: It is difficult for a pathogen to infect a cell without activating any number of immune pathways, including cell death pathways (Clouston and Kerr, 1985; Everett and McFadden, 1999). Recently, Liu et al. (2011) used an in vivo system to demonstrate Michelob_X (mx), the mosquito ortholog of pro-apoptotic gene Drosophila reaper, is specifically induced in larval C. nigripalpus midgut cells following infection with a baculovirus (Liu et al., 2011). keywords: apoptosis; autophagy; caspase; cell; cell death; death; drosophila; et al; immune; immunity; infection; insects; melanogaster; mosquito; pathogens; pathway; proteins; response; role; signaling; toll; virus; viruses cache: isj-245.pdf plain text: isj-245.txt item: #149 of 465 id: isj-246 author: Silver, A C; Graf, J title: Innate and procured immunity inside the digestive tract of the medicinal leech date: 2011-08-29 words: 4128 flesch: 56 summary: Key Words: medicinal leech; Aeromonas; innate immuni y t   Introduction The ability of medicinal leech to consume large quantities of vertebrate blood is a fascinating biological adaptation of this slow moving parasite and the underlying reason for the resurgence of its use in today’s surgical wards. While there are many uses of medicinal leeches, one particular use led to the approval of the medicinal leech as a medical device by the FDA (Rados, 2004). keywords: blood; cells; et al; graf; gut; leech; silver; tract; veronii cache: isj-246.pdf plain text: isj-246.txt item: #150 of 465 id: isj-247 author: Domeneghetti, S; Manfrin, C; Varotto, L; Rosani, U; Gerdol, M; De Moro, G; Pallavicini, A; Venier, P title: How gene expression profiles disclose vital processes and immune responses in Mytilus spp. date: 2011-09-08 words: 6660 flesch: 45 summary: Experimental design for gene expression microarrays. ISSN 1824-307X REVIEW How gene expression profiles disclose vital processes and immune responses in Mytilus spp. keywords: analysis; changes; data; dna; et al; expression; galloprovincialis; gene; gene expression; geo; hybridization; immune; microarray; mussel; mytilus; probes; protein; responses; sequence; species; venier cache: isj-247.pdf plain text: isj-247.txt item: #151 of 465 id: isj-248 author: Rodrigues Macedo, M L; das Graças Machado Freire, M title: Insect digestive enzymes as a target for pest control date: 2011-11-04 words: 6714 flesch: 54 summary: The size of plant proteinase inhibitor (PI) proteins ranges from 4 to 85 kDa, with a great proportion being small proteins of only 8 - 20 kDa. Plant protease inhibitors: a defense strategy in plants. keywords: activity; biochem; cysteine; digestive; enzymes; et al; genes; inhibitors; insect; larvae; pis; plant; proteases; proteinase; proteinase inhibitors; resistance; serine; transgenic; trypsin cache: isj-248.pdf plain text: isj-248.txt item: #152 of 465 id: isj-249 author: Plytycz, B; Morgan, A J title: Riboflavin storage in earthworm chloragocytes/eleocytes in an eco-immunology perspective date: 2011-11-10 words: 5178 flesch: 50 summary: A number of earthworm biomarkers representing different levels of biological organization have been developed, optimized, and deployed (Gastaldi et al., 2007; Guo et al., 2009; Brulle et al., 2010), including immunotoxicity biomarkers (Plytycz et al., 2009a, 2011a; Homa et al., 2010). Metal pollution affects earthworm celomocytes Previous experiments indicated that celomocyte numbers and their composition can be significantly modified in response to soil metal contamination (Wieczorek-Olchawa et al., 2003; Homa et al., 2003) or by experimental exposures to metal-spiked soil (e.g., Kwadrans et al., 2008; Dutkiewicz et al., 2009; Podolak et al., 2011) or metal-spiked filter paper (e.g., Olchawa et al., 2007; Homa et al., 2005, 2007, 2010). keywords: celomocytes; chlorotica; content; earthworm; eleocytes; et al; fig; metal; morgan; plytycz; plytycz et; riboflavin; soil; species cache: isj-249.pdf plain text: isj-249.txt item: #153 of 465 id: isj-250 author: Coscia, M R; Giacomelli, S; Oreste, U title: Toll-like receptors: an overview from invertebrates to vertebrates date: 2011-11-10 words: 12764 flesch: 51 summary: Moreover, among 20 potential N-linked glycosylation sites in CgToll-1, nine are anchored at the convex surface of LRRs accounting for a high degree of putative N-linked glycosylation in this region (Zhang et al., 2011). Clinical investigations have demonstrated that rare mutations affecting the TLR3-TRIF pathway underlie Herpes simplex encephalitis (Zhang et al., 2007). keywords: analysis; biol; cells; comp; dev; domain; drosophila; ectodomain; et al; evolution; expression; family; fish; genes; genome; http://www.ncbi.nlm.nih.gov/pubmed?term=; human; immune; immunol; innate; like; lrrs; mammalian; molecular; molecules; myd88; pathway; present; protein; receptor; recognition; response; sequences; signaling; species; structure; tir; tlr; tlr2; tlrs; toll; vertebrate cache: isj-250.pdf plain text: isj-250.txt item: #154 of 465 id: isj-251 author: de Eguileor, M; Ottaviani, E title: The central role of immunity in the symbiotic event referred as parasitism date: 2011-11-25 words: 2352 flesch: 52 summary: Here we stress the crucial role of immune system in symbiosis and parasitism. Key Words: immune system; symbiotic interactions Introduction Accordingly to a traditional view, parasite benefits at the expenses of the host. keywords: et al; host; insect; interactions; parasite; parasitoid; system cache: isj-251.pdf plain text: isj-251.txt item: #155 of 465 id: isj-252 author: Camargo Mathias, M I; Scopinho Furquim, K C; Nunes, P H title: Immunomodulatory effects of tick saliva date: 2011-12-06 words: 7702 flesch: 61 summary: Functions of the tick saliva The tick saliva is a mixture that plays a variety of roles during parasitism and non-parasitism periods, as: modulating the immune system of the host (Fawcett et al., 1986; Ribeiro et al., 1985; Wikel, 1999; Sauer et al., 2000); attaching the tick to the host skin through the secretion of cement to form the cone (Fawcett et al., 1986); excreting excess water and ions from the food (blood) (Sauer et al., 2000); secreting hygroscopic solution, which is deposited in the mouth region and absorbs atmospheric water, hydrating the ectoparasite during non-parasitism periods (Sauer et al., 2000; Bowman and Sauer, 2004); producing secretions that lubricate the spermatophore during its transfer to the female during copulation (Feldman-Muhsam et al., 1970); releasing toxins that cause paralysis in the host (Fawcett et al., 1986) and conveying pathogens to the host (Fawcett et al., 1986; Wikel, 1999; Sauer et al., 2000; Bowman and Sauer, 2004). The tick saliva is a complex and sophisticated pharmacological arsenal effectively interacting with elements of the immune-inflammatory and hemostatic system of the host that can hold its defenses quickly since the first days of ectoparasite feeding (Ribeiro et al., 1985; Wikel, 1989; Brossard and Wikel, 1997, 2004; Francischetti et al., 2005, Steen et al., 2006). keywords: activity; binnington; cells; et al; exp; factor; feeding; glands; host; ixodes; molecules; parasitol; protein; rhipicephalus; ribeiro; salivary; sanguineus; species; tick; tick saliva; type; walker; wikel cache: isj-252.pdf plain text: isj-252.txt item: #156 of 465 id: isj-253 author: Wang, L; Wang, L; Huang, M; Zhang, H; Song, L title: The immune role of C-type lectins in molluscs date: 2011-12-07 words: 4604 flesch: 57 summary: Further knowledge of lectin structure will deduct these ubiquitous recognition molecules with myriad exciting functions and applications. The possible use of molluscan lectins in science and technology The activities of lectin are of advantageous within the immune system, both for self/non-self discrimination and interactions between components of the immune system. keywords: binding; carbohydrate; et al; immunol; lectins; molluscan; recognition; type; type lectins; wang; zhang cache: isj-253.pdf plain text: isj-253.txt item: #157 of 465 id: isj-254 author: Poirié, M; Coustau, C title: The evolutionary ecology of aphids' immunity date: 2011-12-19 words: 6498 flesch: 43 summary: We highlight the complexity of predicting evolution of aphid immune resistance in the field, due to variable selection pressures, short-term costs, and cross-talk between symbionts. Aphids can also carry secondary, facultative symbionts that are not required for survival but can be mutualistic in affecting positively various life history traits such as suitability to the plant host, heat tolerance, or protection against natural enemies (Montlor et al., 2002; Oliver et al., 2010). keywords: aphid; biol; et al; host; immune; immunity; interactions; oliver; parasitoids; pea; pisum; plant; resistance; species; symbionts cache: isj-254.pdf plain text: isj-254.txt item: #158 of 465 id: isj-255 author: Ballarin, L title: Ascidian cytotoxic cells: state of the art and research perspectives date: 2012-01-11 words: 4194 flesch: 49 summary: However, unlike arthropod POs, which assemble in vivo to form hexamers (Decker et al., 2007), electrophoretic data indicate that ascidian PO monomers interact each other to form dimers (Frizzo et al., 1999; Parrinello et al., 2003; Cammarata et al., 2008). As for the second point, it is known that MCs contain sulfur in the form of bound sulfates inside their vacuoles (Bell et al., 1982; Scippa et al.,1985; Frank et al., 1987; Ballarin et al., 1995). keywords: activity; ascidian; ballarin; ballarin et; blood; botryllus; cammarata; cells; et al; hemocytes; parrinello; phenoloxidase; schlosseri cache: isj-255.pdf plain text: isj-255.txt item: #159 of 465 id: isj-257 author: Vallesi, A; Alimenti, C; Luporini, P title: XIIIth scientific meeting of the Italian Association of Developmental and Comparative Immunobiology (IADCI), 22 - 24 February 2012, Department of Environmental and Natural Sciences, University of Camerino, Camerino, Italy date: 2012-02-24 words: 10197 flesch: 31 summary: In addition, Er-1 was found to significantly increase gene expression levels and production of specific cytokines in Jurkat cells. Transcriptomic analysis in parallel to detailed functional studies on gene expression and cell biology in in vitro and in vivo experimental models are needed. keywords: activity; analysis; biology; cells; complement; components; department; effects; expression; gene; heavy; hemocytes; immune; italy; marine; metals; mif; organisms; padua; presence; present; response; results; sea; sequences; species; stress; system; university cache: isj-257.pdf plain text: isj-257.txt item: #160 of 465 id: isj-258 author: Zibaee, A; Hoda, H; Fazeli-Dinan, M title: Purification and biochemical properties of a salivary α-amylase in Andrallus spinidens Fabricius (Hemiptera: Pentatomidae) date: 2012-02-29 words: 4902 flesch: 58 summary: So, the aims of the current study were the complete purification and characterization of salivary α-amylase to find its role in EOD process of preys. Miles (1968) divided insect saliva into three categories; i) saliva of hemipterans contains almost exclusively α-amylase like in Lygus disponsi Linnavuori (Hemiptera: Miridae), while other carbohydrases are just present in the alimentary canal, ii) phloem feeder insects like aphids in which carbohydrases are the only salivary enzymes, iii) seed feeder insects whose saliva contains proteases and esterases. keywords: activity; amylase; enzyme; fig; glands; salivary; spinidens; temperature cache: isj-258.pdf plain text: isj-258.txt item: #161 of 465 id: isj-259 author: Mandrioli, M title: Someone like it hot? Effects of global warming on insect immunity and microbiota date: 2012-03-14 words: 4045 flesch: 54 summary: and Bacillus subtilis (Charnley et al., 1995; Dillon and Charnley, 1996, 2005), suggesting that they are more susceptible to infection than normal insects and that the gut microbiota exerted a protective function out-competing potentially harmful organisms (Dillon et al., 2005). In view of its cost, the immune response is influenced therefore by both biotic and abiotic factors (such as food availability and temperature) (Le Moullac and Haffner, 2000; Mydlarz et al., 2006; De Block and Stoks, 2008; Karl et al., 2011). keywords: aphids; change; climate; et al; immune; immunity; insect; reproduction; response; temperature; warming cache: isj-259.pdf plain text: isj-259.txt item: #162 of 465 id: isj-26 author: Abdolmaleki, A; Maafi, Z T; Dastjerdi, H R; Naseri, B; Ghasemi, A title: Immune defense of Pieris brassicae larvae in challenged with Heterorhabditis bacteriophora, its symbiotic bacteria and metabolites date: 2017-03-23 words: 5997 flesch: 55 summary: 1 Analysis of proteins in aqueous extracts of 48 h culture broths of Ptt. 2002). After each injection, the syringe was rinsed three times with ddH2O, three times with 70 % ethanol, and then three times again with sterile ddH2O. Ten microliters of LB diluted in saline and LB were injected into hemocel through proleg using sterilized 25 µl Hamilton syringe as control for living bacteria, aqueous extract, respectively. keywords: 4th; activity; bacteria; bacteriophora; brassicae; control; extracts; heat; instars; larvae; living; phenoloxidase; ptt cache: isj-26.pdf plain text: isj-26.txt item: #163 of 465 id: isj-260 author: Ajamhassani, M; Sendi, J J; Farsi, M J; Zibaee, A title: Purification and characterization of phenoloxidase from the hemolymph of Hyphantria cunea (Lepidoptera: Arctiidae) date: 2012-05-04 words: 5186 flesch: 62 summary: Protein content and PO activity were measured and fractions showing PO activities were pooled; c) CM-Sepharose separation. PO activity has been investigated in other insects such as Manduca sexta (Lepidoptera: Sphingidae), (Hall et al., 1995), Drosophila melanogaster (Diptera: Drosophilidae) (Sezaki et al., 2001), Apis mellifera (Hymenoptera: Apidae) (Zufelato et al., 2004), Pieris rapae (Lepidoptera: Pieridae) (Xue et al., 2006), Heliothis virescens (Lepidoptera: Noctuidae) (Shelbi et al., 2006), Ostrinia furnacalis (Lepidoptera: Pyralidae) keywords: activity; biochem; cunea; enzyme; et al; hemolymph; insect; phenoloxidase; purification cache: isj-260.pdf plain text: isj-260.txt item: #164 of 465 id: isj-261 author: Saberi Riseh, N; Ghadamyari, M title: Biochemical characterization of α-amylases from gut and hemolymph of Rhynchophorus ferrugineus Olivieri (Col.: Curculionidae) and their inhibition by extracts from the legumes Vigna radiata L. and Phaseolus vulgaris L. date: 2012-05-08 words: 5288 flesch: 57 summary: However, as depicted in Fig. 5, intensity of both bands showing α-amylase activity in hemolymph were less than that in the gut, which is correlated well with α-amylase activities in crude extracts. amylase activity of last instar larvae Rhynchophorus ferrugineus. keywords: activity; amylase; amylase activity; bean; ferrugineus; gut; hemolymph; inhibitors; insect; larvae cache: isj-261.pdf plain text: isj-261.txt item: #165 of 465 id: isj-262 author: Fiołka, M J title: Immunotoxic action of cyclosporin A on the humoral immune response of Galleria mellonella pupae date: 2012-05-17 words: 3741 flesch: 48 summary: Key Words: cyclosporin A; immunity; lysozyme activity; peptide activity; Galleria mellonella Introduction Cyclosporin A (CsA) is a cyclic undecapeptide isolated from the fungi Tolypocladium inflatum and Cylindrocarpon lucidium. Diameters of the lytic zones were measured after incubation of the plates at 28 oC for 24 h. The antibacterial activity of hemolymph expressed in terms of lysozyme activity (EC.3.2.1.17) is given in equivalents to µg/ml egg- white lysozyme. keywords: activity; csa; hemolymph; immune; immunization; lysozyme; mellonella; pupae; response cache: isj-262.pdf plain text: isj-262.txt item: #166 of 465 id: isj-263 author: Ottaviani, E; Franceschi, C title: Contribution of invertebrate models to aging and longevity studies date: 2012-05-28 words: 2389 flesch: 52 summary: Accordingly, we not only predict a major role of the gut microbiota in life extension in the invertebrates (Ottaviani et al., 2011), but we also suggest that inflamm-aging, and the underpinning molecular mechanisms and pathways, will also play a prominent role in invertebrate models of life extension. VISIONS AND PERSPECTIVES ISJ 9: 89-92, 2012 ISSN 1824-307X VISIONS AND PERSPECTIVES Contribution of invertebrate models to aging and longevity studies E Ottaviani1, C Franceschi 2, 3 1 Department of Biology, University of Modena and Reggio Emilia, Modena, Italy 2 Department of Experimental Pathology, University of Bologna, Bologna, Italy 3 CIG-Interdepartmental Center L Galvani, University of Bologna, Bologna, Italy Accepted May 28, 2012 keywords: aging; franceschi; invertebrates; life; longevity; ottaviani cache: isj-263.pdf plain text: isj-263.txt item: #167 of 465 id: isj-264 author: Zhao, L; Jones, W A title: Expression of heat shock protein genes in insect stress responses date: 2012-05-14 words: 6478 flesch: 57 summary: 93 http://en.wikipedia.org/wiki/Protein http://en.wikipedia.org/wiki/Dinitrophenol mailto:Liming.zhao@ars.usda.gov mailto:walker.jones@ars.usda.gov http://en.wikipedia.org/wiki/Bacteria http://en.wikipedia.org/wiki/Human 94 Table 1 Examples of heat shock protein gene expression in insects Species Heat shock proteins References Aedes aegypti Hsp26, Hsp83, Hsp70, Hsc70 Zhao et al., 2009 Aedes aegypti Hsp26, Hsp83, Hsp70 Zhao et al., 2010a Aedes aegypti, arthropods Hsp70 Benoit et al., 2011 Aedes aegypti, Anopheles gambiae, Culex pipiens Hsp70, Hsp90 Benoit et al., 2009 Apis mellifera Hsp70 Elekonich, 2009 Belgica antarctica Menin, a widespread regulator of heat shock gene expression and a critical factor in the maintenance of genome integrity, also links the stress response to the control of genome stability in D. melanogaster (Papaconstantinou et al., 2010). keywords: biol; diapause; drosophila; et al; expression; genes; heat; heat shock; hsp23; hsp70; hsps; insect; larvae; melanogaster; mol; protein; radiation; response; rinehart; shock; stress; tolerance cache: isj-264.pdf plain text: isj-264.txt item: #168 of 465 id: isj-265 author: Romero, A; Novoa, B; Figueras, A title: Genomics, immune studies and diseases in bivalve aquaculture date: 2012-06-05 words: 9679 flesch: 56 summary: The transcriptome of mussels was used to select markers that trace contaminants (Venier et al., 2003b, 2006; Dondero et al., 2006a). In mussel, the first systematic production and annotation of ESTs was performed in M. galloprovincialis by Venier et al. (2003a); however, due to the lack of available mussel sequences in the databases, most of the sequences did not exhibit homology. keywords: analysis; aquaculture; aquat; bivalve; crassostrea; disease; edulis; et al; expression; figueras; galloprovincialis; genes; genomic; gigas; immune; immunol; libraries; marinus; molluscs; mussel; mytilus; new; oyster; perkinsus; res; ruditapes; sequencing; shellfish; species; study; virginica cache: isj-265.pdf plain text: isj-265.txt item: #169 of 465 id: isj-266 author: Tarr, D E K title: Nematode antimicrobial peptides date: 2012-06-15 words: 9137 flesch: 55 summary: Defensins Defensins are by far the most studied of nematode antimicrobial peptides. This may become the general rule for nematode antimicrobial peptides, but structure and activity have not been investigated for the caenacins and neuropeptide-like proteins. keywords: 2012; activity; cecropins; clade; cysteine; defensins; disulfide; elegans; et al; groups; mollusc; motif; nematode; peptides; sequences; species; structure; tarr cache: isj-266.pdf plain text: isj-266.txt item: #170 of 465 id: isj-267 author: Ottaviani, E; Malagoli, D; Grimaldi, A; de Eguileor, M title: The case of the “serfdom” condition of phagocytic immune cells date: 2012-07-24 words: 2855 flesch: 49 summary: From invertebrates to vertebrates immune cells are capable of sophisticated performances. As a paradox, it may be stated that a very low level in the functioning of immune system has been attributed for a long time to the vertebrate macrophage and, for extension, also to invertebrate phagocytic immune cells. keywords: cells; et al; invertebrate; ottaviani; phagocytic cache: isj-267.pdf plain text: isj-267.txt item: #171 of 465 id: isj-268 author: Martins, G F; Ramalho-Ortigão, J M title: Oenocytes in insects date: 2012-08-17 words: 10570 flesch: 55 summary: Oenocytes ultrastructure One of the most striking albeit not surprising characteristics of insect oenocytes is the presence of a well-developed SER. Oenocytes in other arthropods In addition to insects, oenocytes have been described in Chelicerata (Romer and Gnatzy, 1981), Miriapoda (Fontanetti et al., 2004), and Crustacea (Symonová and Smrž, 2009). keywords: adult; aegypti; body; cells; cytoplasm; development; drosophila; epidermis; et al; fat; insect; larvae; lipids; locke; martins; martins et; melanogaster; oenocytes; romer; ser; species; staining; synthesis cache: isj-268.pdf plain text: isj-268.txt item: #172 of 465 id: isj-269 author: Grimaldi, A; Girardello, R; Malagoli, D; Falabella, P; Tettamanti, G; Valvassori, R; Ottaviani, E; de Eguileor, M title: Amyloid/Melanin distinctive mark in invertebrate immunity date: 2012-09-14 words: 5310 flesch: 40 summary: The pro-PO activating system is best understood in crayfish Pacifasticus leniusculus (Söderhäll and Smith, 1986), in silkworm Bombyx mori (Ashida and Yoshida, 1990; Yasuhara et al., 1995), in Drosophila melanogaster (Nappi and Vass, 1993; Fujimoto et al., 1995), in Echinoderms such as Holoturia tubulosa (Roch et al., 1992), in Ascidians (Jhoanson and Söderhäll, 1989; Cammarata and Parrinello, 2009; Ballarin, 2012), and in Cephalochordates (Pang et al., 2004). These events have been well-studied in insect host/parasitoid model (Heliothis virescens/Toxoneuron nigriceps) (Ferrarese et al., 2005; Falabella et al., 2012; Grimaldi et al., 2012). keywords: amyloid; ballarin; cells; et al; fibrils; grimaldi; hemocytes; immune; immunity; insect; invertebrates; melanin; nappi; ottaviani; pigment; presence; production; system; söderhäll cache: isj-269.pdf plain text: isj-269.txt item: #173 of 465 id: isj-27 author: de Souza, T AJ; de Carli, G J; Pereira, T C title: Survival potential of the anhydrobiotic nematode Panagrolaimus superbus submitted to extreme abiotic stresses date: 2017-03-28 words: 5252 flesch: 48 summary: Negative Control (NC): hydrated worms immobilized on membrane and exposed to stress; Experimental Group (EG): desiccated worms immobilized on membrane and exposed to stress. PC (Positive Control): desiccated worms immobilized on membranes but not exposed to stress; NC* (Negative Control*): hydrated worms immobilized on membranes but not exposed to stress; NC 100 Gy (or 500 Gy) (Negative Controls): hydrated worms immobilized on membranes and exposed to 100 Gy (or 500 Gy); EG 100 Gy (or 500 Gy) (Experimental Groups): desiccated worms immobilized on membranes and exposed to 100 Gy (or 500 Gy). keywords: anhydrobiosis; group; hydrated; membranes; radiation; superbus; tolerance; worms cache: isj-27.pdf plain text: isj-27.txt item: #174 of 465 id: isj-270 author: Kaito, C; Yoshikai, H; Sekimizu, K title: Utilization of a silkworm model for understanding host-pathogen interactions date: 2012-09-27 words: 3517 flesch: 52 summary: The cvfA gene is also required for the lethality of S. pyogenes in silkworms and mice, and it is involved in the expression of various genes in S. pyogenes (Kaito et al., 2005; Kang et al., 2010; Kang et al., 2012) (Table 1). Injection of human pathogenic bacteria such as Staphylococcus aureus and Pseudomonas aeruginosa into the silkworm hemolymph kills the silkworm (Kaito et al., 2002). keywords: aureus; et al; factors; gene; kaito; model; silkworm; virulence cache: isj-270.pdf plain text: isj-270.txt item: #175 of 465 id: isj-271 author: Sulik, P; Klimek, M; Talik, P; Kruk, J; Morgan, A J; Plytycz, B title: Searching for external sources of the riboflavin stored in earthworm eleocytes date: 2012-10-01 words: 5282 flesch: 49 summary: In earthworms riboflavin acts as a chemoattractant for celomocytes what may facilitate the targeted recruitment of immune-competent celomocytes to the site of pathogen invasion (Mazur et al., 2011). In order to check if the main source of earthworm riboflavin is intestinal microflora the second part of experiments was performed. keywords: antifungal; bacteria; body; earthworm; effects; eleocytes; et al; fig; plytycz; riboflavin; species; week; worms cache: isj-271.pdf plain text: isj-271.txt item: #176 of 465 id: isj-272 author: Bajzek, C; Dushay, M S title: A new in vivo capillary assay of coagulation in invertebrates date: 2012-10-11 words: 2465 flesch: 62 summary: This too is consistent with current models of Drosophila coagulation, and suggests that much of the effect of Bc on wound survival is due to loss of phenoloxidase and defects in plug formation and wound healing, similar to the effects of comparable phenoloxidase blocking mutation lz15 (Galko and Krasnow, 2004). This assay showed that Drosophila larvae bleed more after wounding in the feeding stage of the third instar than in the wandering stage, in line with the change in numbers of hemocytes circulating in the different larval stages. keywords: assay; coagulation; drosophila; larvae cache: isj-272.pdf plain text: isj-272.txt item: #177 of 465 id: isj-273 author: Manfrin, C; De Moro, G; Torboli, V; Venier, P; Pallavicini, A; Gerdol, M title: Physiological and molecular responses of bivalves to toxic dinoflagellates date: 2012-10-31 words: 10144 flesch: 48 summary: Paralytic shellfish toxins in bivalve molluscs: Occurrence, transfer kinetics, and biotransformation. Bacterial degradation of paralytic shellfish toxins. keywords: accumulation; acid; activity; bivalves; dinoflagellate; edulis; effects; et al; exposure; expression; galloprovincialis; human; marine; molluscs; mussels; mytilus; okadaic; phycotoxins; poisoning; psp; psts; response; shellfish; shellfish poisoning; species; studies; toxic; toxicon; toxins cache: isj-273.pdf plain text: isj-273.txt item: #178 of 465 id: isj-274 author: Moret, Y; Moreau, J title: The immune role of the arthropod exoskeleton date: 2012-11-17 words: 4824 flesch: 57 summary: Key Words: invertebrates; immunity; cuticle defense; parasite; ecological immunology Introduction Arthropods include insects, spiders, centipedes, shrimp, and crayfish, and make up the most abundant phylum in the animal kingdom. The physiology of insect cuticle. keywords: arthropods; cuticle; defense; disease; et al; immune; infection; insect; moulting; new; parasites; response; wilson cache: isj-274.pdf plain text: isj-274.txt item: #179 of 465 id: isj-275 author: Ottaviani, E; Malagoli, D; Grimaldi, A; de Eguileor, M title: The immuneregulator role of neprilysin (NEP) in invertebrates date: 2012-11-17 words: 2635 flesch: 55 summary: This last procedure is based on the capacity of NEP to cleave biological peptides (Duvaux-Miret et al., 1992; Otttaviani and Ceselgrandi, 1997) and cytokines (Pierart et al., 1988; Casey et al., 1993; Caselgrandi et al., 2000) molecules that, in turn, activate the cell motility of immunocytes (Scharrer and Stefano, 1994; In the first case, the cytofluorimetric analysis of M. galloprovincialis immunocytes revealed that the cells were positive to CD10 in a range from 8 to 10 % (Fig. 2) (Caselgrandi et al., 2000), while in granulocytes of the insect H. virescens the presence of the enzyme was detected by immunocytochemical (Fig. 3) and Western Blot analysis (Grimaldi et al., 2012). keywords: activity; caselgrandi; cell; endopeptidase; et al; immunocytes; nep; ottaviani cache: isj-275.pdf plain text: isj-275.txt item: #180 of 465 id: isj-276 author: Mantione, K J; Kim, C; Casares, F M; Stefano, G B title: Microarray validation of molecular and cellular signaling in Homarus americanus and Penaeus monodon date: 2012-12-11 words: 5655 flesch: 50 summary: Twarog BM, Muneoka Y, Ledgere M. Serotonin and dopamine as neurotransmitters in mytilus: block of serotonin receptors by an organic mercurial. CHRNA2 cholinergic receptor, nicotinic, alpha 2 (muscle) keywords: alpha; beta; chemokine; cholinergic receptor; dopamine; dopamine receptor; et al; genes; hydroxytryptamine; kinase; lobster; member; motif; muscle; protein; receptor; serotonin; stefano cache: isj-276.pdf plain text: isj-276.txt item: #181 of 465 id: isj-277 author: Obata, M; Komaru, A title: The mechanisms of primordial germ cell determination during embryogenesis in molluscan species date: 2012-12-20 words: 5252 flesch: 61 summary: Toyooka Y, Tsunekawa N, Takahashi Y, Matsui Y, Satoh M, Noce T. Expression and intracellular localization of mouse Vasa-homologue protein during germ cell development. Germ plasm was specifically transmitted to D blastomere derivatives and finally segregated in germ cells in the late gastrula. keywords: blastomeres; cell; cleavage; development; germ; germline; pgc; pgcs; plasm; species; specification; stage; vasa cache: isj-277.pdf plain text: isj-277.txt item: #182 of 465 id: isj-278 author: Mandrioli, M; Manicardi, G C title: Evolving aphids: one genome-one organism insects or holobionts? date: 2013-01-18 words: 3893 flesch: 50 summary: Indeed, the presence of genetic differences among clones could be very important for aphid evolution since several studies showed that cryptic sympatric speciation occurred in a wide range of aphid species (Loxdale, 2008a, b), including evidences of rapid chromosomal changes affecting speciation events in the aphids Rhopalosiphum maidis and Myzus persicae (Blackman, 1987; Brown and Blackman, 1988; Monti et al., 2012). Aphid clones cannot be considered as evolutionary individuals in any sense of the term neither the idea of aphids as a single genome species should be further considered in the light of the existence of the aphid hologenome. keywords: aphid; et al; evolution; genome; host; loxdale; moran; resistance; rosenberg; symbionts cache: isj-278.pdf plain text: isj-278.txt item: #183 of 465 id: isj-279 author: Grimaldi, A; Ferrarese, R; Tettamanti, G; Valvassori, R; de Eguileor, M title: Ras activation in Hirudo medicinalis angiogenic process date: 2013-02-18 words: 4155 flesch: 54 summary: Effect of Ras61 on botryoidal tissue cells Botryoidal tissue cells have been transformed both with GFP and Ras61 (constitutively activated RAS protein) in order to: a) define the effects of Ras activation on botryoidal tissue phenotypes; b) to determine whether Ras activation was sufficient to cause actin filaments polymerization, driving angiogenic responses without the synergistic VEGF induction. Our findings indicate that assembly and disassembly of actin filaments regulated by Ras protein is involved in morphological modification of botryoidal tissue cells during leech angiogenic process. keywords: actin; botryoidal; cells; endothelial; figs; gfp; ras; ras61; tissue; vegf cache: isj-279.pdf plain text: isj-279.txt item: #184 of 465 id: isj-28 author: Nie, Z; Lü, P; Chen, X; Wang, Q; Meng, X; Lu, S; Dong, X; Chen, K title: Reference gene selection for quantitative real-time polymerase chain reaction analysis in Bombyx mori nucleopolyhedrovirus-infected silkworms date: 2017-03-29 words: 4232 flesch: 48 summary: Quantitative methods of analyzing gene expression at the transcriptional mailto:kpchen@ujs.edu.cn 95 Table 1 Candidate RGs and their primers for qPCR analysis level, such as quantitate polymerase chain reaction (qPCR), RNA blotting, RNase protection analysis, and gene chip technology, as well as quantitative methods that analyze expression at the protein level, such as western blotting, all require the calculation of a RG to target gene expression ratio to obtain reliable results. A lower M value indicates higher stability of gene expression (Bustin et al., 2009). keywords: analysis; bc8; bmnpv; expression; genes; infected; silkworms; tubulin; virus cache: isj-28.pdf plain text: isj-28.txt item: #185 of 465 id: isj-280 author: Stanley, D title: Aging and immunosenescence in invertebrates date: 2012-06-11 words: 6347 flesch: 50 summary: A sketch of insect immunity Some readers may not be fully aware of insect immunity and this simple sketch is designed to facilitate reading this essay without referring to external literature. Gillespie et al. (1997) review signal systems in insect immunity. keywords: age; aging; elegans; expression; flies; genes; hemocytes; immunity; immunocompetence; immunosenescence; infection; insect; invertebrates; life; research; senescence cache: isj-280.pdf plain text: isj-280.txt item: #186 of 465 id: isj-282 author: Parrinello, N; Arizza, V; Cammarata, M; Parisi, M G; Vazzana, M; Vizzini, A title: XIVth scientific meeting of the Italian Association of Developmental and Comparative Immunobiology (IADCI), 14 - 16 February 2013, Department of Biological Chemical Pharmaceutical Science and Technology, University of Palermo, Palermo, Italy date: 2013-02-16 words: 11116 flesch: 31 summary: Now we show that the amyloid production is not only linked to precursor melanin activation and synthesis but it is fundamentally important to guaranty a state of cellular redox equilibrium due to regulation of ROS presence, i.e., amyloid fibrils production could be considered as a basic cellular compensatory response endeavouring to attenuate oxidative stress in different cell types. Sessioni: ISJ 10: 15-28, 2013 ISSN 1824-307X REPORT OF MEETING XIVth scientific meeting of the Italian Association of Developmental and Comparative Immunobiology (IADCI), 14 - 16 February 2013, Department of Biological Chemical Pharmaceutical Science and Technology, University of Palermo, Palermo, Italy Organizers: N Parrinello, V Arizza, M Cammarata, MG Parisi, M Vazzana, A Vizzini Department of Biological Chemical Pharmaceutical Science and Technology, University of Palermo, Palermo, Italy Plenary lecture From signal transduction to gene expression in innate immunity: learning from the mussel model P Roch, M Toubiana Ecologie des Systèmes Marins et Côtiers (EcoSym), Université Montpellier 2-CNRS, Montpellier, France Antimicrobial peptides (AMP) are certainly one of the major effectors of the anti-infectious innate immunity. keywords: activity; analysis; bacteria; cells; chemical; effects; expression; gene; hemocytes; hemolymph; immune; injection; italy; mussel; padua; palermo; peptides; pharmaceutical; presence; protein; response; results; science; sea; species; stress; study; system; technology; time; university cache: isj-282.pdf plain text: isj-282.txt item: #187 of 465 id: isj-283 author: Hibino, T; Nonaka, M title: A novel third complement component C3 gene of Ciona intestinalis expressed in the endoderm at the early developmental stages date: 2013-03-29 words: 5901 flesch: 58 summary: Discussion It had been reported that the number of complement C3 gene is one in H. roretzi, and two in C. intestinalis (Nonaka et al., 1999; Marino et al., 2002; The phylogenic analysis of C3 genes have indicated that the gene duplication event between CiC3-1 and CiC3-2 occurred in the Enterogona lineage after the divergence from Pleurogona (Marino et al., 2002). keywords: acid; amino; ascidian; cic3; complement; domain; embryos; et al; expression; gene; intestinalis; thioester; vertebrate cache: isj-283.pdf plain text: isj-283.txt item: #188 of 465 id: isj-284 author: Grdiša, M; Gršić, K; Grdiša, M D title: Earthworms - role in soil fertility to the use in medicine and as a food date: 2013-04-04 words: 6591 flesch: 62 summary: Moreover, in the folk medicine (North American Indians, doctors in East Asia) the EWs have been used for the treatment of various diseases (Cooper et al., 2004). They possess innate immunity, as well as some functions associated with the adaptive immunity (allogenic tissue rejection) (Cooper et al., 1995, 1999). keywords: activities; activity; biochem; biol; cooper; earthworm; eisenia; enzymes; et al; ews; fibrinolytic; fluid; foetida; food; grdiša; lumbricus; proteins; role; sci; soil cache: isj-284.pdf plain text: isj-284.txt item: #189 of 465 id: isj-285 author: Mandrioli, M; Ottaviani, E title: The self/non-self dualism is still so marked as it was considered for a long time? date: 2013-05-27 words: 2743 flesch: 53 summary: Similarly, the expression of some genes related to the immune response is highly related to the microbiome composition since, for instance, microbial symbionts provide developmental signals that limit the proliferation of basophil progenitor cells and thereby prevent basophil-induced allergic responses in vertebrate, so that multiple populations of intestinal immune cells require the microbiota for their full development and function (Gilbert et al., 2012; Hill et al., 2012). At the same time, the dysregulation of immune responses versus the commensal microbiota is related to intestinal inflammations occurring directly in consequence of disequilibria between the finely tuned pro- and anti- inflammatory mechanisms within the gastrointestinal tract (Dupaul-Chicoine, 2010; Maloy and Powrie 2011). keywords: immune; non; recognition; self; system; toll cache: isj-285.pdf plain text: isj-285.txt item: #190 of 465 id: isj-286 author: Tumminello, R A; Fuller-Espie, S L title: Heat stress induces ROS production and histone phosphorylation in celomocytes of Eisenia hortensis date: 2013-06-16 words: 5109 flesch: 54 summary: Reproducibly we observed significant (p < 0.05) increases in ROS production and decreases in cell viability at temperatures of 28 °C and above. Detection of cell viability and ROS The viability dye 7-aminoactinomycin D (7-AAD; BD Biosciences) was employed for two purposes: 1) to enable the elimination of dead cells from our ROS analyses; and 2) to determine percent viable cells. keywords: assays; cell; celomocytes; control; dna; flow; h2ax; heat; production; ros; stress; viability cache: isj-286.pdf plain text: isj-286.txt item: #191 of 465 id: isj-287 author: Zdybicka-Barabas, A; Cytryńska, M title: Apolipophorins and insects immune response date: 2013-07-30 words: 7964 flesch: 57 summary: (*) denotes processes in which lipophorin particles or apoLp- I/II are involved From 14 to 16 molecules of apoLp-III can be associated with the LDLp surface (Kawooya et al., 1984, 1986; Wells et al., 1987; Van der Horst et al., 1991). Physical and surface properties of insect apolipophorin III. keywords: activity; apolipophorin; apolipophorin iii; apolipoprotein; apolp; binding; biochem; biol; et al; galleria; hemolymph; iii; immune; insect; lipid; lps; mellonella; protein; response; ryan; van; weers cache: isj-287.pdf plain text: isj-287.txt item: #192 of 465 id: isj-288 author: Hayashi, Y; Engelmann, P title: Earthworm’s immunity in the nanomaterial world: new room, future challenges date: 2013-08-22 words: 5435 flesch: 49 summary: In invertebrates, haemocytes from insects (Franc et al., 1996) and molluscs (Liu et al., 2011) are known to effect scavenger receptor-mediated uptake of pathogens and apoptotic cells. When the molluscs were exposed in vivo to NPs in an aquatic system, the digestive gland appeared as the likely target of NPs with signatures of oxidative stress and haemocyte damages (Canesi et al., 2010b). keywords: agnps; cells; coelomocytes; der; earthworm; eisenia; environ; et al; fetida; hayashi; immune; immunity; nanomaterials; nanoparticles; nps; responses; silver; uptake; van cache: isj-288.pdf plain text: isj-288.txt item: #193 of 465 id: isj-289 author: Wang, L; Yang, C; Song, L title: The molluscan HSP70s and their expression in hemocytes date: 2013-09-23 words: 5160 flesch: 59 summary: Zheng et al., 2012), scallop (Song et al., 2006; Wang et al., 2009), oyster (Boutet et al., 2003a and 2003b; Piano et al., 2005; Zhang and Zhang, 2012; Zhang et al., 2012), mussel (Franzellitti and Fabbri, 2005; Cellura et al., 2006; Kourtidis et al., 2006), abalone (Cheng et al., 2007), and clam (Park et al., 2007; Recently, the expression of HSP70s in molluscan hemocytes have been investigated extensively against several environment stressors, such as high temperature (Yang et al., unpublished data), heavy metal (Taylor et al., 2013), pollutants of toxins (Mello et al., 2012; Mello et al., 2013), pharmaceuticals (Gust et al., 2013), bacterial infections (Wang et al., 2009) and seasonal changes (Li et al., 2009), and their expression profiles are generally divided into three cases, up-regulated, invariable and down-regulated. keywords: cell; et al; expression; family; gene; gigas; heat; hemocytes; hsp70; molluscan; oyster; protein; response; shock; stress; stressors; zhang cache: isj-289.pdf plain text: isj-289.txt item: #194 of 465 id: isj-29 author: Gerdol, M title: Immune-related genes in gastropods and bivalves: a comparative overview date: 2017-03-29 words: 11460 flesch: 52 summary: (Tasumi and Vasta, 2007; Kim et al., 2008) and various types of bacteria (Zhang et al., 2011; Maldonado-Aguayo et al., 2014). While extensive works have been carried out to document the genetic and molecular background of both gastropod (Loker 2010, Coustau et al., 2015) and bivalve (Gerdol and Venier, 2015; Song et al., 2015; Zhang et al., 2015) innate immune system, little attention has been paid so far at providing a comparative account of the differences between the two major molluscan classes. keywords: activity; bivalves; domain; et al; expression; fish; gastropods; gene; gerdol; immune; immunol; lectin; molecular; molecules; molluscan; molluscs; novel; oyster; peptides; proteins; recognition; response; shellfish; species; sting; system; wang; zhang cache: isj-29.pdf plain text: isj-29.txt item: #195 of 465 id: isj-290 author: Li, Q; Zhao, X; Kong, L; Yu, H title: Transcriptomic response to stress in marine bivalves date: 2013-09-25 words: 7823 flesch: 52 summary: The current literature shows that bivalves eliminate or limit the development of the microorganisms through different innate immune response in combination with other cellular mechanism, such as the apoptotic pathway by transcriptomic analysis (Wang et al., 2010; De Lorgeril et al., 2011; Morga et al., 2011; Brulle et al., 2012; Moreira et al., 2012a; Moreira et al., 2012b). For mussels, the salinity may determine the outcome of competition between native and invasive mussels (Lockwood et al., 2011). keywords: bivalves; crassostrea; et al; expression; genes; gigas; gills; hypoxia; immune; marine; mortality; mussels; mytilus; oysters; pacific; pcr; response; ssh; stress; stresses; studies; summer; time; transcriptomic cache: isj-290.pdf plain text: isj-290.txt item: #196 of 465 id: isj-291 author: Nikapitiya, C; Dorrington, T; Gómez-Chiarri, M title: The role of histones in the immune responses of aquatic invertebrates date: 2013-10-04 words: 5655 flesch: 51 summary: Therefore, binding of histones to LPS released from Gram- negative bacteria may also block the production of cytokines such as tumor necrosis factor alpha (TNF- α) that can often leads to fatalities from toxic shock in humans (Kim et al., 2002). Furthermore, recombinant human histones H2A and H2B efficiently kill promastigotes of the parasites Leishmania amazonensis, L. major, L. braziliensis, and L. mexicana (Wang et al., 2011). keywords: activity; bacteria; cells; challenge; et al; fish; genes; gram; h2a; h2b; histones; immune; immunol; invertebrate; kim; response; role; species; traps cache: isj-291.pdf plain text: isj-291.txt item: #197 of 465 id: isj-292 author: Liu, F; Xu, Q; Zhang, Q; Lu, A; Beerntsen, B T; Ling, E title: Hemocytes and hematopoiesis in the silkworm, Bombyx mori date: 2013-10-09 words: 6193 flesch: 55 summary: In the silkworm hemolymph, there are 5 types of circulating hemocytes that are classified as prohemocytes, granulocytes, plasmatocytes, spherulocytes and oenocytoids. When its hematopoietic organs are extirpated through a surgical operation, circulating hemocytes can still remain at a high level through the wandering stage due to an increase in the level of cell division. keywords: bombyx; cells; drosophila; et al; hematopoietic; hemocytes; insect; ling; mori; organs; plasmatocytes; ppo; silkworm; strand cache: isj-292.pdf plain text: isj-292.txt item: #198 of 465 id: isj-293 author: Mirhaghparast, S K; Zibaee, A; Hajizadeh, J title: Effects of Beauveria bassiana and Metarhizium anisopliae on cellular immunity and intermediary metabolism of Spodoptera littoralis Boisduval (Lepidoptera: Noctuidae) date: 2013-10-27 words: 4267 flesch: 51 summary: Overall activity of the enzymes in the larvae injected by M. anisopliae spores was higher than that of B. bassiana spores (Fig. 3). Injection of larvae by B. bassiana spores caused the highest number of nodules 12 hours post- injection but spores of M. anisopliae caused the highest number of nodules after 1-6 hours of post- injection. keywords: activity; anisopliae; bassiana; entomopathogenic; fungi; hours; injection; larvae; littoralis; spores cache: isj-293.pdf plain text: isj-293.txt item: #199 of 465 id: isj-294 author: Dolashka, P; Voelter, W title: Antiviral activity of hemocyanins date: 2013-10-11 words: 4660 flesch: 29 summary: (Dolashka et al., 2010; Dolashka-Angelova et al., 2011; Nesterova et al., 2011). 124 Fig. 4 3D model of functional unit RvH2-e. Amino acid residues included in the loops are shown in blue and green (Dolashka et al., 2010) Glycosylation of hemocyanins The relevance of specific glycosylation patterns as a differentiating factor for immunostimulatory properties has already been raised in studies on the hemocyanin isoforms KLH1 and KLH2 of M. crenulata and R. venosa, (Geyer et al., 2005; Sandra et. keywords: activity; angelova; angelova et; antiviral; dolashka; et al; hcs; hemocyanins; infection; molluscan; proteins; rvh; rvh2; subunits; syndrome; virus cache: isj-294.pdf plain text: isj-294.txt item: #200 of 465 id: isj-295 author: Ghasemi, V; Moharramipour, S; Sendi, J J title: Circulating hemocytes of Mediterranean flour moth, Ephestia kuehniella Zell. (Lep: Pyralidae) and their response to thermal stress date: 2013-10-27 words: 7786 flesch: 63 summary: 1 Light microscopy pictures of E. kuehniella hemocytes stained with Giemsa. Differential counting of hemocyte morphotypes was performed by classifying 200 cells per smear (Arnold and Hinks 1976). keywords: cells; hemocytes; hemolymph; increase; insect; instar; kuehniella; larvae; stages; table; temperature; thc cache: isj-295.pdf plain text: isj-295.txt item: #201 of 465 id: isj-296 author: Wang, L; Gao, Q; Shi, F; Yang, C; Qiu, L; Zhang, H; Zhou, Z; Song, L title: The comparative study of immunity between two scallop species Chlamys farreri and Argopecten irradians date: 2013-11-12 words: 6279 flesch: 59 summary: After challenged with Vibrio anguillarum, the ROS level in hemocytes of Bay scallops was significantly lower than that of Zhikong scallops at 30 min, and the cumulative mortality of Bay scallop was also significantly lower than that of Zhikong scallop at 2nd-5th day. 4 ROS levels of Zhikong scallop and Bay scallop hemocytes challenged by V. anguillarum. keywords: activity; bay; bay scallops; burst; challenge; control; et al; exposure; hemocytes; l-1; mortality; pb2; scallops; species; zhikong; zhikong scallops cache: isj-296.pdf plain text: isj-296.txt item: #202 of 465 id: isj-297 author: Okrzesik, J; Kachamakova-Trojanowska, N; Jozkowicz, A; Morgan, A J; Plytycz, B title: Reversible inhibition of reproduction during regeneration of cerebral ganglia and celomocytes in the earthworm Dendrobaena veneta date: 2013-11-25 words: 6944 flesch: 46 summary: Differential expression of three labial genes during earthworm head regeneration. Sulik P, Klimek M, Talik P, Kruk J, Morgan AJ, Plytycz B. Searching for external sources of the riboflavin stored in earthworm eleocytes. keywords: brain; celomocyte; control; earthworm; et al; fig; ganglion; group; regeneration; riboflavin; treatment; weeks; worms cache: isj-297.pdf plain text: isj-297.txt item: #203 of 465 id: isj-298 author: Devi, V R; Basil-Rose, M R; Pallaty, M D title: The biological role of hemolymph lectins in Episesarma tetragonum date: 2013-12-12 words: 4889 flesch: 53 summary: The enhancement of lectin activity in response to foreign cells suggests a specific lectin - foreign cell interaction. Similar patterns of augmentation in lectin activity after administration of erythrocytes is also reported in earthworms (Stein et al., 1987), insects (Jayalakshmi, 2005), oyster, Crassostrea gigas (Hardy et al., 1977) fresh water snail, Planorbarius corneus (Ottoviani et al., 1986), millipedes (Basil Rose, 1999) and crabs (Mercy and Ravindranath, 1994; Jayasuriya, 2000; Maghil, 2001). keywords: activity; clearance; crab; dog; erythrocytes; hemolymph; horse; human; injection; lectin; titer cache: isj-298.pdf plain text: isj-298.txt item: #204 of 465 id: isj-299 author: Ottaviani, E title: The importance of studying invertebrate immune-neuroendocrine functions date: 2013-12-15 words: 1771 flesch: 37 summary: As far as the immune- neuroendocrine system is concerned, my group as well as others have revealed the involvement of numerous mediators in what that include mammalian-like molecules such as the neurohormone corticotrophin releasing hormone (CRH); proopiomelanocortin products such as corticotropin (ACTH) and β-endorphin; small bioactive molecules such as norepinephrine, epinephrine and dopamine, steroid hormones such as glucocorticoids, cytokines such as IL-1, IL-6 and TNF-α and gaseous mediators such as nitric oxide (Ottaviani et al., 1997). But while changes ___________________________________________________________________________ Corresponding author: Enzo Ottaviani Department of Life Sciences University of Modena and Reggio Emilia via Campi 213/D, 41125 Modena, Italy E-mail: enzo.ottaviani@unimore.it have been found to be important we can now assert on the basis of our previous data (Ottaviani and Franceschi, 1996; Ottaviani et al., 1997) as well as the molecular data now available in the literature on all the major families of proteins (antibodies, adhesion molecules, heat shock molecules, calcium-binding molecules, etc.) that conserved traits are highly significant and, in some cases, more relevant than changes. keywords: franceschi; immune; invertebrates; molecules; ottaviani; research cache: isj-299.pdf plain text: isj-299.txt item: #205 of 465 id: isj-30 author: Vizzini, A title: Gene expression and regulation of molecules involved in pharynx inflammatory response induced by LPS in Ciona intestinalis date: 2017-04-04 words: 6838 flesch: 53 summary: Inflammatory response in the pharynx Effector molecules Following an LPS challenge or the inoculation of a foreign agent into the ascidian body wall, several inflammatory events are initiated, including hemocyte recruitment into the inflamed tissue (Parrinello, 1981; Parrinello et al., 1984a, b; Parrinello and Patricolo, 1984). Granulocytes and compartment/morula cells are CiTNFα-producing cells in both the inflamed pharynx and larvae (Parrinello et al., 2010). keywords: cells; ciona; et al; expression; genes; hemocytes; immune; inflammation; innate; intestinalis; lps; mrna; parrinello; pharynx; protein; response; tissue; vizzini cache: isj-30.pdf plain text: isj-30.txt item: #206 of 465 id: isj-300 author: Ulu, T C; Susurluk, I A title: Heat and desiccation tolerances of Heterorhabditis bacteriophora strains and relationships between their tolerances and some bioecological characteristics date: 2013-12-16 words: 3890 flesch: 52 summary: Thus, the potential reduction of symbiotic bacteria may explain why heat tolerant strains had less infectivity capabilities in the present study. Abstract Heat tolerances, desiccation tolerances, and effectiveness of 10 Heterorhabditis bacteriophora strains isolated from different climatic regions in Turkey were analyzed in laboratory conditions. keywords: bacteriophora; desiccation; ehlers; heat; origins; strains; tolerances cache: isj-300.pdf plain text: isj-300.txt item: #207 of 465 id: isj-301 author: Khosravi, R; Sendi, J J; Zibaee, A; Shokrgozar, M A title: Immune reactions of the lesser mulberry pyralid, Glyphodes pyloalis Walker (Lepidoptera: Pyralidae) to the entomopathogenic fungus, Beauveria bassiana (Bals.- Criv.) Vuill and two developmental hormones date: 2013-12-27 words: 6517 flesch: 57 summary: The eicosanoids (Stanley, 2000), biogenic amines (Baines et al., 1992) adipokinetic hormone (Goldsworthy et al., 2003), juvenile hormone (JH) and 20-hydroxyecdysone (20E) (Franssens et al., 2006) change insect immune response to pathogenic agents. Catalán TP, Wozniak A, Niemeyer HM, Kalergis AM, Bozinovic F. Interplay between thermal and immune ecology: Effect of environmental temperature on insect immune response and energetic costs after an immune challenge. keywords: activity; bassiana; ecdysone; et al; hemocyte; injection; insect; larvae; number; pyloalis; response; spores cache: isj-301.pdf plain text: isj-301.txt item: #208 of 465 id: isj-302 author: Ballarin, L; Covre, V; Masiero, L; Casellato, S title: Immunotoxic effects of fluoride on the hemocytes of Venerupis philippinarum date: 2014-01-05 words: 4237 flesch: 53 summary: Recent results indicate that, when present at high levels, the ion causes cell toxicity, mainly related to the induction of oxidative stress and the activation of the apoptotic pathway (Barbier et al., 2010; Gutowska et al., 2010; Jacinto-Alemán, 2010; Wang et al., 2010; Liu et al., 2011). The observed occurrence of apoptosis is likely related to the induction of oxidative stress: this hypothesis fits previous observations demonstrating that one of the main effects of fluoride on cells is the inhibition of antioxidant enzymes and the increase of NADPH oxidase activity with the consequent production of reactive oxygen species (Barbier et al., 2010; Izquierdo-Vega et al., 2011; Liu et al., 2011). keywords: assay; cells; effects; et al; fig; fluoride; fsw; hemocytes; naf; philippinarum cache: isj-302.pdf plain text: isj-302.txt item: #209 of 465 id: isj-303 author: Díaz-Resendiz, K J G; Romero-Bañuelos, C A; Robledo-Marenco, M L; Rojas-García, A E; Barrón-Vibanco, B S; Medina-Díaz, I M; Girón-Pérez, M I title: Deregulation of the humoral immune response of the oyster (Crassostrea corteziensis) exposed to naphthalene date: 2014-01-15 words: 5032 flesch: 57 summary: Studies referring the effect of PAH on this parameter indicate that benzo[a]pyrene inhibits lysozyme activity in the hemolymph of bivalves (Gopalakrishnan et al., 2009; Matozzo et al., 2009; Gopalakrishnan et al., 2011). Studies on the immunotoxicity of PAH in molluscs have demonstrated drastic changes in the immunocompetence of this type of organism (Sauve et al., 2002; Gagnaire et al., 2004; Thiagarajan et al., 2007). keywords: activity; corteziensis; crassostrea; days; et al; exposure; immune; lysozyme; l–1; naphthalene; oyster; pacific; production; response cache: isj-303.pdf plain text: isj-303.txt item: #210 of 465 id: isj-304 author: Parisi, M G; Trapani, M R; Cammarata, M title: Granulocytes of sea anemone Actinia equina (Linnaeus, 1758) body fluid contain and release cytolysins forming plaques of lysis date: 2014-01-20 words: 5551 flesch: 59 summary: Cell bands are cytolytic towards various erythrocyte targets and lysis is inhibited by sphingomyelin A. equina cells lysate was assayed for its hemolytic activity (CLC) using the rabbit erythrocytes. A) Percentage of hemolysis towards rabbit erythrocytes of A. equina cell lysate from bands B1, B2, B3, unfractionated cell and debris. keywords: actinia; activity; anderluh; anemone; bands; cell; cytotoxic; equina; equinatoxin; erythrocytes; et al; gradient; percoll; sea; toxins cache: isj-304.pdf plain text: isj-304.txt item: #211 of 465 id: isj-305 author: Memarizadeh, N; Ghadamyari, M; Adeli, M; Talebi, K title: Biochemical biomarkers of Glyphodes pyloalis Walker (Lepidoptera: Pyralidae) in exposure to TiO2 nanoparticles date: 2014-01-28 words: 4652 flesch: 58 summary: Because of the importance of general ESTs in the insect physiology, metabolism and detoxification of xenobiotics, in this study the possible role of these enzymes as a biomarker to determination of NPs toxicity was investigated (Ishaaya, 1993; Memarizadeh et al., 2013). EST, GST and POD as biochemical biomarkers are useful diagnostic tools to determination of NPs toxicity. keywords: activities; activity; concentrations; est; et al; exposure; gst; nps; pod; pyloalis; time; tio2; toxicity cache: isj-305.pdf plain text: isj-305.txt item: #212 of 465 id: isj-306 author: Abelli, L; Mancia, A; Marchetti, M G; Lunardi, D; Zuccon, G title: XVth scientific meeting of the Italian Association of Developmental and Comparative Immunobiology (IADCI), 12 - 14 February 2014, Department of Life Sciences and Biotechnology, University of Ferrara, Ferrara, Italy date: 2014-02-14 words: 9664 flesch: 30 summary: In all these species, the receptor is mediating immune response against pathogens activating cytokine secretion and phagocytosis. Immune responses imply an increase in oxygen consumption with a consequent risk of oxidative stress. keywords: activity; analysis; antarctic; biology; cells; data; department; evolution; expression; ferrara; gene; hemocytes; immune; italy; life; mhc; molecules; padua; pheromone; proteins; response; sciences; species; study; system; time; university cache: isj-306.pdf plain text: isj-306.txt item: #213 of 465 id: isj-307 author: Delkash-Roudsari, S; Zibaee, A; AbbaciMozhdehi, M R title: Determination of lipase activity in the larval midgut of Bacterocera oleae Gmelin (Diptera: Tephritidae) date: 2014-02-07 words: 3401 flesch: 59 summary: In the current study, digestive lipase activity was determined and characterized in the third larval instars of olive fly, Bactericera oleae as the first time in dipteran order. Zibaee (2012) found that Mg2+, Na+, EDTA and TTHA significantly affect digestive lipase activity in P. brassicae. keywords: activity; digestive; lipase; membrane; zibaee cache: isj-307.pdf plain text: isj-307.txt item: #214 of 465 id: isj-308 author: Ottaviani, E; Franchini, A; Mandrioli, M title: The main actors involved in extending the invertebrate life span date: 2014-02-03 words: 3272 flesch: 59 summary: Similarly, non-virulent strains of Wolbachia can extend Drosophila life span (Fry and Rand, 2002) and experiments performed using axenic cultures and antibiotic treatment revealed that exposure to bacteria during the first week of adult life increased longevity by 30 - 35 % in flies (Pletcher et al., 2002; Seroude et al., 2002; Brummel et al., 2004). The possible regulative role of A. pomorum in fly life span is not surprising taking into account that the digestive tract of many insect species harbours several bacteria that perform different beneficial functions to their host and may affect host longevity 75 Fig. keywords: bacteria; body; drosophila; fat; flies; insulin; life; longevity; signaling; span cache: isj-308.pdf plain text: isj-308.txt item: #215 of 465 id: isj-309 author: de Almeida, G D; Zanuncio, J C; Senthil-Nathan, S; Pratissoli, D; Polanczyk, R A; Azevedo, D O; Serrão, J E title: Cytotoxicity in the midgut and fat body of Anticarsia gemmatalis (Lepidoptera: Geometridae) larvae exerted by neem seeds extract date: 2014-02-14 words: 4262 flesch: 54 summary: The cells of the midgut epithelium of A. gemmatalis larvae showed swelling, basal membrane detachment and complete disruption after exposure to NSKE. SDS-PAGE The analyses of protein profile of haemolymph and fat body of A. gemmatalis larvae were adapted from the methods described byHuang et al. keywords: azadirachtin; diet; effects; fat; fig; gemmatalis; larvae; lepidoptera; midgut; neem; nske; ppm cache: isj-309.pdf plain text: isj-309.txt item: #216 of 465 id: isj-31 author: Dong, X; Lü, P; Cao, W; Zhang, C; Zhu, F; Meng, X; Nie, Z; Lu, S; Chen, K title: Study of the toxicity of Bacillus cereus on silkworm (Bombyx mori) and the relevant proteome date: 2017-04-11 words: 6327 flesch: 57 summary: 3 Two-dimensional electrophoretic (2-DE) map of Bombyx mori fat body protein. 4 Two-dimensional electrophoretic (2-DE) map of Bombyx mori midgut protein. keywords: bacillus; bacteria; body; bombyx; cell; cereus; et al; expression; fig; group; infection; midgut; mori; protein; silkworm; spots; tissue cache: isj-31.pdf plain text: isj-31.txt item: #217 of 465 id: isj-310 author: Lombardo, T; Peralta, D M; Kornblihtt, L; Blanco, G A title: Sipunculan celomocytes increase the resistance to H2O2-induced cell death under hypoxia date: 2014-03-04 words: 9883 flesch: 57 summary: The sigmoid shape of the cytotoxic H2O2 dose-effect curve showed that at lower doses the rate of change in cell death effect was low. Exposure to 24 h hypoxia did not cause cell death but induced intracellular acidification. keywords: cell death; cells; celomocytes; damage; dapi; death; dose; effect; et al; fda; fluorescence; h2o2; hypoxia; intracellular; median; mmp; nacl; oxidative; production; ros; zymosan cache: isj-310.pdf plain text: isj-310.txt item: #218 of 465 id: isj-311 author: Jiang, X; Tang, C; Gao, H; Cui, H title: Mechanisms of asymmetric cell divisions in Drosophila melanogaster neuroblasts date: 2014-04-04 words: 4157 flesch: 56 summary: Thus, the Par complex is crucial for asymmetric cell divisions since it provides essential positional information for cell division. (AZ4)Stem cells are defined as the cells not only can self-renew and produce daughter cells devoting to differentiate for ages,but also repair injury and maintaining cellular homeostasis.(AZ10)Moreover,they use two main strategies for division,including ISJ 11: 103-108, 2014 ISSN 1824-307X MINIREVIEW Mechanisms of asymmetric cell divisions in Drosophila melanogaster neuroblasts X Jiang, C Tang, H Gao, H Cui State Key Laboratory of Silkworm Genome Biology, Southwest University, Chongqing 400716, P.R. China Accepted April 4, 2014 Abstract Stem cells possess the properties of self-renewal and differentiation, and mainly rely on two strategies for division, including symmetric and asymmetric cell divisions. keywords: asymmetric; cell; determinants; divisions; drosophila; fate; nbs; numb; prospero; spindle; stem cache: isj-311.pdf plain text: isj-311.txt item: #219 of 465 id: isj-312 author: Garcia-Carreño, F L; Navarrete del Toro, M A; Muhlia-Almazan, A title: The role of lysosomal cysteine proteases in crustacean immune response date: 2014-04-22 words: 8222 flesch: 49 summary: Although not exclusively, apoptosis is a process of cell destruction requiring cysteine proteases called caspases (Wang et al., 2008). The protein is synthesized as a pre-proenzyme and targeted to lysosomes, and it may exhibit both,   110 Table 1 Lysosomal cysteine proteases from Crustacea species Enzyme Species Tissue/organ Protein size (aas) Suggested function Reference Cathepsin B Pandalus borealis MG exclusive 328 Hydrolysis of food protein Aoki et al., 2003 Cathepsin B Litopenaeus vannamei Hm, Gills, Amp, M, MG, Gut, GJ 331 Hydrolysis of food protein/Intracellular protein hydrolysis Stephens et al., 2012 Cathepsin B Fenneropenaeus chinensis Muscle, Gills, MG 331 May participate in anti- WSSV immune reactions Li et al., 2013 Cathepsin C Penaeus monodon O, H, MG, M, P, B 449 Perhaps involved in the immune defense Qiu et al., 2008 Cathepsin C Eriocheir sinensis Hm 427 Involved in the innate immune system Li et al., 2010 Cathepsin C F. chinensis Hm, MG, Gills, Gut 451 May play a role in the antiviral immune response Wang et al., 2012 Cathepsin L Homarus americanus MG, GJ 323, 322, 321 keywords: apoptosis; caspases; cathepsin; cell; crustaceans; cysteine; enzyme; et al; functions; immune; immunity; immunol; innate; lysosomal; molecules; proteases; protein; response; role; serine; shrimp; species; specific; studies; system cache: isj-312.pdf plain text: isj-312.txt item: #220 of 465 id: isj-313 author: Yi, Q; Liu, R; Sun, R; Wang, L; Zhou, Z; Wang, M; Liu, Y; Sun, J; Madzak, C; Song, L title: The protection of CpG ODNs and Yarrowia lipolytica harboring VP28 for shrimp Litopenaeus vannamei against White spot syndrome virus infection date: 2014-04-22 words: 8301 flesch: 61 summary: In addition, increased mRNA expression levels of STAT and Dicer were observed in CpG group post WSSV challenge. The enzyme activity in CpG ODNs feeding shrimps kept increasing after WSSV challenge, which confirmed that the effect of CpG ODNs on the activation of PO system was long-lasting. keywords: activity; challenge; control; cpg; day; et al; feeding; group; immune; immunol; lipolytica; odns; post; rvp28; shrimps; stat; virus; wssv cache: isj-313.pdf plain text: isj-313.txt item: #221 of 465 id: isj-314 author: Ebrahimi, L; Niknam, G; Dunphy, G B; Toorchi, M title: Side effects of immune response of Colorado potato beetle, Leptinotarsa decemlineata against the entomopathogenic nematode, Steinernema carpocapsae infection date: 2014-04-24 words: 6063 flesch: 49 summary: PO increased significantly to highest values from 24 - 48 h pi in nematode (LC20 and LC80) injected insects. 7 Total protein concentrations (mg/ml) of LC20 and LC80 nematode-injected, wounded and Ringer’s solution injected insects in different time intervals. keywords: activity; carpocapsae; control; cpb; decemlineata; effects; entomopathogenic; et al; injection; insects; nematode; ringer; soil; solution cache: isj-314.pdf plain text: isj-314.txt item: #222 of 465 id: isj-315 author: Mendoza-López, D G; Girón-Pérez, M I; Romero-Bañuelos, C A; Rojas-García, A E; Barrón-Vivanco, B S; Medina-Díaz, I M; Robledo-Marenco, M L title: Oxidative stress in oysters (Crassostrea corteziensis) exposed to naphthalene date: 2014-05-05 words: 3851 flesch: 55 summary: Materials and Methods Animals and treatment Crassostrea corteziensis oysters of commercial length and weight (8 ± 2 cm and 70 ± 30 g, respectively, and approximately 7 months old) were acquired at a local market in the State of Nayarit, Mexico and were immediately transported to the laboratory for their depuration during a 30 day period prior to experimentation (Adamo et al., 1997). Key Words: naphthalene; oxidative stress; membrane stability; oyster; Crassostrea corteziensis   Introduction The physiology of molluscs can be altered by polluting substances in aquatic ecosystems (Auffret, 2005; Rodriguez et al., 2005; Baqueiro-Cárdenas et al., 2007; Collin et al., 2010). keywords: corteziensis; digestive; gland; lipid; membrane; naphthalene; oxidation; oxidative; oysters; p>0.05; proteins; stress cache: isj-315.pdf plain text: isj-315.txt item: #223 of 465 id: isj-316 author: Wang, Q; Ning, X; Zhang, Q; Liu, F; Wu, H; Zhang, Y; Zhao, J title: Molecular characterization of two glutathione peroxidase genes in Mytilus galloprovincialis and their transcriptional responses to sub-chronic arsenate and cadmium exposure date: 2014-05-16 words: 6935 flesch: 52 summary: The role of cytosolic selenium-dependent GPxs in host immune and antioxidant defense system has been well documented in many mollusks, such as Unio tumidus (Doyen et al., 2006), Crassostrea gigas (Jo et al., 2008), Chlamys farreri (Mu et al., 2010), Meretrix meretrix (Wang et al., 2011a), Venerupis philippinarum (Zhang et al., 2011; Zhang et al., 2012) and Haliotis discus hannai (Wu et al., 2010). qRT-PCR was carried out in an ABI 7500 Real-time Detection System by using the SYBR ExScript qRT-PCR Kit (Takara) as described before (Wang et al., 2013). keywords: activity; analysis; antioxidant; cadmium; et al; exposure; expression; genes; gills; gland; glutathione; gpx; l-1; mgcgpx; mggpx4; mrna; mussel; pcr; peroxidase; stress; wang cache: isj-316.pdf plain text: isj-316.txt item: #224 of 465 id: isj-317 author: Matozzo, V title: Effects of pharmaceuticals on immune parameters of aquatic invertebrates date: 2014-05-21 words: 6740 flesch: 43 summary: Lysosomal membrane stability ↓ Canesi et al., 2007a Bezafibrate Gemfibrozil Mytilus spp. injection Lysosomal membrane stability ↓ Lysozyme release ↑ Phagocytosis ↑ Canesi et al., 2007a Bezafibrate Gemfibrozil E. complanata in vitro exposure Phagocytosis ↑ Gagné et al., 2006 Antihypertensive drugs Atenolol + furosemide + hydrochlorothiazide + lisinopril L. stagnalis in vivo exposure Phagocytosis ↓ TLR4 ↑ NOS-1 ↑ NOS-2 ↑ SOD ↑ Gust et al., 2013 Atenolol D. polymorpha in vitro exposure Haemocyte viability ↓ Parolini et al., 2011c Antidepressant agents Fluoxetine Mytilus galloprovincialis in vivo exposure cAMP ↓ PKA activity ↓ ABCB mRNA ↓ Franzellitti and Fabbri, 2013 Fluoxetine V. philippinarum in vivo exposure THC ↑ Haemocyte diameter = Haemocyte volume = Cell proliferation ↑ NR uptake ↓ Munari et al., 2014 169 Venlafaxine + carbamazepine + diazepam L. stagnalis in vivo exposure Haemocyte density = Haemocyte viability = Phagocytosis = ROS levels = Thiol levels = TLR4 ↑ HSP70 ↑ SeGPx↑ AIF-1 ↓ CAT ↓ GR ↓ Gust et al., 2013 Carbamazepine E. complanata n vitro exposure Phagocytosis ↑ Cell adherence ↓ keywords: activity; effects; et al; exposure; hemocytes; immune; lysosomal; membrane; parameters; pharmaceuticals; stability; table; vitro; vivo cache: isj-317.pdf plain text: isj-317.txt item: #225 of 465 id: isj-318 author: Li, C; Chen, X; Zhang, P; Lu, Y; Zhang, R title: Di-(2-ethylhexyl) phthalate mediates glycolysis and the TCA cycle in clam Venerupis philippinarum date: 2014-06-05 words: 4632 flesch: 54 summary: The concentration of clam foot DEHP determined by GC-MS peroxisome proliferator activated receptor (PPAR) responsive genes (Uren-Webster et al., 2010). 1 Protein expression patterns of Venerupis philippinarum foot under different concentrations of DEHP exposure: ethanol group (A); 0.4 mg L-1 DEHP (B); 4 mg L-1 DEHP (C). keywords: analysis; clam; dehp; dehydrogenase; exposure; expression; foot; glycolysis; phthalate; protein cache: isj-318.pdf plain text: isj-318.txt item: #226 of 465 id: isj-319 author: Trapani, M R; Parisi, M G; Toubiana, M; Coquet, L; Jouenne, T; Roch, P; Cammarata, M title: First evidence of antimicrobial activity of neurotoxin 2 from Anemonia sulcata (Cnidaria) date: 2014-06-06 words: 5275 flesch: 51 summary: Key Words: antimicrobial peptide; Anemonia sulcata; ATX II; neurotoxin; Micrococcus lysodeikticus Introduction The sea anemone Anemonia sulcata is a widespread Mediterranean species. Antimicrobial peptides are important defense molecules in marine invertebrates covering a broad- spectrum of bacteria and fungi (Boman, 2003; Bulet et al., 2004). keywords: acid; activity; amino; anemone; anemonia; antibacterial; atx; fraction; lysodeikticus; peptide; protein; sea; sulcata cache: isj-319.pdf plain text: isj-319.txt item: #227 of 465 id: isj-32 author: Houssou, A M; Daguégué, E J; Montchowui, E title: Lethal and sub-lethal effects of cypermethrin and glyphosate on the freshwater’s copepod, Acanthocyclops robustus date: 2017-04-18 words: 5103 flesch: 61 summary: Only 20 % of females have hatched their eggs against 60 % in the control and 10 % LC50 cypermethrin treatment. In cypermethrin exposure, there was 100 % mortality from 8 ppb to 10 ppb (24-h) and from 6 ppb to 10 ppb (48-h). keywords: concentration; cypermethrin; exposure; females; glyphosate; hatching; lc50; nauplii; ppb; ppm; robustus; toxicity cache: isj-32.pdf plain text: isj-32.txt item: #228 of 465 id: isj-320 author: Fernández Gimenez, A V; Haran, N S; Pereira, N A; Acuña, F H title: First report of phenoloxidase and peroxidase activities in two intertidal sea anemone species of Argentina date: 2014-06-06 words: 3067 flesch: 48 summary: Abstract The presence of immune responses within sea anemone species has received little attention, in comparison with coral species, so we decided to investigate the phenoloxidase and peroxidase activities in ectoderm, endoderm and tentacles of actiniarians Aulactinia marplatensis and Bunodosoma zamponii, the most common species in intertidal zone of Mar del Plata, Argentina. The presence of immune responses within sea anemone species have received little or virtually no attention, but their biology suggests that disease- resisting defenses would be adaptive. keywords: activity; acuña; mar; peroxidase; phenoloxidase; sea; species; zamponi cache: isj-320.pdf plain text: isj-320.txt item: #229 of 465 id: isj-322 author: Domínguez-Ojeda, D; Rojas-García, A E; Robledo-Marenco, M L; Barrón-Vivanco, B S; Medina-Díaz, I M title: Exposure to tributyltin chloride induces penis and vas deferens development and increases RXR expression in females of the purple snail (Plicopurpura pansa) date: 2014-06-26 words: 4725 flesch: 56 summary: In this study, RXR expression in imposex females and females exposed to TBTCl was similar to that of males. mRNA RXR in imposex females and females exposed to TBTCl only was similar to that of males, indicating that RXR might contribute to the development of imposex. keywords: control; expression; females; fig; imposex; mrna; pansa; penis; purple; rxr; snails; tbtcl; tributyltin cache: isj-322.pdf plain text: isj-322.txt item: #230 of 465 id: isj-323 author: Sogame, Y; Kojima, K; Takeshita, T; Kinoshita, E; Matsuoka, T title: Identification of cAMP-dependent phosphorylated proteins involved in the formation of environment-resistant resting cysts by the terrestrial ciliate Colpoda cucullus date: 2014-06-26 words: 3431 flesch: 48 summary: Key Words: environment-resistant cyst; Colpoda; encystment; protein phosphorylation; cAMP Introduction The terrestrial protists, inhabitants of temporary puddles, form resting cysts when they detect approaching hostile environmental conditions. ‘P-tag’: Protein phosphorylation detected by biotinylated Phos-tag/ECL assays. keywords: camp; colpoda; cucullus; encystment; phos; phosphorylation; protein; tag cache: isj-323.pdf plain text: isj-323.txt item: #231 of 465 id: isj-324 author: Bai, Y; Zhi, D; Li, C; Liu, D; Ren, H; Gao, C; Wang, X; Li, Y; Wu, Z; Li, H title: sek-1 is important in tissue-specific regulation of innate immunity during the Xoo infection in the model host Caenorhabditis elegans date: 2014-08-23 words: 6289 flesch: 60 summary: Compared to the JXOIII, another Xoo strain PXO99 did not induce worm avoidance response. p38 MAPK regulates expression of immune response genes and contributes to longevity in C. elegans. keywords: avoidance; elegans; faecalis; fig; immune; innate; jxoiii; pxo99; response; sek-1; xoo cache: isj-324.pdf plain text: isj-324.txt item: #232 of 465 id: isj-325 author: Enríquez-Vara, J N; Guzmán-Franco, A W; Alatorre-Rosas, R; González-Hernández, H; Córdoba-Aguilar, A; Contreras-Garduño, J title: Immune response of Phyllophaga polyphylla larvae is not an effective barrier against Metarhizium pingshaense date: 2014-09-03 words: 4974 flesch: 57 summary: Using this approach, we had two aims in the present study: a) finding a median lethal dose (LD50) of M. pingshaense blastospores; and, b) measuring immune response of P. polyphylla larvae after injection with different doses of M. pingshaense. Gillespie JP, Bailey AM, Cobb B, Vilcinskas A. Fungi as elicitors of insect immune responses. keywords: activity; blastospores; cuticle; et al; immune; infection; insect; larvae; pbs; pingshaense; polyphylla; response cache: isj-325.pdf plain text: isj-325.txt item: #233 of 465 id: isj-326 author: Benitez-Trinidad, A B; Bernal-Hernández, Y Y; Moreno-Hernández, C L; Medina-Díaz, I M; Robledo-Marenco, M L; Barrón-Vivanco, B S; Domínguez-Ojeda, D; Romero-Bañuelos, C A; Girón-Pérez, M I; Rojas-García, A E title: Acetylcholinesterase inhibition and micronucleus frequency in oysters (Crassostrea corteziensis) exposed to chlorpyrifos date: 2014-09-15 words: 5515 flesch: 58 summary: Exposure to mitomycin C as positive control Mitomycin C (MMC) is a DNA cross-linking agent that has been extensively used as a reference mutagen in numerous MN studies (Das and Nanda, 1986; Majone et al., 1987; Scarpato et al., 1990, Williams and Metcalfe, 1992). In some cases, the formulated pesticides are found to be more toxic than the active ingredient, particularly to aquatic organisms (Ali et al., 2009). keywords: ache; activity; control; corteziensis; cpf; crassostrea; effects; environ; estuary; et al; frequency; gill; micronucleus; mytilus; organisms; oysters; res cache: isj-326.pdf plain text: isj-326.txt item: #234 of 465 id: isj-327 author: Micheal, A S; Subramanyam, M title: Influence of sericin in alleviating the hydrogen peroxide induced oxidative stress in silkworm Bombyx mori: role of the amino acids date: 2014-09-15 words: 7110 flesch: 57 summary: (a, b) Normal midgut epithelial cells, (c, d) hydrogen peroxide treated cells, (e, f) cells incubated with sericin prior to hydrogen peroxide treatment and (g, h) cells incubated with amino acid mixture prior to hydrogen peroxide treatment. (a - f) Normal hemocytes, (g - l) hydrogen peroxide treated hemocytes, (m - r) hemocytes incubated with sericin prior to hydrogen peroxide treatment and (s - x) hemocytes incubated with amino acid mixture prior to hydrogen peroxide treatment. keywords: acid; activity; amino; antioxidant; cells; hemocytes; hydrogen; hydrogen peroxide; midgut; mixture; peroxide; protein; sericin; serine; silkworm; stress; treatment cache: isj-327.pdf plain text: isj-327.txt item: #235 of 465 id: isj-329 author: Grimaldi, A; Tettamanti, G; Girardello, R; Pulze, L; Valvassori, R; Malagoli, D; Ottaviani, E; de Eguileor, M title: Functional amyloid formation in LPS activated cells from invertebrates to vertebrates date: 2014-10-01 words: 7021 flesch: 49 summary: Wright et al., 2000; Scholzen, 2004; Dores and Lecaude, 2005; Huising and Flik, 2005; Slominski et al., 2005; Lovejoy and Jahan, 2006; Malagoli et al., 2007, 2011; Rivest, 2010; Caruso et al., 2012; Falabella et al., 2012; Grimaldi et al., 2012a; Thyaga Rajan and Priyanka, 2012). Wright et al., 2000; Scholzen, 2004; Dores and Lecaude, 2005; Huising and Flik, 2005; Slominski et al., 2005; Lovejoy and Jahan, 2006; Carroll, 2008; Rivest, 2010; Caruso et al., 2012; Grimaldi et al., 2012a, b; Thyaga Rajan and Priyanka, 2012) that results in the release of stress- related molecules such as ACTH, α-MSH and NEP. keywords: acth; activation; amyloid; amyloidogenesis; cells; et al; fibrils; fig; formation; grimaldi; grimaldi et; human; lps; material; melanin; msh; production; ros; staining; stress cache: isj-329.pdf plain text: isj-329.txt item: #236 of 465 id: isj-33 author: Song, D; Lin, Z; Fu, W; Wang, S; Liu, C; Liu, P; Bao, Y title: Hemoglobin from the blood clam Tegillarca granosa (Tg-HbIIA, Tg-HbIIB): expression and antibacterial activity of recombinant proteins date: 2017-04-18 words: 4916 flesch: 55 summary: Key Words: Tegillarca granosa; hemoglobin; recombinant protein; antibacterial activity Introduction Hemoglobin (Hb) is a respiratory protein containing iron that has multiple biological functions and is one of the most researched proteins in the protein family (Riggs, 1991; Terwilliger, 1998; Jiang et al., 2007; Katsu et al., 2010). The MIC of recombinant proteins (Tg-HbIIA, Tg-HbIIB) was determined using the broth dilution method. keywords: activity; expression; granosa; hbiia; hemoglobin; proteins; recombinant; wang cache: isj-33.pdf plain text: isj-33.txt item: #237 of 465 id: isj-330 author: Chen, X; Zhang, R; Li, C; Bao, Y title: Mercury exposure modulates antioxidant enzymes in gill tissue and hemocytes of Venerupis philippinarum date: 2014-10-13 words: 7034 flesch: 58 summary: Due to its wide distribution, long life cycle, high tolerance to salinity and temperature, ease of collection, and high bioaccumulation of heavy metals (Laing and Child, 1996; Kim et al., 2001; Baudrimont et al., 2005; Liu et al., 2011a, b ,c; Wu et al., 2011), the Manila clam exhibits most of the criteria that define a bio-indicator for metal pollution monitoring and has therefore been considered a useful bio-indicator in marine biology and ecotoxicology (Liang et al., 2004; Ji et al., 2006; Zhang et al., 2011a, b, c; Liu et al., 2013a, b). Corresponding authors: Chenghua Li Ningbo University 818 Fenghua Road Ningbo, Zhejiang Province 315211, PR China E-mail: lichenghua@nbu.edu.cn Yongbo Bao Zhejiang Wanli University 8 South Qianhu Road Ningbo, Zhejiang 315100, PR China E-mail: bobbao2001@gmail.com and other toxic contaminants, further supporting the proposition that V. philippinarum may be useful for monitoring marine and coastal pollution (Blasco and Puppo, 1999; Ji et al., 2013; Nasci et al., 2000; Moraga et al., 2002; Irato et al., 2003; Wu et al., 2013a, b ,c; Zhang et al., 2011d, 2012a). keywords: activity; clam; environ; et al; exposure; expression; gill; gst; hemocytes; level; liu; mda; philippinarum; ruditapes; sod; tissue; trx; zhang cache: isj-330.pdf plain text: isj-330.txt item: #238 of 465 id: isj-331 author: Wang, L; Yang, J; Suna, M; Yang, C; Cui, Z; Jang, In K; Song, L title: The genetic diversity and differentiation of shrimp Fenneropenaeus chinensis in the Yellow Sea revealed by polymorphism in control region of mitochondrial DNA date: 2014-10-29 words: 6133 flesch: 61 summary: KY06 A T T G T T T T T A T T T T A keywords: chinensis; diversity; g t; genetic; liu; population; sea; shrimp; t c; t t; yellow cache: isj-331.pdf plain text: isj-331.txt item: #239 of 465 id: isj-332 author: Franchi, N; Hirose, E; Ballarin, L title: Cellular aspects of allorecognition in the compound ascidian Botrylloides simodensis date: 2014-07-01 words: 3168 flesch: 48 summary: In the case of rejection reaction, these molecules, released as a consequence of the recognition of soluble allogeneic factors diffusing 221 Fig. In this reaction, the key role of the enzyme phenoloxidase (PO) in the induction of cytotoxicity was clearly established (Ballarin et al., 1995, 1998; Shirae and Saito, 2000; Shirae et al., 2002; Cima et al., 2004). keywords: ballarin; mcs; reaction; rejection cache: isj-332.pdf plain text: isj-332.txt item: #240 of 465 id: isj-333 author: Dias, T K R; Wilcken, C F; Soliman, E P; Barbosa, L R; Serrão, J E; Zanuncio, J C title: Predation of Thaumastocoris peregrinus (Hemiptera: Thaumastocoridae) by Atopozelus opsimus (Hemiptera: Reduviidae) in Brazil date: 2014-08-19 words: 2096 flesch: 50 summary: Registro de Thaumastocoris peregrinus (Hemiptera: Thaumastocoridae) no estado do Paraná. SHORT COMMUNICATION ISJ 11: 224-227, 2014 ISSN 1824-307X SHORT COMMUNICATION Predation of Thaumastocoris peregrinus (Hemiptera: Thaumastocoridae) by Atopozelus opsimus (Hemiptera: Reduviidae) in Brazil TKR Dias1, CF Wilcken1, EP Soliman1, LR Barbosa2, JE Serrão3, JC Zanuncio4 1Departamento de Proteção Vegetal, Universidade Estadual Paulista Júlio de Mesquita Filho (UNESP), Faculdade de Ciências Agronômicas, 18610-307, Botucatu, SP, Brasil 2Laboratório de Entomologia Florestal, EMBRAPA Florestas, Colombo, 83411-000, PR, Brasil 3Departamento de Biologia Geral, Universidade Federal de Viçosa, 36570-900 Viçosa, MG, Brasil 4Departamento de Entomologia, Universidade Federal de Viçosa, 36570-900 Viçosa, MG, Brasil Accepted August 19, 2014 keywords: eucalyptus; opsimus; peregrinus; thaumastocoris cache: isj-333.pdf plain text: isj-333.txt item: #241 of 465 id: isj-334 author: Toledo-Hernández, C; Ruiz-Diaz, C P title: The immune responses of the coral date: 2014-11-03 words: 8411 flesch: 52 summary: Uncharacterized antimicrobial agents have been also documented in over a dozen members of the Plexauridae, Gorgonidae and Ellisellidae families (Kim, 1994; Kim et al., 2000a). Some of these extracts, such as lipid metabolites extracted from G. ventalina colonies, have been shown to be active against A. sydowii (Kim et al., 2000b; Alker et al., 2001; Dube et al., 2002). keywords: activity; bacteria; biol; caribbean; cells; compounds; coral; disease; et al; immune; instance; melanin; microbes; microbial; mucus; palmer; receptors; recognition; response; role; ros; scleractinian; system cache: isj-334.pdf plain text: isj-334.txt item: #242 of 465 id: isj-335 author: Basil-Rose, Sr M R; Ravindranath, M H; Mercy, Sr P D title: Physico-chemical characterization of a natural agglutinin from the hemolymph of a millipede Thyropygus descriptus date: 2014-11-12 words: 3264 flesch: 52 summary: HA activity after adsorption with different erythrocytes When T. descriptus hemolymph adsorbed to rabbit, rat and ISJ 11: 331-336, 2014 ISJ 11: 331-336, 2014 ISSN 1824-307X RESEARCH REPORT Physico-chemical characterization of a natural agglutinin from the hemolymph of a millipede Thyropygus descriptus SrMR Basil-Rose1, MH Ravindranath2, SrPD Mercy1 1Department of Zoology, Holy Cross College, Nagercoil-629 004, India 2Terasaki Foundation Laboratory, Los Angeles, CA, USA Accepted November 12, 2014 Abstract Natural hemagglutinins with specific affinity for the glycocalyx of rabbit erythrocytes is identified in the hemolymph of the millipedes, Thyropygus descriptus, Xenobolus acuticonus, Arthrosphaera disticta and A. craspedota. keywords: acid; activity; agglutinin; assay; descriptus; erythrocytes; hemolymph; human; millipede; rabbit cache: isj-335.pdf plain text: isj-335.txt item: #243 of 465 id: isj-336 author: Oliveira, C L; Pallini Filho, A; de S Tavares, W; de A Oliveira, M G; Serrão, J E; Zanuncio, J C title: Foraging and oviposition of Thyrinteina leucoceraea (Lepidoptera: Geometridae) on introduced and native hosts in Brazil sprayed with the protease inhibitor benzamidine date: 2014-11-25 words: 4867 flesch: 58 summary: T. leucoceraea individuals were collected in the field from host plants and kept with those of origin, and therefore, with previous experience potential in the host plant (Solarz and Newman, 2001). T. leucoceraea females might have identified the PI benzamidine on the leaves of host plants and reduced oviposition, since this compound would affect the development of its offspring. keywords: benzamidine; grandis; guajava; host; larvae; lepidoptera; leucoceraea; plants; triton cache: isj-336.pdf plain text: isj-336.txt item: #244 of 465 id: isj-337 author: Ottaviani, E title: Invertebrate immunological memory: could the epigenetic changes play the part of lymphocytes? date: 2014-12-10 words: 2118 flesch: 50 summary: Rensing L, Koch M, Becker A. A comparative approach to the principal mechanisms of different memory systems. Based on the deep link existing among immune and neuroendocrine functions, it is argued here that epigenetic changes could represent the basis for explaining the numerous observations reporting hints of immunological memory in absence of lymphocytes.   keywords: dna; epigenetic; invertebrates; memory; methylation; ottaviani; systems cache: isj-337.pdf plain text: isj-337.txt item: #245 of 465 id: isj-338 author: Vorontsova, Y L; Slepneva, I A; Yurlova, N I; Glupov, V V title: Do snails Lymnaea stagnalis have phenoloxidase activity in hemolymph? date: 2014-12-11 words: 4152 flesch: 56 summary: It is just peroxidase activity that may be important in the formation of cytotoxic molecules, such as o-semiquinones, during snail defense immune reactions. Hemocytes with brown coloration were described a peroxidase-positive cells, i.e., the hemocytes with peroxidase activity. keywords: activity; dopa; dopamine; hemocytes; hemolymph; oxidation; peroxidase; stagnalis cache: isj-338.pdf plain text: isj-338.txt item: #246 of 465 id: isj-339 author: Xu, M; Tan, J; Wang, X; Zhong, X; Cui, H title: Establishment and characterization of a new embryonic cell line from the silkworm, Bombyx mori date: 2014-12-18 words: 3346 flesch: 68 summary: Ever since Thomas Grace and Shangyin Gao established cell lines from Antheraea eucalypti and Bombyx mori, respectively, the development of insect cell lines has progressed rapidly (Grace, 1962; Gaw et al., 1958). Key Words: embryonic cell line; BmE-SWU3; DNA fingerprinting; BmNPV infection; Bombyx mori   Introduction As an experimental tool, cell lines offer great advantages due to their easy handling and amenability to manipulation. keywords: bme; bmn; cell; line; mori; silkworm; swu1; swu3 cache: isj-339.pdf plain text: isj-339.txt item: #247 of 465 id: isj-34 author: Chengxiang, H; Han, W; Dingding, L; Ruilin, L; Xijie, G title: Molecular cloning and characterization of High Mobility Group box（HMGB）gene from Beauveria bassiana- infected silkworm, Bombyx mori date: 2017-04-18 words: 6562 flesch: 79 summary: T T T T G T T T G T C T T T T T C G T T T A C T G T C T G keywords: ac c; ac t; ag c; ag g; ag t; c c; c g; g ac; g g; q t; t c; t g; t t; t ta; ta g; ° c cache: isj-34.pdf plain text: isj-34.txt item: #248 of 465 id: isj-340 author: De Vico, G; Carella, F title: Tumors in invertebrates: molluscs as an emerging animal model for human cancer date: 2014-12-31 words: 1885 flesch: 57 summary: It is known that neoplasia is a pathological process characterized by an overgrowth of a new tissue in the context of a pre-existing one, and consists of atypical cells, a term which incorporates the sum of the differences in morphological, biochemical and functional features of cancer cells relative to normal cells (Carella et al., 2013). Recently, we described at last two different types of leukemia in two different bivalve species (Mytilus galloprovincialis and Cerastodema edule), showing distinctive morphological and histo-pathogenetic behaviour of cells (Carella et al., 2013). keywords: arenaria; carella; cells; et al; neoplasia; p53 cache: isj-340.pdf plain text: isj-340.txt item: #249 of 465 id: isj-341 author: Christensen, B M title: ANTHONY J. NAPPI 1937 - 2014 date: 2014-11-13 words: 866 flesch: 42 summary: Following retirement, he became a Visiting Professor of Animal Health and Biomedical Sciences at the University of Wisconsin in Madison where he directed research programs funded by the National Science Foundation and the National Institutes of Health. What perhaps tweaked his interests most during his final decade of research were his studies of the roles reactive oxygen and nitrogen intermediates play in immunity. keywords: biology; research; toni; university cache: isj-341.pdf plain text: isj-341.txt item: #250 of 465 id: isj-342 author: Stefano, G B; Mantione, K J; Casares, F M; Kream, R M title: Anaerobically functioning mitochondria: evolutionary perspective on modulation of energy metabolism in Mytilus edulis date: 2015-01-09 words: 4343 flesch: 50 summary: The ciliated gill epithelium of M. edulis has been studied not only for its ciliary activity but for its innervation as well (Paparo, 1972; Stefano et al., 1975, 1976). We surmise this difficulty is overcome by way of nervous system integration of the tissue, exerting specific and rapid responses to respiratory and waste needs carried out by the ciliated epithelium (Stefano, 1990; Stefano et al., 1991). keywords: anaerobic; atp; biochem; cancer; cell; edulis; energy; et al; metabolic; mitochondria; mussel; mytilus; opines; production; trna cache: isj-342.pdf plain text: isj-342.txt item: #251 of 465 id: isj-343 author: Manfrin, C; Peruzza, L; Bonzi, L C; Pallavicini, A; Giulianini, P G title: Silencing two main isoforms of crustacean hyperglycemic hormone (CHH) induces compensatory expression of two CHH-like transcripts in the red swamp crayfish Procambarus clarkii date: 2015-01-14 words: 5632 flesch: 57 summary: CHH silencing Three individuals from each of the CHHi and GFPi experimental groups were used to evaluate CHH expression level, as well as of the above mentioned CHHop and CHHip genes using the EF1A as reference gene normalized to the GFPi group (Fig. 2). In the crayfish Pontastacus leptodactylus, CHH injection causes a short term increase in glucose levels and its reduction through eyestalk ablation resulted with a decrease to basal levels (Mosco et al., 2012, Lebaupain et al., 2012). keywords: chh; clarkii; crustacean; day; dschh; dsgfp; et al; experiment; expression; group; hormone; hyperglycemic; injection; rna; silencing; time cache: isj-343.pdf plain text: isj-343.txt item: #252 of 465 id: isj-344 author: Hao, L J; Lü, P; Gao, L; Zhou, Y; Yao, Q; Yang, Y H; Chen, K P title: Identification and characterization of the Bombyx mori myosin II essential light chain and its effect in BmNPV infection date: 2015-02-02 words: 4527 flesch: 58 summary: We selected two different cell lines, MGC803 and BmN, and constructed two vectors (PCDNA3.0 and PIZ/V5) to encode BmMyosin II ELC protein fused to the Flag epitope tag at the COOH terminus (C-Flag-BmMyosin II ELC) ( Clarke et al., 2007). Polyclonal antibody of BmMyosin II ELC was prepared by immunizing a laboratory rat (Rattus rattus) using purified Myosin II ELC as antigen (Zhang et al., 2012). keywords: bmmyosin; bmmyosin ii; bmnpv; cell; chain; elc; expression; fig; ii elc; light; migration; myosin; protein cache: isj-344.pdf plain text: isj-344.txt item: #253 of 465 id: isj-346 author: Stephens-Camacho, N A; Muhlia-Almazan, A; Sanchez-Paz, A; Rosas-Rodríguez, J A title: Surviving environmental stress: the role of betaine aldehyde dehydrogenase in marine crustaceans date: 2015-02-02 words: 5279 flesch: 46 summary: ISJ 12: 66-74, 2015 ISJ 12: 66-74, 2015 ISSN 1824-307X REVIEW Surviving environmental stress: the role of betaine aldehyde dehydrogenase in marine crustaceans NA Stephens-Camacho1, A Muhlia-Almazan2, A Sanchez-Paz3, JA Rosas-Rodríguez4 1Licenciatura en Nutrición Humana, Universidad Estatal de Sonora UAN. Key Words: betaine aldehyde dehydrogenase; stress response; osmoregulation; glycine betaine   Introduction Besides being the largest and most dynamic reservoir of biomass on Earth, oceans are the ultimate repository for a vast amount of discharged compounds via human activities (Kennish, 1996). keywords: accumulation; aldehyde; aldehyde dehydrogenase; badh; betaine; biochem; choline; crustaceans; dehydrogenase; enzymes; et al; family; marine; mitochondrial; osmotic; response; soto; stress cache: isj-346.pdf plain text: isj-346.txt item: #254 of 465 id: isj-347 author: Trapani, M R; Sanfratello, M A; Mangano, V; Parrinello, D; Vizzini, A; Cammarata, M title: Phenoloxidases of different sizes are modulated by LPS inoculation into Ciona intestinalis tunic and pharynx date: 2015-02-11 words: 4903 flesch: 56 summary: In this ascidian, an inflammatory response after inoculation of erythrocytes (Parrinello et al., 1984a, b), foreign proteins (Parrinello, 1981), or lipopolysaccharide (LPS) (Parrinello et al., 2007), has been shown in tunic and pharynx where hemocytes and humoral components are involved. In the pharynx, compartment cells (hemocytes with large vacuoles) express CitypeIX- collagen 1α-chain (Vizzini et al., 2008), galectin-like lectins (Vizzini et al., 2012), tumor necrosis factor-α-like cytokine (CiTNF-α; Parrinello et al., 2008, 2010), a mannose-binding lectin (Bonura et al., 2009) and a cysteine-rich secretory proteins, antigen 5, and pathogenesis- related 1 proteins (Bonura et al., 2010). keywords: activity; fractions; kda; lps; parrinello; peak; phs; ths; tunic cache: isj-347.pdf plain text: isj-347.txt item: #255 of 465 id: isj-348 author: Ballarin, L; Franchi, N; Gasparini, F; Caicci, F; Miyauchi, A; Hirose, E title: Suppression of cell-spreading and phagocytic activity on nano-pillared surface: in vitro experiment using hemocytes of the colonial ascidian Botryllus schlosseri date: 2015-02-23 words: 4380 flesch: 58 summary: Dipping the sheets in FSW had no significant effect on the detachment of the spreading amebocytes on the pillared sheet (Mann-Whitney test, p > 0.05): cell numbers per optical field were 1.2 ± 1.34 (average ± SD) on the dipped sheet and 1.1 ± 0.96 on the control (no dipping). Similarly, there was no significance on the flat sheet (Mann-Whitney test, p > 0.05): cell numbers per optical field were 1.57 ± 1.2 on the dipped sheet and 2.13 ± 1.22 on the control. keywords: amebocytes; ballarin; cell; hemocytes; hirose; nipple; number; schlosseri; sheet; spreading; surface cache: isj-348.pdf plain text: isj-348.txt item: #256 of 465 id: isj-349 author: Battistella, S; Ferrero, E; Gerdol, M; Giulianini, P; Manfrin, C; Lorenzon, S; Pallavicini, A; Scocchi, M title: XVIth scientific meeting of the Italian Association of Developmental and Comparative Immunobiology (IADCI), 18 - 20 February 2015, Dept. of Life Sciences, Univ. of Trieste, and National Institute of Oceanography and Experimental Geophysics, Trieste, Italy date: 2014-02-20 words: 11148 flesch: 32 summary: For this purpose, nanotubes at different concentration will be then added at primary cell cultures to study some aspects of their effects on cell morphology, cell stress response, cell viability and death events. Ultrastructural analysis at TEM suggests that short and curled MWCNTs may be internalized by phagocytosis or during the process of matrix degradation, while straight and rigid MWNCTs seem to be able to pierce cell membranes during cells migration and are then found free in the cytosol. keywords: activity; analysis; bass; biology; cells; effects; expression; fish; food; genes; hemocytes; igt; immune; immunity; italy; life; like; padua; palermo; peptides; presence; protein; response; sciences; sea; species; system; trieste; university cache: isj-349.pdf plain text: isj-349.txt item: #257 of 465 id: isj-35 author: Giglio, A; Brandmayr, P; Giulianini, P G; Cavaliere, F; Trapani, M R; Parisi, M G; Cammarata, M title: Gender-related variations in hemolymph parameters of Carabus lefebvrei (Coleoptera: Carabidae): HPLC analysis and phenoloxidase activity date: 2017-04-26 words: 5783 flesch: 59 summary: St: standard; Lane 1: reproductive males; Lane 2: reproductive females; Lane 3: virgin males; Lane 4: virgin females. Previous study on C. lefebvrei showed that gender differences occur only for PO activity that was significantly higher in reproductive males than females but not for lysozyme-like enzyme activity (Giglio et al., 2016). keywords: activity; biol; et al; females; hemolymph; immune; immunity; insect; lefebvrei; min; phenoloxidase; protein; reproductive; virgin cache: isj-35.pdf plain text: isj-35.txt item: #258 of 465 id: isj-350 author: Tian, L; Li, S title: Autophagy studies in Bombyx mori date: 2015-03-04 words: 4170 flesch: 59 summary: These data indicate that autophagy prevents Bombyx cells and other Lepidoptera insect cells from death at an early stage of non-favorable conditions (Wu et al., 2011; Romanelli et al., 2014). Finally, the mature autophagosomes fuse with lysosomes to form autolysosomes, in which bulk degradation of dysfunctional proteins, unnecessary organelles, and invading microorganisms is completed (Klionsky et al., 2012). keywords: apoptosis; atg; autophagy; body; bombyx; cell; death; et al; fat; mori; protein cache: isj-350.pdf plain text: isj-350.txt item: #259 of 465 id: isj-351 author: Franchi, N; Ballarin, L; Cima, F title: Insights on cytotoxic cells of the colonial ascidian Botryllus schlosseri date: 2015-03-02 words: 5690 flesch: 55 summary: MCs play a key role in the rejection reaction between contacting, incompatible colonies of botryllid ascidians (Taneda and Watanabe, 1982; Ballarin et al., 1995; Hirose et al., 1997; Shirae and Saito, 2000; Shirae et al., 2002; Cima et al., 2004). The compound reacts with polyphenols and quinones giving a red product (Gasparič et al., 1977; Winder and Harris, 1991; Ballarin et al., 1995). keywords: activity; ascidian; ballarin; botryllus; cells; cytotoxicity; et al; hemocytes; inside; mcs; min; schlosseri; vacuoles cache: isj-351.pdf plain text: isj-351.txt item: #260 of 465 id: isj-352 author: Gupta, T; Kadono-Okuda, K; Ito, K; Trivedy, K; Ponnuvel, K M title: Densovirus infection in silkworm Bombyx mori and genes associated with disease resistance date: 2015-04-13 words: 7260 flesch: 54 summary: Four multivoltine races revealed the presence of BmDV-2 resistant gene. A total of nine multivoltine races screened for the presence of resistance/susceptible genes, of which six races possessed susceptible genes, while two races (MV- 76, MV-77) had resistant genes in a homozygous condition and one race (MV-73) had neither of the genes (Fig. 2). keywords: bmdv-2; bombyx; densovirinae; densovirus; dna; dvs; et al; family; genes; genome; infection; midgut; mori; races; resistance; silkworm; tijssen; viruses cache: isj-352.pdf plain text: isj-352.txt item: #261 of 465 id: isj-353 author: Schorn, T; Drago, F; de Eguileor, M; Valvassori, R; Vizioli, J; Tettamanti, G; Grimaldi, A title: The Allograft Inflammatory Factor-1 (AIF-1) homologous in Hirudo medicinalis (medicinal leech) is involved in immune response during wound healing and graft rejection processes date: 2015-04-09 words: 7150 flesch: 53 summary: 140 Utans U, Quist WC, McManus BM, Wilson JE, Arceci RJ, Wallace AF, et al. Allograft inflammatory factor-1. Watano K, Iwabuchi K, Fujii S, Ishimori N, Mitsuhashi S, Ato M, et al. Allograft inflammatory factor-1 augments production of interleukin-6, -10 and - 12 by a mouse macrophage line. keywords: allograft; anti; cd45; cells; et al; expression; grimaldi; hmaif-1; inflammatory; leeches; macrophages; rabbit; response; tettamanti; tissue; wound cache: isj-353.pdf plain text: isj-353.txt item: #262 of 465 id: isj-354 author: Chaves da Silva, P G; Santos de Abreu, I; Cavalcante, L A; Monteiro De Barros, C; Allodi, S title: Role of hemocytes in invertebrate adult neurogenesis and brain repair date: 2015-04-20 words: 8615 flesch: 54 summary: Key Words: neuroregeneration; neurogenesis; blood cells; stem cells; hematopoietic tissue; ascidians; crustaceans   Introduction The ability of many animals to regenerate their whole body or substantial parts of the body is a remarkable biological phenomenon that is non- uniformly represented in different phyla. Stem cells derived from the umbilical cord have also been the subject of research focusing on repairing lesions in the brain of mammals. keywords: adult; ascidian; blood; blood cells; brain; cells; chaves; cns; crayfish; crustaceans; dev; et al; hemocytes; invertebrates; neural; neurogenesis; niche; regeneration; silva; stem; stem cells; system; tissue; types cache: isj-354.pdf plain text: isj-354.txt item: #263 of 465 id: isj-355 author: Nagai, H; Yano, T; Kurata, S title: Role of autophagy in Drosophila innate immunity date: 2015-04-23 words: 2412 flesch: 50 summary: Because studies were performed in cultured cells and autophagy-knockout animals are in most cases lethal, the critical role of autophagy in vivo was first demonstrated in Drosophila by tissue-specific autophagy knockdown (Yano et al., 2008). Corresponding author: Shoichiro Kurata Aoba 6-3, Aramaki Aoba-ku, Sendai 980-8578, Japan E-mail: kurata@m.tohoku.ac.jp in which the autophagy gene atg5 is specifically knocked down in hemocytes are susceptible to Listeria infection, suggesting that autophagy is important for their survival against infection by Listeria (Yano et al., 2008). keywords: autophagy; bacteria; cells; drosophila; et al; immunity; role cache: isj-355.pdf plain text: isj-355.txt item: #264 of 465 id: isj-356 author: dos Santos, M C; Resende Junqueira, M R; Mendes de Sá, V G; Zanúncio, J C; Serrão, J E title: Effect of silicon on the morphology of the midgut and mandible of tomato leafminer Tuta absoluta (Lepidoptera: Gelechiidae) larvae date: 2015-05-12 words: 4940 flesch: 59 summary: Bar = 20 μm; b) Control group without any addition of compounds containing silicon Bar = 20 μm epidermis prevents the penetration and chewing by insects due to the hardening of plant cell wall (Datnoff et al., 2001). Terra WR, Costa RH, Ferreira C. Plasma membranes from insect midgut cells. keywords: absoluta; cells; effect; et al; ha-1; larvae; leaves; lepidoptera; membrane; midgut; plants; silicon; soil; tomato; treatments cache: isj-356.pdf plain text: isj-356.txt item: #265 of 465 id: isj-357 author: Stanley, D; Zhang, L; Kim, Y title: Insect anti-viral immunity: roles of prostaglandins and other eicosanoids date: 2015-05-19 words: 2847 flesch: 53 summary: Kim et al. (2008) found that PSP also influenced hemocyte spreading in S. exigua. Insect genomic data bases facilitated searches for insect genes encoding COX proteins, which uniformly indicate insects do not have such genes, although two crustaceans do (Varvas et al., 2009). keywords: eicosanoids; expression; genes; infection; insect; kim; larvae; stanley cache: isj-357.pdf plain text: isj-357.txt item: #266 of 465 id: isj-358 author: Rinkevich, B title: Conserved histocompatible machinery in marine invertebrates? date: 2015-05-26 words: 2081 flesch: 46 summary: A recent study (Oren et al., 2013) illuminates the scientific insight that surfaced when employing the cross-invertebrate phyla comparisons approach and the need for additional, similar studies. Oren et al. (2013) disclosed 74 similar blast matches in the immune-related categories of the coral and the ascidian expression libraries, accounting for 37.2 % of the total immunerelated matches. keywords: allorecognition; cells; et al; immune; invertebrates; marine; rinkevich cache: isj-358.pdf plain text: isj-358.txt item: #267 of 465 id: isj-359 author: Molnár, L; Pollák, E; Somogyi, I; Engelmann, P title: On the existence of possible pituitary adenylate cyclase-activating polypeptide adenylate type 1 receptor in earthworms date: 2015-05-29 words: 1635 flesch: 48 summary: A possible role of PACAP-like peptides in mediation of both embryogenesis (Boros et al., 2008) and posterior regeneration of E. fetida (Várhalmi et al., 2008) was suggested based on the quantitative analysis of the expression of PACAP- like peptides applying one of the most sensitive immunoserological methods, the radioimmunoassay. The expression of PAC1-receptor was investigated by immunocytochemical and immunoserological methods (Western blot and Far Western blot) during the embryonic development of E. fetida and showed its existence in germinal layers and developing ventral nerve cord ganglia (Boros et al., 2010). keywords: boros; et al; pac1; pacap; receptor cache: isj-359.pdf plain text: isj-359.txt item: #268 of 465 id: isj-360 author: Plytycz, B; Morgan, A J title: Interactions between earthworm neuroendocrine and immune systems date: 2015-06-27 words: 1648 flesch: 44 summary: This ability is commonly exploited for non-invasive retrieval of celomocytes for ex vivo studies and/or for temporal depletion of earthworm celomocytes and celomocyte-derived humoral factors. ISJ 12: 176-178, 2015     176 ISJ 12: 176-178, 2015 ISSN 1824-307X LETTER TO EDITOR Interactions between earthworm neuroendocrine and immune systems B Plytycz1, AJ Morgan2 1Department of Evolutionary Immunology, Institute of Zoology, Jagiellonian University, Krakow, Poland 2Cardiff School of Biosciences, Main Building, Cardiff University, Cardiff CF10 3US, Wales, UK Accepted June 27, 2015 To the Editor We read with interest the recent paper about the importance of studying invertebrate immune- neuroendocrine functions published in the “Vision and Perspectives” section of Inv. keywords: brain; earthworm; et al; molnar; restoration cache: isj-360.pdf plain text: isj-360.txt item: #269 of 465 id: isj-361 author: de Castro, A A; de S Tavares, W; Collatz, J; de A Pereira, A I; Serrão, J E; Zanuncio, J C title: Antibiosis of tomato, Solanum lycopersicum (Solanaceae) plants to the Asopinae predator Supputius cincticeps (Heteroptera: Pentatomidae) date: 2015-06-06 words: 5527 flesch: 56 summary: Key Words: antagonistic association; defense; development; natural enemy; reproduction   Introduction Zoophytophagous stink bugs of the subfamily Asopinae, such as Supputius cincticeps (Heteroptera: Pentatomidae) are considered important biological control agents of numerous pests in South American agro-forestry ecosystems (Zanuncio et al., 2005, 2012, 2014). The zoophytophagous predator S. cincticeps occurs on bean (Phaseolus vulgaris, Fabaceae), cotton and soybean crops in Brazil (Zanuncio et al., 2003, 2012; de Castro et al., 2013a) preying mainly on species of Diptera, Coleoptera, Hemiptera, and Lepidoptera (Zanuncio et al., 2005; Lemos et al., 2009b; da Silva et al., 2012). keywords: cincticeps; cotton; et al; eucalyptus; feeding; leaves; nymphs; pentatomidae; plant; predator; tomato; zanuncio cache: isj-361.pdf plain text: isj-361.txt item: #270 of 465 id: isj-362 author: Mandrioli, M; Monti, M; Tedeschi, R title: Presence and conservation of the immunoglobulin superfamily in insects: current perspective and future challenges date: 2015-06-06 words: 4566 flesch: 52 summary: In the specific, this study demonstrated that a RNAi- mediated AgDscam depletion in mosquitoes, which fed on mice infected with GFP-expressing P. bergei parasites, resulted in a statistically significant increase of oocystis numbers on the midgut as well as at 13d of feeding (Dong et al., 2006). Ladendorff and Kanost, 1991; Lindström-Dinnetz et al., 1995). keywords: cell; dscam; et al; genes; hemolin; igsf; immune; immunity; immunoglobulin; insect; pathogen; proteins; superfamily; system; vector cache: isj-362.pdf plain text: isj-362.txt item: #271 of 465 id: isj-363 author: Parrinello, D; Sanfratello, M A; Celi, M; Vazzana, M title: Hemocyte types and some plasmatic properties of two edible crabs Cancer borealis and Cancer pagurus date: 2015-06-23 words: 5440 flesch: 58 summary: The cells, which were washed with a cacodylate buffer, were post-fixed with 1 % osmium total hemocyte cells counted x 100   196 Table 1 Morphometric measures and differential count of hemocyte types from Cancer borealis and Cancer pagurus hemolymph Cell types Morphological characterization, cell type identification, differential numbering of hemolymph cell populations of reared crab hemocytes, some plasmatic parameters and agglutinating titers of the plasma hemolymph may contribute to examinations of the physiological role of reared crabs and the monitoring of their health (Celi et al., 2013). keywords: borealis; cancer; cells; crab; et al; granules; granulocytes; hemocytes; hemolymph; hyalinocytes; pagurus; semigranulocytes; species cache: isj-363.pdf plain text: isj-363.txt item: #272 of 465 id: isj-364 author: Roubalová, R; Procházková, P; Dvořák, J; Škanta, F; Bilej, M title: The role of earthworm defense mechanisms in ecotoxicity studies date: 2015-07-24 words: 7033 flesch: 57 summary: E. fetida Cd, Pb toxic elements widely distributed in the environment (Li et al., 2009) results in ultrastructure alterations of the cuticle and skin, and the reduction of mucus production by secretory cells. Furthermore, the exposure of E. fetida to sub-lethal concentrations of 1,2,4-trichlorobenzene     206 Table 1 Summary of recent studies involving genotoxicity assessment of various organic and inorganic pollutants Tested species Organic pollutant Source Reference E. fetida naphtenic acids constituents of petroleum, used in commercial and industrial applications (Wang et al., 2015a) keywords: antioxidant; biomarker; cells; cellular; damage; defense; earthworms; effects; eisenia; eisenia fetida; environ; et al; fetida; mechanisms; molecular; nanoparticles; pollutants; responses; soil; species; stress; system; wang cache: isj-364.pdf plain text: isj-364.txt item: #273 of 465 id: isj-365 author: Lekha, G; Gupta, T; Trivedy, K; Ponnuvel, K title: Paralogous gene conversion, allelic divergence of attacin genes and its expression profile in response to BmNPV infection in silkworm Bombyx mori date: 2015-07-27 words: 6059 flesch: 55 summary: The cDNA was used as template to quantify attacin I and attacin II gene expression by qPCR. ISJ 12: 214-224, 2015 ISJ 12: 214-224, 2015 ISSN 1824-307X RESEARCH REPORT Paralogous gene conversion, allelic divergence of attacin genes and its expression profile in response to BmNPV infection in silkworm Bombyx mori G Lekha, T Gupta, K Trivedy, K Ponnuvel Genomics Division, Seri Biotech Research Laboratory, Carmelaram Post, Kodathi, Bangalore 560 035, India Accepted July 27, 2015 keywords: analysis; attacin; bmnpv; expression; fig; gene; infected; infection; mori; silkworm cache: isj-365.pdf plain text: isj-365.txt item: #274 of 465 id: isj-366 author: Cerkowniak, M; Ostachowska, A; Słocińska, M; Rosiński, G; Stepnowski, P; Gołębiowski, M title: The influence of hormones on the lipid profile in the fat body of insects date: 2015-08-03 words: 5475 flesch: 64 summary: Overall diagram of the analysis of fat body lipids in Zophobas atratus (Gołębiowski et al., 2014). Key Words: fat body; adipokinetic hormone; sulfakinins, insects; Zophobas atratus   Introduction The neuroendocrine systems of insects play a special role in the regulation of most of their metabolic ___________________________________________________________________________ keywords: acids; akh; analysis; biochem; body; chromatography; der; et al; fatty; gołębiowski; hormone; horst; insect; lipids; min; van cache: isj-366.pdf plain text: isj-366.txt item: #275 of 465 id: isj-367 author: Ballarin, L; Du Pasquier, L; Rinkevich, B; Kurtz, J title: Evolutionary aspects of allorecognition date: 2015-09-08 words: 2476 flesch: 40 summary: This stresses the selective value of allorecognition, that may have played a role in the generation of specific immune systems of many Metazoa, and which reached its highest complexity in vertebrates with the appearance of adaptive immune systems. Because of the involvement of MHC, the answers to these two questions will perhaps help placing allorecognition in the context of the evolution of adaptive immune systems. keywords: allorecognition; aspects; biol; cell; chimerism; evolution; molecules; systems cache: isj-367.pdf plain text: isj-367.txt item: #276 of 465 id: isj-368 author: Muthukaruppan, G title: Heavy metal induced biomolecule and genotoxic changes in earthworm Eisenia fetida date: 2015-09-16 words: 5654 flesch: 62 summary: The heavy metals concentration in medium, earthworm over 35 days and DNA damage scores at percentage of cells in each damage class in coelomocytes of E. fetida after heavy metals exposure over 35days were subjected to suitable statistical transformations and the transformed values were evaluated by one-way analysis of variance in the Microsoft Excel statistical package. Key words: earthworm; Eisenia fetida; FTIR; DNA fragmentation; heavy metals and biomolecules   Introduction Heavy metal pollution of soil is widespread across the globe and has caused biological problems, leading to potential toxicity to living organisms. keywords: accumulation; cells; cm−1; concentration; control; damage; dna; earthworm; et al; exposure; fetida; ftir; heavy; metal; soil; spectroscopy cache: isj-368.pdf plain text: isj-368.txt item: #277 of 465 id: isj-369 author: Zattara, E E title: Transplants in annelids, nemerteans and planarians: a tool for embryology, immunology, endocrinology and regeneration research date: 2015-09-22 words: 11683 flesch: 53 summary: With the discovery that X-ray irradiation could abrogate regenerative powers in vertebrates, researchers of worm regeneration combined this technique with transplantation experiments to test whether grafting from an intact, regeneration- capable donor could rescue an irradiated, regeneration-disabled host (Fig. 4C, left). In contrast, it has been found that extirpation of the brain greatly inhibits posterior regeneration (Fig. 4B, center and right) in earthworms (Clitellata: Lumbricidae), ragworms (Errantia: Nereididae) and catworms (Errantia: Nepthydae) (Kropp, 1933; Hubl, 1956; Clark and Clark, 1959; Hauenschild, 1960; Clark and Evans, 1961; Golding, 1967a, b). keywords: annelids; bierne; biol; body; cell; development; donor; et al; experiments; fig; graft; grafting; host; immune; immunity; nemerteans; non; planarians; posterior; regeneration; rejection; response; self; species; tissue; transplantation; worms cache: isj-369.pdf plain text: isj-369.txt item: #278 of 465 id: isj-37 author: Seyedtalebi, F S; Safavi, S A; Talaei-Hassanloui, R; Bandani, A R title: Quantitative comparison for some immune responses among Eurygaster integriceps, Ephestia kuehniella and Zophobas morio against the entomopathogenic fungus Beuveria bassiana date: 2017-04-26 words: 4946 flesch: 54 summary: 2 Effect of B. bassiana isolates conidia on mean phagocytosis percentage (±SE) in different insect on different times, means followed by different letters differ significantly (F-LSD, p < 0.05) 3 Effect of B. bassiana isolates spores on mean number of nodule formation (±SE) in different insect on different times, means followed by different letters differ significantly (F-LSD, p < 0.05) keywords: activity; bassiana; conidia; fungal; insects; integriceps; isolates; larvae cache: isj-37.pdf plain text: isj-37.txt item: #279 of 465 id: isj-371 author: Kocinski, M; Takacs, V; Molnar, L; Morgan, A J; Bigaj, J; Plytycz, B title: Experimental induction of autotomy in two potential model lumbricid earthworms Eisenia andrei and Aporrectodea caliginosa date: 2016-01-06 words: 3888 flesch: 47 summary: This suggests that nicotinic cholinergic receptors are involved in the autotomy reflex, and offers sustenance to the notion that the nervous system is fundamentally implicated in earthworm autotomy. In contrast, we have found recently that multiply stimulations with the pulsating direct electric current from a 4.5 V cell phone electric charger leads to posterior segment autotomy in the eco-physiologically contrasting lumbricids Eisenia andrei (a litter- inhabiting ‘epigeic’ species) and Aporrectodea caliginosa (an ‘edogeic’ inhabitor of mineralized soil). keywords: andrei; autotomy; caliginosa; eisenia; electrostimulation; pdc; segments; species cache: isj-371.pdf plain text: isj-371.txt item: #280 of 465 id: isj-372 author: Franchini, A; Simonini, R; Ottaviani, E title: Celomic cells of the marine fireworm Hermodice carunculata (Annelida, Polychaeta) date: 2016-01-11 words: 2036 flesch: 52 summary: ISJ 13: 18-22, 2016 ISJ 13: 18-22, 2016 ISSN 1824-307X RESEARCH REPORT Celomic cells of the marine fireworm Hermodice carunculata (Annelida, Polychaeta) A Franchini, R Simonini, E Ottaviani Department of Life Sciences, University of Modena and Reggio Emilia, Modena, Italy Accepted January 11, 2016 Abstract Key Words: polychete; Hermodice carunculata; celomic cells; immunocyte   Introduction Dhainaut and Porchet-Hennerè (1988) described the presence of five main types of amebocytes in several species of polychetes. keywords: carunculata; cells; celomic; fluid; ottaviani; porchet cache: isj-372.pdf plain text: isj-372.txt item: #281 of 465 id: isj-373 author: Guimarães, R R; Guimarães-Junior, R R; Harlan-Ronald, R S; Rodrigues-Guimarães, R; Carvalho, F L; Araújo-Junior, M L C; Carvalho, R W title: Cutaneous neoplasm in Phaeotabanus litigiosus (Diptera, Tabanidae) collected on the Marambaia Island, Rio de Janeiro, Brazil date: 2016-01-28 words: 2769 flesch: 51 summary: This study is related to a cutaneous tumor formation found in Phaeotabanus litigiosus collected on Marambaia Island, Rio de Janeiro state, Brazil. ISJ 13: 23-27, 2016 ISJ 13: 23-27, 2016 ISSN 1824-307X SHORT COMMUNICATION Cutaneous neoplasm in Phaeotabanus litigiosus (Diptera, Tabanidae) collected on the Marambaia Island, Rio de Janeiro, Brazil RR Guimarães1,2,5, RR Guimarães-Junior2,3, RS Harlan-Ronald2, R Rodrigues-Guimarães4,5, FL Carvalho6, MLC Araújo-Junior6, RW Carvalho1 1Escola Nacional de Saúde Pública Sérgio Arouca-FIOCRUZ, Rio de Janeiro, RJ, Brasil 2Centro de Educação e Pesquisas em Medicina Ambiental - CEMA, Nilópolis, RJ, Brasil 3Associação Brasileira de Ensino Universitário - ABEU, Nova Iguaçu, RJ, Brasil 4Centro Universitário de Barra Mansa - UBM, Barra Mansa, RJ, Brasil 5Universidade Estácio de Sá - UNESA, Rio de Janeiro, RJ, Brasil 6Instituto Nacional do Câncer - INCA, Rio de Janeiro, Brasil Accepted January 28, 2016 keywords: cells; diptera; insect; invertebr; island; janeiro; melanogaster; pathol; rio; tabanidae; tumors cache: isj-373.pdf plain text: isj-373.txt item: #282 of 465 id: isj-374 author: Malagoli, D; Ottaviani, E title: ACTH in invertebrates: a molecule for all seasons date: 2016-01-29 words: 4097 flesch: 54 summary: Moreover, in situ hybridization experiments using a bovine ACTH receptor cDNA probe evidenced that M. galloprovincialis immunocytes express an mRNA encoding for a molecule similar to ACTH receptor (Ottaviani et al., 1998). Phagocytosis shows a different behavior with respect to chemotaxis (Ottaviani et al., 1994), and in contrast to the conventional paradigm, there is no direct correlation between the two processes in molluscan immunocytes. keywords: acth; cells; et al; immune; immunocytes; invertebrates; molecules; ottaviani; peptides; stress cache: isj-374.pdf plain text: isj-374.txt item: #283 of 465 id: isj-375 author: Zhao, D; Song, L; Liu, R; Liang, Z; Wang, L; Sun, M; Zhu, B title: The immunosuppressive effects of continuous CpG ODNs stimulation in chinese mitten crab, Eriocheir sinensis date: 2016-02-04 words: 6753 flesch: 61 summary: The immunosuppressive effects of continuous CpG ODNs stimulation in chinese mitten crab, Eriocheir sinensis D Zhao 1 , L Song 2 , R Liu 3 , Z Liang 3 , L Wang 3 , M Sun 3 , B Zhu 1 1 Dalian Polytechnic University, Dalian 116034, China 2 Key Laboratory of Mariculture & Stock enhancement in North China’s Sea, Ministry of Agriculture, Dalian Ocean University, Dalian 116023, China 3 Key Laboratory of Experimental Marine Biology, Institute of Oceanology, Chinese Academy of Sciences, Qingdao 266071, China Accepted February 4, 2016 Abstract CpG oligodeoxynucleotides (CpG ODNs) have been widely used as a novel vaccine adjuvant in mammals due to its immune protection, long effectiveness and safety. In the present study, the long-term immune effects as well as immunosuppression of CpG ODNs was evaluated by comparing the immune parameters of Chinese mitten crab, Eriocheir sinensis after continuous or interval feeding with CpG ODNs-supplement diet for 21 days (designated as CC and CI group, respectively). keywords: control; cpg; cpg odns; crabs; day; et al; expression; feeding; fold; group; immune; immunol; level; mrna; odns; tnf cache: isj-375.pdf plain text: isj-375.txt item: #284 of 465 id: isj-376 author: Pagliara, P; Stabili, L title: XVIIth scientific meeting of the Italian Association of Developmental and Comparative Immunobiology (IADCI), 11 - 13 February 2016, Department of Biological and Environmental Sciences and Technologies, University of Salento, Lecce, Italy date: 2016-02-13 words: 9569 flesch: 31 summary: Lymnaea stagnalis ganglia transcriptional activity after LPS induced immune activation F Tascedda1, C Benatti1, D Malagoli1, JMC Blom2, E Ottaviani1 1Department of Life Sciences, University of Modena and Reggio Emilia, Modena, Italy 2Department of Education and Human Sciences and Paediatric Oncology Unit, University of Modena and Reggio Emilia, Italy The mechanisms by which the neuroendocrine and immune systems communicate and influence each other from invertebrates to vertebrates are well known and are among the most exiting areas of research in biology. Analysis of Antarctic Teleosts transcriptomes as a tool to explore adaptive immune responses F Buonocore1, M Gerdol2, A Pallavicini2, C Bernini1, S Mattiucci3, D Lucente4, R Cimmaruta4, G Scapigliati1 1Department for Innovation in Biological, Agro-food and Forest Systems, Tuscia University, Largo dell'Università s/n, Viterbo, Italy 2Department of Life Sciences, University of Trieste, keywords: activity; astakine; biological; cells; data; evolution; expression; genes; hemocytes; host; immune; invertebrate; italy; life; modena; molecules; padua; potential; presence; response; sciences; sea; species; study; system; trieste; university cache: isj-376.pdf plain text: isj-376.txt item: #285 of 465 id: isj-377 author: Filipiak, A; Zając, k; Kübler, D; Kramarz, P title: Coevolution of host-parasite associations and methods for studying their cophylogeny date: 2016-03-02 words: 8107 flesch: 49 summary: Multi-host parasite species in cophylogenetic studies. Key Words: coevolution; host-parasite interactions; cophylogenetic methods; event-based methods; global fit methods   Introduction One of the most fascinating topics in evolutionary biology is the coevolutionary race between hosts and parasites, driven by antagonistic interactions which lead to reciprocal adaptations. keywords: analysis; associations; biol; coevolution; cospeciation; et al; events; evolutionary; host; methods; page; parasite; phylogenetic; phylogenies; phylogeny; species; test; trees cache: isj-377.pdf plain text: isj-377.txt item: #286 of 465 id: isj-378 author: Ballarin, L; Burighel, P; Cima, F; Manni, L; Zaniolo, G title: IN MEMORIAM ARMANDO SABBADIN 1920 - 2016 date: 2016-03-07 words: 640 flesch: 39 summary: Prof. Sabbadin was member of the Italian Zoological Society, Italian Association of Developmental and Comparative Immunobiology, 66   67   Italian Embryology Group, International Society of Developmental and Comparative Immunology. Microsoft Word - ISJ-In Memoriam-Sabbadin ISJ 13: 66-67, 2016 ISSN 1824-307X IN MEMORIAM ARMANDO SABBADIN 1920 - 2016 Armando Sabbadin was Emeritus Professor of Comparative Anatomy at the University of Padua, Padua (Italy). keywords: padua; sabbadin; university cache: isj-378.pdf plain text: isj-378.txt item: #287 of 465 id: isj-379 author: Sinkovics, J G title: Genes of ancient microtubule-stabilizing proteins traveled through pre-Cambrian Echinoidea to advanced life forms of dry land and ended up in the human genome as the fusion oncogenes-oncoproteins eml1/EML1-abl/ABL, and eml4/EML4-alk/ALK date: 2016-03-04 words: 6546 flesch: 51 summary: Doval DC, Prabhash K, Patil S, Chaturvedi H, Goswami C, Vaid AK, et al. Clinical epidemiological study of EGFR mutations and EML4-ALK fusion genes among Indian patients with adenocarcinoma of the lung. Analysis of ERBB ligand- induced resistance mechanism to crizotinib by primary culture of lung adenocarcinoma with EML4-ALK fusion gene. keywords: abl; alk; biol; cancer; cell; dna; eml1; eml4; et al; eukaryota; evolution; fusion; gene; human; lung; microtubule; oncogenes; protein; sci; sea; sinkovics; tubulin; urchin cache: isj-379.pdf plain text: isj-379.txt item: #288 of 465 id: isj-38 author: Shahriari, M; Sahebzadeh, N; Zibaee, A title: Effect of Teucrium polium (Lamiaceae) essential oil on digestive enzyme activities and energy reserves of Ephestia kuehniella (Lepidoptera: Pyralidae) date: 2017-05-03 words: 4926 flesch: 61 summary: 182 ISJ 14: 182-189, 2017 ISSN 1824-307X SHORT COMMUNICATION Effect of Teucrium polium (Lamiaceae) essential oil on digestive enzyme activities and energy reserves of Ephestia kuehniella (Lepidoptera: Pyralidae) M Shahriari1, N Sahebzadeh1, A Zibaee2 1Department of Plant Protection, Faculty of Agriculture, University of Zabol, Zabol, Iran 2Department of Plant Protection, Faculty of Agricultural Sciences, University of Guilan, Rasht, Iran Accepted May 3, 2017 The supernatants were stored at -20 oC for determination of digestive enzyme activities (Ramzi et al., 2013). keywords: activity; et al; kuehniella; larvae; min; oil; pinene; protein cache: isj-38.pdf plain text: isj-38.txt item: #289 of 465 id: isj-381 author: Sogame, Y; Hori, M; Matsuoka, T title: EF-1α silencing by feeding RNAi suppresses resting cyst formation in Colpoda cucullus Nag-1 strain date: 2016-03-15 words: 2968 flesch: 54 summary: These results suggest that Colpoda EF-1α is involved in the early morphogenetic events of the resting cyst formation by accelerating protein translation or cytosleletal dynamics such as microtubule disintegration. The fact that the expression of Colpoda EF-1α is prominently enhanced in the ___________________________________________________________________________ keywords: cells; colpoda; cucullus; ef-1α; encystment; stock cache: isj-381.pdf plain text: isj-381.txt item: #290 of 465 id: isj-382 author: Sukhachev, A N; Dyachkov, S I; Zyumchenko, N E; Kudryavtsev, V I; Polevshchikov, A V title: Dynamics of hemocyte subsets from ascidian Halocynthia aurantium in response to tissue damage: a comparative analysis of flow cytometry vs confocal microscopy data date: 2016-03-21 words: 4053 flesch: 45 summary: To examine dynamics in circulatory cell subsets, 24 h later each ascidian repeatedly received another cutting followed by hemolymph collection and the same volume of hemolymph was collected. This is one of the reasons why, over the years, ascidians have been extensively used for examining specialization of circulatory cells (Sukhachev et al., 2013) as well as their involvement in defense and reparative reactions (Smith, 1970). keywords: ascidian; aurantium; cells; circulatory; cytometry; damage; flow; hemocytes; tissue; tunic cache: isj-382.pdf plain text: isj-382.txt item: #291 of 465 id: isj-383 author: Giglio, A; Brandmayr, P; Cammarata, M; Cavaliere, F; Trapani, M R; Giulianini, P G title: Are immune responses gender-related in Carabus lefebvrei (Coleoptera: Carabidae)? date: 2016-03-29 words: 5833 flesch: 60 summary: For determination of total PO enzyme activity, 30 μL of hemolymph -buffer solution were added to 30 μL of methanol that chemically activates PO from its inactive zymogen, prophenoloxidase (proPO). PO activity of samples, compared to untreated or activated controls, was lowered (males 3.54 ± 0.66 U; females 1.25 ± 0.34 U). keywords: activity; adults; basal; enzyme; et al; females; hemolymph; immune; immunity; insect; lefebvrei; mating; sexual; stoehr cache: isj-383.pdf plain text: isj-383.txt item: #292 of 465 id: isj-384 author: Can Ulu, T; Sadic, B; Susurluk, I A title: Effects of different pesticides on virulence and mortality of some entomopathogenic nematodes date: 2016-04-01 words: 3195 flesch: 56 summary: ISJ 13: 111-115, 2016 ISJ 13: 111-115, 2016 ISSN 1824-307X RESEARCH REPORT Effects of different pesticides on virulence and mortality of some entomopathogenic nematodes T Can Ulu, B Sadic, IA Susurluk Uludag University, Faculty of Agriculture, Department of Plant Protection, 16059, Nilufer, Bursa, Turkey Accepted April 1, 2016 Abstract Entomopathogenic nematodes (EPNs) have been used against especially soil borne insect pests. The aim of the present study was to determine compatibility of different pesticides on commercial and a hybrid EPN strain. keywords: control; dd-136; epns; mortality; nematodes; pesticides; strains; study; virulence cache: isj-384.pdf plain text: isj-384.txt item: #293 of 465 id: isj-385 author: Matozzo, V title: Aspects of eco-immunology in molluscs date: 2016-04-05 words: 4531 flesch: 51 summary: Key Words: eco-immunology; hemocytes; immune responses; molluscs   Introduction What is the cost of the immune response? Immune response of blue mussels (Mytilus edulis) in spawning period following exposure to metals. keywords: clam; effects; et al; hemocytes; immune; immunology; invertebrates; matozzo; molluscs; parameters; response cache: isj-385.pdf plain text: isj-385.txt item: #294 of 465 id: isj-386 author: Mardani-Talaee, M; Zibaee, A; Nouri-Ganblani, G; Razmjou, J title: Chemical and organic fertilizers affect physiological performance and antioxidant activities in Myzus persicae (Hemiptera: Aphididae) date: 2016-04-06 words: 7655 flesch: 55 summary: Effects of fertilizers on intermediary metabolism of M. persicae Significant differences were found in activities of aspartate amino transferase (AST), alanine amino transferase (ALT) and γ-glutamyl transferase (γ-GT) of M. persicae fed on different fertilizer 127   Table 4 Effects of fertilizers on activities of aldolase, alkaline and acid phosphatase and lactate dehydrogenase in M. persicae adults Statistic (Mean±SE U/mg protein) Treatments Aldolase ALP ACP LDH Control 0.424±0.099 b 0.104±0.002 a 0.337±0.033 a 0.259±0.049 b Vermicompost (30%) 0.773±0.030 a 0.039±0.026 b 0.150±0.012 b Mardani- Talaee et al. (2015) reported higher activity of LDH in L. decemlineata adults fed on potatoes cultured in vermicompost (30 %) with regard to increased levels of secondary metabolites in the treated plants. keywords: activities; activity; aphids; control; et al; fed; fertilizers; min; persicae; sulfate; table; treatments; vermicompost; zinc cache: isj-386.pdf plain text: isj-386.txt item: #295 of 465 id: isj-387 author: Hirose, E; Uyeno, D title: Regional differentiation of the cuticular surface structure in the mesoparasitic copepod Cardiodectes shini (Siphonostomatoida: Pennellidae) on a pygmy goby date: 2016-05-10 words: 3380 flesch: 57 summary: For instance, in a pennellid copepod Phrixocephalus cincinnatus Wilson, 1908 that infects the eyes of flatfishes, the cuticle surface of the holdfast is covered with numerous, fine microvillosities that are occasionally in contact with host cells and may be involved in molecular exchange between parasite and host (Perkins, 1994). This array of protuberances might be involved in suppression of the host immune response, because the cephalothorax has direct contact with the host connective tissues and similar structures are found on other parasitic copepods inhabiting host tissue. keywords: array; cephalothorax; host; nipple; processes; shini; surface; tissue; trunk cache: isj-387.pdf plain text: isj-387.txt item: #296 of 465 id: isj-388 author: Gagnon, C; Pilote, M; Turcotte, P; André, C; Gagné, F title: Effects of exposure to zinc oxide nanoparticles in freshwater mussels in the presence of municipal effluents date: 2016-05-12 words: 8228 flesch: 45 summary: Discriminant function analysis showed that the municipal effluent related effects differed from the unexposed mussels and nano-ZnO exposed mussels in terms of the following responses: free Zn in gills and digestive gland and GST activity. In mussels exposed to nano-ZnO, factorial ANOVA revealed a significant effect only for Zn exposure concentrations (Fig. 2C). keywords: concentration; digestive; effluent; exposure; fig; gills; gland; levels; mussels; nano; p>0.1; presence; stress; zn levels; zncl2; zno cache: isj-388.pdf plain text: isj-388.txt item: #297 of 465 id: isj-389 author: Edwin, E; Vasantha-Srinivasan, P; Senthil-Nathan, S; Thanigaivel, A; Ponsankar, A; Selin-Rani, S; Kalaivani, K; Hunter, W B; Duraipandiyan, V; Al-Dhabi, N A title: Effect of andrographolide on phosphatases activity and cytotoxicity against Spodoptera litura date: 2016-05-12 words: 4927 flesch: 55 summary: Synthetic pesticides or chemical insecticides used for controlling S. litura have started to fail as populations of S. litura start to develop chemical resistance (Sintim et al., 2009; Senthil-Nathan et al., 2013). A. paniculata extracts have been reported as an antifeedant and ovicidal activity against insects (Hermawan et al., 1993), but activity of andrographolide on S. litura has yet to be evaluated. keywords: activity; andrographolide; cells; concentrations; fig; instar; larvae; litura; mortality; nathan; plant; ppm; reduction; senthil; spodoptera cache: isj-389.pdf plain text: isj-389.txt item: #298 of 465 id: isj-39 author: Yang, L; Wei, Z; Xu, M; Zhao, Y; Liang, H; Tan, P; Ma, H; Lu, T; Wang, Z; Cui, H title: Wnt1 promotes the proliferation of midgut epithelial cells in silkworm, Bombyx mori date: 2017-05-04 words: 4240 flesch: 61 summary: Cell stem cell 4: 49-61, 2009. Abstract Wnt genes are crucial members of at least three major signaling pathways that control diverse cellular behaviors, such as cell fate decisions, cell migration, and cell proliferation. keywords: analysis; bmwnt1; cell; control; drosophila; dss; edu; et al; expression; midgut; pcr; proliferation; silkworm cache: isj-39.pdf plain text: isj-39.txt item: #299 of 465 id: isj-390 author: Ataev, G L; Prokhorova, E E; Kudryavtsev, I V; Polevshchikov, A V title: The influence of trematode infection on the hemocyte composition in Planorbarius corneus (Gastropoda, Pulmonata) date: 2016-05-16 words: 5243 flesch: 52 summary: Metabolites facilitating cell destruction accumulate during long-term incubation of mollusc hemocytes. Bacterial injection leads to a 12 - 19 % increase in the number of P. corneus circulating hemocytes. keywords: analysis; bacteria; biomphalaria; cells; corneus; granulocytes; hemocytes; hemolymph; hyalinocytes; molluscs; number; snails cache: isj-390.pdf plain text: isj-390.txt item: #300 of 465 id: isj-391 author: Kiszler, G; Várhalmi, E; Krecsák, L; Solt, Z; Pollák, E; Molnár, L title: GABA immunoreactive elements in the sensory system of the earthworm Eisenia fetida (Annelida, Clitellata) date: 2016-05-20 words: 6861 flesch: 59 summary: Electrophysiological observations were used to find connections between the different types of sensory cells and their function. a) Solitary and grouped sensory cell were also represented in the epithelial layer. keywords: body; cells; distribution; earthworm; fig; gaba; lumbricus; mill; pattern; plexus; processes; segments; sensilla; system cache: isj-391.pdf plain text: isj-391.txt item: #301 of 465 id: isj-392 author: Tascedda, F; Ottaviani, E title: Biologically active peptides in molluscs date: 2016-05-27 words: 3052 flesch: 54 summary: These BAP, include bombesin, calcitonin, cholecystokinin (CCK)-8, CCK-39, gastrin, glucagon, growth hormone, insulin, met-enkephalin, neurotensin, oxytocin, pancreatic polypeptide (PP), somatostatin, substance P, secretin, serotonin, substance P, thyroglobulin, vasopressin and vasointestinal P (VIP) (Ottaviani and Cossarizza, 1990; Ottaviani et al., 1992), adrenocorticotropin hormone (ACTH), β-endorphin (Ottaviani et al., 1990), α-melanocyte-stimulating hormone (α-MSH) (Franchini et al., 1994) and corticotropin-releasing hormone (CRH) (Ottaviani et al., 1998). However, the enormous mass of molecular data available today, suggests we should adopt a rather opposite approach supporting conservation compared to changes (Ottaviani et al., 2001). keywords: acth; cells; et al; molecules; ottaviani; peptides; snail; stagnalis; system cache: isj-392.pdf plain text: isj-392.txt item: #302 of 465 id: isj-394 author: Maltseva, A L; Starunov, V V; Zykin, P A title: Application of MALDI-MSI for detection of antimicrobial peptides in tissues of the marine invertebrate Arenicola marina date: 2016-06-13 words: 2531 flesch: 47 summary: No specific signal was obtained from other body compartments, where arenicins were reported to be expressed (epithelium of the body wall and gut, extravasal 207      tissue, cuticle, ventral nerve cord (Maltseva et al., 2014). Although AMPs were identified in a wide range of organisms including plants, vertebrate and invertebrate animals, protists and prokaryotes (Boman, 2003; Reddy et al., 2004; Yount et al., 2006; Otero-González et al., 2010; Pasupuleti et al., 2012; Harder and Schröder, 2016) different taxa are still very unequally studied in terms of AMPs diversity and functioning, and immunology in general. keywords: amps; arenicins; body; imaging; maldi; marine; mass; msi; peptides cache: isj-394.pdf plain text: isj-394.txt item: #303 of 465 id: isj-395 author: Wojciechowska, M; Stepnowski, P; Gołębiowski, M title: The use of insecticides to control insect pests date: 2016-06-10 words: 7014 flesch: 51 summary: Methods of insects pests control Different procedures and methods can be used to control harmful organisms. 1) Physical methods: According to their mode of action, physical control methods can be active or passive. Other insect can also be used against insects pests (Commission Directive 2008/113/EC of 8 December 2008 amending Council Directive 91/414/EEC to include several micro-organisms as active substances; Can Ulu et al., 2016). 3) Chemical methods: associated with the use of chemicals that affect particular insects. keywords: beetles; chemicals; compounds; control; development; environment; et al; homozygotes; insecticides; insects; larvae; management; methods; natural; pesticides; pests; plant; population; protection; pyrethroids; resistance; species; use cache: isj-395.pdf plain text: isj-395.txt item: #304 of 465 id: isj-396 author: Golikhajeh, N; Naseri, B; Razmjou, J title: Effect of geographic origin of Spodoptera exigua (Lepidoptera: Noctuidae) and sugar beet cultivar on nutritional indices of this pest date: 2016-06-28 words: 5641 flesch: 58 summary: Determination of minerals in sugar beet cultivars Leaf samples of four tested sugar beet cultivars were oven dried (at 60 °C) for 48 h, and then ground with electric mills. Effect of population and sugar beet cultivar on ECI value of S. exigua Results The effect of population and sugar beet cultivar on ECI value of the fifth instar of S. exigua is shown in Table 2. keywords: beet; cultivar; dorothea; exigua; indices; perimer; persia; plant; population; sugar; value cache: isj-396.pdf plain text: isj-396.txt item: #305 of 465 id: isj-398 author: Berlov, M N; Maltseva, A L title: Immunity of the lugworm Arenicola marina: cells and molecules date: 2016-07-07 words: 6980 flesch: 51 summary: Antimicrobial activity of arenicins Arenicins at micromolar or even lower concentrations display significant antimicrobial activity towards the wide range of Gram-positive and Gram-negative bacteria, and fungi (Ovchinnikova et al., 2004, 2007; Lee et al., 2007; Andrä et al., 2008; Sandvang et al., 2008). Several marine bacteria (Vibrio alginolyticus, Listonella anguillarum, and Planococcus citreus) were also susceptible to arenicins (Andrä et al., 2009). keywords: activity; amps; andrä; arenicin-1; arenicins; arenicola; bacteria; body; cells; celomic; celomocytes; comp; et al; immunity; lee; marina; ovchinnikova; peptide; polychaete; structure cache: isj-398.pdf plain text: isj-398.txt item: #306 of 465 id: isj-399 author: Grimaldi, A title: Origin and fate of hematopoietic stem precursor cells in the leech Hirudo medicinalis date: 2016-07-12 words: 7387 flesch: 50 summary: In particular, leech HSPCs that extravasate are positive for L-selectin, which is a typical marker for hematopoietic cells adhering to the inner vessel wall and destined to leave the blood stream. Moreover, the role of several cytokines in the recruitment, commitment and differentiation of hematopoietic cells has been also confirmed by injecting MG supplemented with different kind of growth factors in the leech body wall. keywords: botryoidal; cells; differentiation; eguileor; endothelial; et al; grimaldi; grimaldi et; growth; hematopoiesis; hspcs; leech; medicinalis; stem; tettamanti; tissue; valvassori; vegf; vertebrates cache: isj-399.pdf plain text: isj-399.txt item: #307 of 465 id: isj-40 author: Zajac, K S; Kramarz, P E title: Terrestrial gastropods - how do they reproduce? date: 2017-05-05 words: 9079 flesch: 57 summary: REVIEW 199 ISJ 14: 199-209, 2017 ISSN 1824-307X REVIEW Terrestrial gastropods - how do they reproduce? This publication presents a general review of sexual systems and strategies in terrestrial gastropods with special emphasis on mating, fertilization, presence of love darts, reproductive strategies (semelparity vs. iteroparity) and modes (oviparity, ovoviviparity, viviparity), production of eggs and egg cannibalism. keywords: animal; biol; darts; eggs; et al; female; fertilization; gastropods; heller; juveniles; koene; land; life; love; mating; molluscs; pulmonata; reproductive; sex; size; snail; species; sperm cache: isj-40.pdf plain text: isj-40.txt item: #308 of 465 id: isj-400 author: Andrejko, M; Siemińska, A title: The role of Pseudomonas aeruginosa alkaline protease in activation of the antimicrobial activity in Galleria mellonella larvae date: 2016-08-12 words: 6712 flesch: 51 summary: For detection of bacterial alkaline protease, the membranes were probed with rabbit antibodies against P. aeruginosa alkaline protease (1:1000) (kindly provided by Dr. R. Voulhoux, Laboratoire d'Ingénierie des Systèmes Macromoléculaires, CNRS UMR7255, Institut de Microbiologie de la Méditerranée, France). The activity assay showed that the chromatographic fraction was able to hydrolyze hide powder azure, a substrate for P. aeruginosa alkaline protease (data not shown). keywords: activity; aeruginosa; alkaline; alkaline protease; hemolymph; immune; larvae; mellonella; peptides; protease; pseudomonas cache: isj-400.pdf plain text: isj-400.txt item: #309 of 465 id: isj-401 author: Gagné, F; Auclair, J; Trépanier, S; Turcotte, P; Pilote, M; Gagnon, C title: The impact of zinc oxide nanoparticles in freshwater mussels exposed to municipal effluents date: 2016-08-12 words: 6176 flesch: 41 summary: Accepted August 12, 2016 Abstract Zinc oxide nanoparticles (nano-ZnO) are used in the production of transparent sunscreens and cosmetics, which are released into the environment through municipal effluents. The purpose of this study was to examine the toxicity of nano-ZnO to freshwater mussels (Elliptio complanata) in the presence of municipal effluents. keywords: concentration; dna; effluent; exposure; gills; levels; mda; mussels; nano; nanoparticles; zncl2; zno cache: isj-401.pdf plain text: isj-401.txt item: #310 of 465 id: isj-402 author: Yin, Y; Xia, H; Zhu, F; Chen, L; Lü, P; Chen, K title: Virus-induced opposite effect on Bombyx mori gene transcriptions date: 2016-09-06 words: 4273 flesch: 62 summary: Cytochrome c oxidase subunit II, ribosomal s3a and death associated protein (DAP), which are involved in the apoptotic pathway, relate to the resistance to virus (Chi et al., 2009; Bao et al., 2010;  Xu et al., 2010). Actin, myosin, or tubulin family proteins, such as suppressor of profiling 2, transgelin, actin-depolymerizing factor 1 and myosin heavy chain, relate to the resistance to virus (Xu et al., 2005; Zhao, 2007; Bao et al., 2009). keywords: bmbdv; bmnpv; bombyx; et al; expression; levels; mori; strains; transcription; virus cache: isj-402.pdf plain text: isj-402.txt item: #311 of 465 id: isj-403 author: Sun, X J; Zhou, L Q; Liu, Z H; Wu, B; Yang, A G title: Transcriptome-wide analysis reveals candidate genes responsible for the asymmetric pigment pattern in scallop Patinopecten yessoensis date: 2016-09-14 words: 5915 flesch: 56 summary: Quality control of gene expression analysis To obtain more reliable results and avoid incorrect interpretation of gene expression data, four library samples including two replicates are used to estimate the robustness of abundance as a function of expression level and mapping reads (Fig. 2). 304 biases for the estimation of gene expression (Wang et al., 2009; Bullard et al., 2010). keywords: analysis; color; data; et al; expression; gene; left; mantle; p450; pattern; pigment; pigmentation; reads; right; rna; sequencing; shell; yessoensis cache: isj-403.pdf plain text: isj-403.txt item: #312 of 465 id: isj-404 author: Parisi, M G; Trapani, M R; Cardinale, L; Cammarata, M title: Evidence of cytotoxic activity against mammalian red blood cell of Na+ channel neurotoxin (Ae1) from sea anemone (Actinia equina) date: 2016-09-19 words: 3796 flesch: 54 summary: Na+ and K+ channel peptide toxins are able to paralyze preys immediately. In this study we evaluated the hemolytic activity of HPLC separated fraction of tentacle extracts of sea anemone Actinia equina. keywords: acid; activity; ae1; anemone; channel; equina; hplc; min; peptide; sea; toxins cache: isj-404.pdf plain text: isj-404.txt item: #313 of 465 id: isj-405 author: Plytycz, B; Bigaj, J; Falniowski, A; Morgan, A J title: Unexpected results and open questions from experiments on regeneration in lumbricid worms date: 2016-09-20 words: 5166 flesch: 49 summary: Controlled expulsion of celomic fluid through dorsal pores of the earthworms may be induced by various irritants like 5 % ethanol (Cooper et al., 1995), ultrasounds (Hendawi et al., 2004) or mild electric current (Roch, 1979), the latter procedure modified and used in present studies (see Gałuszka et al., 2015; Kociński et al., 2016). Lysenin, i.e., hemolytic sphingomyelin-binding pore-forming protein (Roch, 1979; Cooper et al., 2002 De Colibus et al., 2012; Bokori-Brown et al., 2016) and lysenin-related proteins were detected in all investigated specimens of Eisenia sp., both Ea and Ef (the latter both EfM+ and EfM-) but not in D. veneta (Swiderska et al., 2016). keywords: + +; blastema; eisenia; et al; fluid; posterior; regeneration; restoration; segments; species; worms cache: isj-405.pdf plain text: isj-405.txt item: #314 of 465 id: isj-406 author: Panini, M; Manicardi, G C; Moores, G D; Mazzoni, E title: An overview of the main pathways of metabolic resistance in insects date: 2016-09-19 words: 7246 flesch: 53 summary: They act to suppress insect populations and, as a consequence of their use, insecticide resistance has evolved. Key Words: insecticide resistance; esterases; P450; glutathione-S-transferases; synergists Introduction Insect pests represent a serious threat to agricultural production and vector disease control. keywords: biochem; biol; enzymes; esterase; et al; field; gene; glutathione; insecticide; insects; mechanisms; metabolic; molecular; myzus; p450; persicae; pest; plant; populations; resistance; sci; species cache: isj-406.pdf plain text: isj-406.txt item: #315 of 465 id: isj-407 author: Bhagat, J; Ingole, B S; Singh, N title: Glutathione S-transferase, catalase, superoxide dismutase, glutathione peroxidase, and lipid peroxidation as biomarkers of oxidative stress in snails: A review date: 2016-10-17 words: 9848 flesch: 55 summary: No observed effect Li et al., 2008 Cantareus apertus Digestive gland Carbamate pesticide Carbaryl Increases Leomanni et al., 2015 Eobania vermiculata Digestive glands Sites contaminated with heavy metals Increase El-Shenawy et al., 2012 Helix aspersa Digestive gland Sites contaminated with heavy metals Increase Abdel-Halim et al., 2013 Lanistes carinatus Chlorpyrifos Increases Khalil et al., 2015 Lymnaea luteola L Hepatopancrease gland Silver nanoparticles Increases Ali et al ., 2014 340 Lymnaea natalensis Polluted sediment and water Increases Siwela et al., 2010 Lymnaea luteola L Hepatopancreas Single walled carbon nanotubes Decreases Ali et al., 2015 Lymnaea luteola L Digestive gland Zinc oxide nanoparticles Increases Ali et al., 2012 Significant increase in CAT activity was reported in A. fulica exposed to 40, 69, and 118 mg/kg of triclosan but high concentrations of 200 and 340 mg/kg showed inhibition in the enzyme activity (Wang et al., 2014). keywords: activity; antioxidant; aspersa; biomarkers; biomphalaria; cat; copper; decrease; digestive; effects; environ; et al; exposure; gland; glutathione; gst; increase; lpo; lymnaea; ma et; metal; oxidative; ros; sites; snail; sod; stress; tissue; toxicol cache: isj-407.pdf plain text: isj-407.txt item: #316 of 465 id: isj-408 author: Roy, S; Prasad, A K; Handique, G; Barua, A; Roy, S title: First report on heat shock protein expression in red spider mites (Oligonychus coffeae) in response to pesticide exposure date: 2016-11-02 words: 2893 flesch: 57 summary: 350 ISJ 13: 350-354, 2016 ISSN 1824-307X SHORT COMMUNICATION First report on heat shock protein expression in red spider mites (Oligonychus coffeae) in response to pesticide exposure S Roy1, AK Prasad2, G Handique2, A Barua2, S Roy2 1Natural Product Chemistry Group, CSIR-North East Institute of Science & Technology, Jorhat, Assam 785006, India 2Entomology Department, Tocklai Tea Research Institute, Tea Research Association Jorhat, Assam 785008, India Accepted November 2, 2016 Abstract Red spider mites (RSM) is one of the major pest of tea and reported from all tea producing regions around the world. In this study early expression of heat shock proteins have been observed in RSM exposed to commonly used acaricides viz., ethion, dicofol and fenpropathrin. keywords: dicofol; ethion; expression; fenpropathrin; hsp; india; mite; spider; tea cache: isj-408.pdf plain text: isj-408.txt item: #317 of 465 id: isj-409 author: Smith, L C; Coscia, M R title: Tuning the host-pathogen relationship through evolution with a special focus on the echinoid Sp185/333 system date: 2016-11-03 words: 13573 flesch: 58 summary: Abstract Diversification of immune genes in host organisms that are in deadly arms races with pathogens has resulted in a wide range of approaches by which the host survives. For invertebrates that survive in the absence of adaptive immunity, innate immune diversity is accomplished based on functions of clusters of immune genes such as FREPs, VCBPs, C1qs, TLRs, and R genes. keywords: binding; buckley; cell; copy; diversification; diversity; dna; dscam; et al; expression; family; fig; function; genes; host; immunity; immunol; pathogen; proteins; purple; recombination; region; response; sea; sequence; smith; sp185/333; system; urchin; vertebrates cache: isj-409.pdf plain text: isj-409.txt item: #318 of 465 id: isj-41 author: Xie, J; Yang, D; Sun, X; Cao, R; Chen, L; Wang, Q; Li, F; Ji, C; Wu, H; Cong, M; Zhao, J title: Combined toxicity of cadmium and lead on early life stages of the Pacific oyster, Crassostrea gigas date: 2017-05-08 words: 6899 flesch: 58 summary: Comparison of trace metal toxicity in life stages (spermiotoxicity, egg toxicity, embryotoxicity and larval toxicity) of Hydroides elegans. Moreover, high levels of metal concentrations are also found in sediments along the coastal and estuary areas in China. keywords: concentration; dna; embryos; embryotoxicity; et al; exposure; larvae; metals; mixture; mortality; oyster; toxicity cache: isj-41.pdf plain text: isj-41.txt item: #319 of 465 id: isj-410 author: Chen, H; Liu, Z; Shi, Y; Ding, H H title: Microbiological analysis and microbiota in oyster: a review date: 2016-11-03 words: 9174 flesch: 48 summary: Environmental impacts on oyster microbiota The diversity and community of bacteria in raw oysters were affected by many factors. These factors include the location of the sea (Cao et al., 2009; King et al., 2012; Madigan et al., 2014; Wood and Arias, 2015), harvest season (Parveen et al., 2008), water temperature (Gonzalez-Acosta et al., 2006; Shen et 376 Table 1 Food borne pathogen in oyster aquaculture, sale and storage Species/ Location Pathogen/ Food borne pathogen* Analysis Method Reference C. virginica oyster/ Mobile Bay, US V. parahaemolyticus* Alkaline phosphatase-labeled DNA probe procedures (Kaufman et al., 2003) Pacific oysters (C. gigas)/ Arcata Bay, US Listeria sp.*, L. monocytogenes* Culture and isolates (Colburn et al., 1990) keywords: aeromonas; bacillus; bacteria; chen; crassostrea; culture; dominant; et al; flavobacterium; food; gigas; microbiota; micrococcus; oyster; pacific; parahaemolyticus; pcr; pseudomonas; spoilage; spp; storage; vibrio cache: isj-410.pdf plain text: isj-410.txt item: #320 of 465 id: isj-411 author: Pinto, R; Zanuncio, J C; de S Tavares, W; Fernandes, F L; Junqueira, L R; Serrão, J E title: Prey scarcity at the beginning of fifth instar: effect of Eucalyptus urophylla (Myrtaceae) plants on reproduction, longevity, and weight of the predator Brontocoris tabidus (Heteroptera: Pentatomidae: Asopinae) date: 2016-11-15 words: 5432 flesch: 63 summary: These adults were mated on the fourth day of adult age (Zanuncio et al., 2006) and those from T2, T3, and T4 placed into the bags on branches of E. urophylla plants (Zanuncio et al., 2004). Discussion The survival of fifth instar B. tabidus nymphs was higher even after 10 days without mealworm pupae than that for those fed daily on pupae and river red gum seedlings, Eucalyptus camaldulensis, flooded gum, Eucalyptus grandis, and E. urophylla (Zanuncio et al., 2000) or only mealworm pupae (Jusselino-Filho et al., 2001). keywords: days; et al; fed; fifth; heteroptera; instar; nymphs; pentatomidae; tabidus; zanuncio cache: isj-411.pdf plain text: isj-411.txt item: #321 of 465 id: isj-412 author: Xu, J; Zhao, D; Sun, M; Wang, L; Jia, Z; Liu, R; Wang, L; Song, L title: A-type CpG ODN with higher binding affinity to LvToll1 could probably activate downstream IFN system-like antiviral response in shrimp Litopenaeus vannamei date: 2016-12-06 words: 8610 flesch: 63 summary: Recently, CpG ODN has been applied as an immunopotentiator against pathogens in crustacean aquaculture and the previous studies have revealed that CpG ODNs could increase the survival rate after WSSV injection (Zhang et al., 2010; Yi et al., 2014). Moreover, the WSSV copy numbers in CpG-A group was the lowest among the four types of CpG ODN groups, especially on the fifth day post WSSV challenge, the numbers in CpG-B, CpG-C and CpG-P groups was 2.68-fold, 3.17-fold and 2.62-fold (p < 0.01) higher than that of CpG-A group respectively. keywords: cpg; cpg odns; dna; et al; expression; fig; fold; group; ifn; immunol; level; lvtoll1; pbs; ros; shrimp; type; virus; wssv cache: isj-412.pdf plain text: isj-412.txt item: #322 of 465 id: isj-413 author: Parisi, M G; Vizzini, A; Toubiana, M; Sarà, G; Cammarata, M title: Identification, cloning and environmental factors modulation of a αβ defensin from the Lessepsian invasive mussel Brachidontes pharaonis (Bivalvia: Mytilidae) date: 2015-11-05 words: 6265 flesch: 52 summary: Key Words: Brachidontes pharaonis; Antimicrobial peptides (AMPs); defensin; Lessepsian mussel; environmental stress effect   Introduction Biological invasions are considered one of the main concerns worldwide they elicit ecological modifications (mostly detrimental) to ecosystem dynamics with tangible economic rebounds on local societies (Ojaveer et al., 2015). Here, we focused on the immunological response by antimicrobial peptides (AMPs). keywords: amps; analysis; bpdef; conditions; defensins; et al; expression; gene; mussel; peptides; pharaonis; sequence; species cache: isj-413.pdf plain text: isj-413.txt item: #323 of 465 id: isj-414 author: Ulu, T C; Sadic, B; Susurluk, I A; Aksit, T title: Virulence of four entomopathogenic nematode species for plum sawfly, Hoplocampa flava L. (Hymenoptera: Tenthredinidae) date: 2015-10-20 words: 2579 flesch: 54 summary: In the second year, EPNs managed to reproduce and control sawfly larvae, but they could not reduce the fruit damage. In addition, Curto et al. (2006) performed a study to determine virulence of S. feltiae on pear sawfly H. brevis. keywords: control; entomopathogenic; epns; larvae; sawfly; species; study cache: isj-414.pdf plain text: isj-414.txt item: #324 of 465 id: isj-415 author: Scalici, M; Traversetti, L; Malafoglia, V; Colamartino, M; Persichini, T; Colasanti, M title: Concepts and tools for exploiting sessile bio-filters as early warning elements: introductory applications for marine ecosystem preservation date: 2015-10-29 words: 5043 flesch: 44 summary: Instead, bioindicators can be considered as responses to changes of environmental conditions at the levels of population, species, community, ecosystem, and landscape (the latter in Adams et al., 2001). The latter is essentially due to their life-history characteristics and to their relatively rapid response to anthropogenic and natural stress descriptors (Roméo and Gnassia-Barelli, 1997; Cheggour et al., 2001; Griscom et al., 2002; Lecoeur et al., 2004; Baudrimont et al., 2005; Machreki-Ajmi and Hamza-Chaffai, 2008; Smaoui- Damak et al., 2009; Serafim and Bebiano, 2010; Ramos-Gomez et al., 2011; Wang et al., 2012). keywords: biomarkers; ecosystem; effects; environ; et al; landmarks; levels; marine; monitoring; mytilus; organisms; population; response; shape; species; stress; use cache: isj-415.pdf plain text: isj-415.txt item: #325 of 465 id: isj-416 author: Meiyalagan, V; Arumugam, M title: Detection and preliminary characterization of antibacterial protein(s) in the serum of mud crab, Scylla serrata date: 2015-11-02 words: 3891 flesch: 49 summary: In contrast, Relf and Chisholm (1999) reported that the antibacterial protein from the granular hemocytes of the shore crab, Carcinus maenas is stable after heating to 100 ⁰C. Presence of antibacterial activity against all the four bacterial species in the precipitation obtained with 75 % ammonium sulphate or the supernatant obtained after precipitating the protein with 10 % TCA indicated that the molecule(s) responsible for serum antibacterial activity appear to be proteinaceous in nature. 289 Fig. 4 pH stability of serum antibacterial activity of mud crab, Scylla serrata. keywords: activity; bacillus; bacteria; coli; crab; mud; serrata; serum cache: isj-416.pdf plain text: isj-416.txt item: #326 of 465 id: isj-418 author: Liu, X H; Wang, B J; Li, Y F; Wang, L; Liu, J G title: Effects of dietary botanical and synthetic astaxanthin on E/Z and R/S isomer composition, growth performance, and antioxidant capacity of white shrimp, Litopenaeus vannamei, in the nursery phase [For this article an Erratum has been published] date: 2018-03-26 words: 6111 flesch: 55 summary: These results suggest that appropriate levels of dietary botanical AST could enhance the expression of the enzymes. These results indicate that dietary botanical AST effectively relieves environmental oxidative damage through higher gene expression levels of antioxidant enzymes, which could counteract stress induced by reactive oxygen species in L. vannamei postlarvae. keywords: antioxidant; ast; ast70; astaxanthin; cis; diets; expression; fed; gpx; groups; isomer; levels; postlarvae; shrimp; vannamei cache: isj-418.pdf plain text: isj-418.txt item: #327 of 465 id: isj-419 author: Zhang, Y; Lü, P; Yu, Q; Li, R; Miao, D; Hu, Z; Yang, Y; Chen, L; Chen, K; Yao, Q title: Construction of a Bombyx mori cell line that stably express the susceptible gene +nsd-2 of Bombyx mori bidensovirus date: 2018-04-01 words: 4958 flesch: 64 summary: As we know, it is hard to promote the virus study without the proper sensitive cell lines, so we tried to clone and express the +nsd-2 gene in BmN cells, and established a BmN (+nsd-2) cell line that can stably express NSD-2 protein. BmN cells were cultured with TC-100 medium supplemented with 10% fetal bovine serum (FBS, Gibco, in Grand Island, NY, USA) and 1% antibiotics (penicillin-streptomycin; HyClone Gibco-BRL (Life) Technologies, Carlsbad, CA, USA) in T-25 flask. keywords: bmbdv; bmn; bmn cells; bombyx; cells; gene; mori; nsd-2; pcr; protein; silkworm; virus cache: isj-419.pdf plain text: isj-419.txt item: #328 of 465 id: isj-42 author: Han, S; Wang, B; Wang, M; Liu, Q; Zhao, W; Wang, L title: Effects of ammonia and nitrite accumulation on the survival and growth performance of white shrimp Litopenaeus vannamei date: 2017-06-01 words: 8124 flesch: 53 summary: On the one hand, ammonia and nitrate are the main toxic product of protein catabolism in the aquatic system, which are generated mainly in the mineralization process of organic wastes such as unconsumed feed and feces (Chen et al., 1989; Cheng et al., 2013; Ren et al., 2015); on the one hand, ammonia and nitrate can increase the concentration of hydrogen ions in aquatic ecosystem, resulting in acidification (Camargo and Alonso, 2006), and are essential, life-sustaining, nitrogen-containing compounds used by many aquatic microorganisms (Pinto et al., 2016). By contrast, the present study indicated that ammonia and nitrite accumulation had significantly higher lethality but similar inhibitory effects on physiological processes involved in body mass increase in treatment shrimp; this could be because exposure to high levels of ambient ammonia induces increased energy expenditure that regulates osmotic and ionic stress (Young-Lai et al., 1991; Spaargaren 1982; Chen and Cheng 1993b, c), resulting in reduced growth; meanwhile, there might be a resulting synergistic effect of ammonia and nitrite accumulation in that energy expenditure for osmoregulation in treatment shrimp according to previous report (Cheng et al., 2013), which led to higher lethality in the present study. keywords: accumulation; activity; ammonia; aquaculture; chen; control; et al; expression; group; growth; hepatopancreas; litopenaeus; nitrite; penaeus; seawater; shrimp; stress; treatment; treatment shrimp; vannamei; white cache: isj-42.pdf plain text: isj-42.txt item: #329 of 465 id: isj-420 author: Ke, X X; Gao, H; Chen, K; Zhang, L; Chen, S; Wang, X; Wei, Z; Yang, L; Cui, H title: Identification of BmBrat gene in silkworm, Bombyx mori date: 2018-04-07 words: 3798 flesch: 59 summary: Abstract: 149 ISJ 15: 149-157, 2018 ISSN 1824-307X RESEARCH REPORT Identification of BmBrat gene in silkworm, Bombyx mori XX Ke1#, H Gao1#, K Chen2, L Zhang1, S Chen1, X Wang1, Z Wei1, L Yang1, H Cui1* #These authors contributed equally to this work 1State Key Laboratory of Silkworm Genome Biology, Southwest University, Chongqing 400716, P.R. China 2Department 6 of Research Institute of Surgery, State Key Laboratory of Trauma, Burns and Combined Injury, Daping Hospital, Army Medical University, Chongqing 400042, P.R. China Accepted April 7, 2018 Abstract NHL protein family is evolutionarily conserved in either vertebrates or invertebrates. (B) Multiple sequence alignment of BmBrat in several species, and BmBrat gene has high homology in these species 152 Fig. keywords: analysis; bmbrat; cell; development; domain; drosophila; expression; fig; gene; proliferation; protein; silkworm cache: isj-420.pdf plain text: isj-420.txt item: #330 of 465 id: isj-421 author: Baghban, A; Sendi, J J; Zibaee, A title: Effect of essential and non-essential elements on cellular immune system of cotton bollworm, Helicoverpa armigera Hübner (Lepidoptera: Noctuidae) date: 2018-04-11 words: 5625 flesch: 58 summary: It has been well documented that insect genotype (Rantala and Roff, 2006), sex and different stage (Rantala et al., 2007; Jalali and Salehi, 2008), quality and quantity of food and feeding indices (Rantala et al., 2003; Yang et al., 2007; Baghban et al., 2014), crowding (Wilson et al., 2003) and physical activity (Ahtiainen et al., 2006) affect the immune functions of insect. Heavy metal treatment continued for 7 days until third instar larvae were 24 h old in all assays. keywords: activity; armigera; cadmium; concentrations; copper; effect; et al; fig; hemocytes; immune; insect; larvae; metals; response cache: isj-421.pdf plain text: isj-421.txt item: #331 of 465 id: isj-422 author: Asadi, M; Rafiee-Dastjerdi, H; Nouri-Ganbalani, G; Naseri, B; Hassanpour, M title: The effects of plant essential oils on the functional response of Habrobracon hebetor Say (Hymenoptera: Braconidae) to its host date: 2018-04-20 words: 6491 flesch: 54 summary: Isolation of essential oils The selected medicinal plants including garlic, Allium sativum; rosemary, Rosmarinus officinalis; black pepper, Piper nigrum; sage, Salvia officinalis and liquorice, Glycyrrhiza glabra that was available in the Iranian flora and contained suitable amount of essential oil were collected from different regions of Islam-Abad Gharb city (34.11° N, 46.53° E) in Kermanshah Province, Iran, during May 2017. To date there have been no research conducted the effects of plant essential oils on E. kuehniella and functional response of H. hebetor; but, the researches about the lethal and sublethal effects of essential oils on this important biocontrol agent are available (Seyyedi et al., 2011; Hashemi et al., 2014; Ahmadpour, 2017). keywords: control; effects; glabra; h. hebetor; hebetor; host; officinalis; oils; parasitoid; plant; response; time; wasp cache: isj-422.pdf plain text: isj-422.txt item: #332 of 465 id: isj-424 author: Huang, Y; Sun, J; Wang, L; Song, L title: The unfolded protein response signaling pathways in molluscs date: 2018-05-14 words: 10138 flesch: 56 summary: Three molluscan PERKs have been identified in oyster C. gigas (Zhang et al., 2012; Yang et al., 2017), C. hongkongensis (Li et al., 2017), and freshwater mussel V. lienosa (Wang et al., 2012). CRT and CNX have been identified from oysters C. gigas (Kawabe and Yokoyama, 2010; Zhang et al., 2012) and C. hongkongensis (Li et al., 2017). keywords: atf6; bip; cell; eif2α; et al; exposure; gigas; gills; heat; ire1; molluscan; molluscs; oyster; pathway; perk; protein; response; signaling; storey et; stress; treatment; upr; xbp1; yang et; zhang et cache: isj-424.pdf plain text: isj-424.txt item: #333 of 465 id: isj-425 author: Borsuk, G; Kozłowska, M; Anusiewicz, M; Paleolog, J title: Nosema ceranae changes semen characteristics and damages sperm DNA in honeybee drones date: 2018-06-07 words: 4031 flesch: 63 summary: Varroa in the mating yard: The effect of Varroa jacobsoni and Apistan on drone honey bees. Prior studies demonstrate that N. ceranae spreads into many tissues and affects the sexual function of infected drones (Roberts and Hughes, 2015; Ciereszko et al., 2017). keywords: apis; ceranae; dna; drones; fragmentation; honey; nosema; semen; sperm; spores cache: isj-425.pdf plain text: isj-425.txt item: #334 of 465 id: isj-426 author: Feng, X W; Huo, J L; Shi, X Z title: Myeloid leukemia factor participates in the antibacterial immune reaction of kuruma shrimp Marsupenaeus japonicus date: 2018-06-12 words: 3996 flesch: 60 summary: Rangrez AY, Pott J, Kluge A, Frauen R, Stiebeling K, Hoppe P, et al. Myeloid leukemia factor-1 is a novel modulator of neonatal rat cardiomyocyte proliferation. In shrimp, MLF functions importantly by inhibiting WSSV replication and inducing hemocytes apoptosis (Feng et al., 2017). keywords: amps; anguillarum; assay; et al; expression; mjmlf; protein; shrimp cache: isj-426.pdf plain text: isj-426.txt item: #335 of 465 id: isj-427 author: Niu, X; Xu, Q; Wang, W; Yu, Z; Liu, Z; Qu, C; Liu, Y; Gong, C; Wang, L; Song, L title: The antifungal activity of a thaumatin-like protein from oyster Crassostrea gigas date: 2018-06-07 words: 7586 flesch: 63 summary: Hemocytes and hepatopancreas were the major immune organs of C. gigas (Wang et al., 2018). The higher mRNA expression in these tissues indicated that CgTLP might play an important role in the immune response of C. gigas (Wang et al., 2018). keywords: activity; antifungal; cgtlp; domain; et al; expression; fig; gigas; group; hemocytes; mrna; pastoris; plant; protein; splendidus; thaumatin; tlps; β-1,3 cache: isj-427.pdf plain text: isj-427.txt item: #336 of 465 id: isj-428 author: Hou, C; Shi, Y; Wang, H; Li, R; Nartey, M A; Guo, X title: Composition and diversity analysis of intestinal microbiota in the fifth instar silkworm, Bombyx mori L. date: 2018-06-12 words: 6615 flesch: 54 summary: Compared with these methods, the recent rapid development of high-throughput sequencing techniques provide new methods in analysis of 16S rRNA genes, genome sequence and transcriptome (Boissière et al., 2012; Hou et al., 2011; 2014; Li et al., 2016; Chengxiang et al., 2017; Zhang et al., 2017). Now some corresponding intestinal microbes were used to treat the specific diseases in medicine (Zhang et al., 2013). keywords: abundance; analysis; bacteria; composition; diversity; et al; fig; genera; gut; microbes; pc2; phylum; samples; silkworm; tags; time cache: isj-428.pdf plain text: isj-428.txt item: #337 of 465 id: isj-429 author: Cammarata, M; Pagliara, P title: Elie Metchnikoff and the multidisciplinary link novelty among Zoology, Embryology and Innate Immunity date: 2018-06-26 words: 4218 flesch: 52 summary: As in echinoids, mesenchyme sea stars cells appear at the tip of archenteron during gastrulation and are widely dispersed throughout the blastocoel (Chia, 1977, Dan-Sohkawa et al., 1980). Some larval and adult cells (Fig. 1) show the same morphology and express the same set of genes. keywords: adult; cells; crawford; immune; immunity; immunol; larval; mesenchyme; metchnikoff; sea; smith; star; urchin cache: isj-429.pdf plain text: isj-429.txt item: #338 of 465 id: isj-43 author: Udroiu, I; Russo, V; Persichini, T; Colasanti, M; Sgura, A title: Telomeres and telomerase in basal Metazoa date: 2017-06-12 words: 4610 flesch: 58 summary: Cnidaria Nematostella vectensis - (2) + (6) References: 1: (Koziol et al., 1998); 2: (Traut et al., 2007); 3: (Robertson, 2009b); 4: (Ojimi et al., 2009); 5: (Nakamichi et al., 2012); 6: (Steele et al., 2011); 7: (Zielke and Bodnar, 2010). Later on, it is downregulated in a tissue-specific manner (Forsyth et al., 2002). keywords: activity; cells; chromosome; dna; et al; human; length; metazoa; ojimi; senescence; shortening; telomere; telomeric cache: isj-43.pdf plain text: isj-43.txt item: #339 of 465 id: isj-430 author: Falabella, P title: The mechanism utilized by Toxoneuron nigriceps in inhibiting the host immune system date: 2018-06-26 words: 11748 flesch: 55 summary: This observation may indicate that T. nigriceps venom metalloproteases might have similar functions in host immune suppression, in addition to their possible activity in host protein and tissue degradation. PTP (protein tyrosine phosphatase) (Provost et al., 2004; Falabella et al., 2006), UDP (glucose-6- dehydrogenase and sugar transporter) and BEN domain proteins (Falabella et al., unpublished data). keywords: asgari; biochem; biol; cell; endoparasitoid; et al; factors; falabella; gene; heliothis; host; immune; insect; larvae; nigriceps; parasitism; parasitoid; pennacchio; physiol; polydnavirus; protein; role; strand; system; teratocytes; tnbv; venom; vinson; virescens; wasp cache: isj-430.pdf plain text: isj-430.txt item: #340 of 465 id: isj-431 author: Gao, L; Yang, Y; Yao, Q; Chen, K title: Differentially expressed genes in the midguts of BmNPV-susceptible and resistant silkworm strains determined using suppression subtractive hybridization date: 2018-07-19 words: 5781 flesch: 52 summary: Apoptosis occurs through the activation of caspase through the apoptosis information pathway (Wang et al., 2016). After baculovirus enters the host cell, the actin of the host cell is aggregated to participate in the transport of the nucleocapsid from the cytoplasm to the nucleus (Wang et al., 2007). keywords: actin; bc10; bmnpv; bombyx; cdna; et al; expression; genes; hybridization; infection; mori; nil; pcr; protease; protein; resistance; silkworm; strain; virus cache: isj-431.pdf plain text: isj-431.txt item: #341 of 465 id: isj-432 author: Venkatesh, M D; Subramanyam, M V V title: Role of glutamate transporter EAAT2 in survival of silk worm Bombyx mori at higher dosages of Azaserine, an analogue of glutamine date: 2018-07-11 words: 5307 flesch: 58 summary: Significance was represented as α and β for mid gut tissues, p and q for posterior silk gland tissue and * and # for fat body tissues assayed in control, 1 and 5 mM azaserine injected larval groups. Significance was represented as α, and γ for midgut tissues p, q and r for posterior silk gland tissue and * and # for fat body tissues assayed in control, 1 and 5 mM azaserine injected larval groups Effect of azaserine on ATP formation in B. mori Tissues were assayed for ATP formation in the presence (+) and absence (-) of creatine phosphate. keywords: azaserine; cystine; dosages; eaat2; gene; ggt; gland; glutamate; gut; larval; mid; mori; silk; survival; tissues cache: isj-432.pdf plain text: isj-432.txt item: #342 of 465 id: isj-433 author: Vorontsova, Y L; Slepneva, I A; Alekseev, A A; Kryukov, V Y; Tyurin, M V; Glupov, V V title: The effect of entomopathogenic fungi Metarhizium robertsii of different virulence on the generation of reactive oxygen species in Galleria mellonella larvae date: 2018-08-13 words: 5758 flesch: 60 summary: It was shown that the melanization and the encapsulation have a negative correlation with the level of destruxins production by fungi (Wang et al., 2012). We have shown that the level of ROS production in the cuticle and hemolymph of G. mellonella larvae depends on the virulence of the M. robertsii strains. keywords: et al; formation; fungi; hemolymph; insects; larvae; mellonella; production; robertsii; ros; strains; treatment; virulence cache: isj-433.pdf plain text: isj-433.txt item: #343 of 465 id: isj-434 author: Wang, M Q; Wang, B J; Liu, M; Jiang, K Y; Wang, L title: An i-type lysozyme (CfLyzI) involved in innate immunity is essential for the survival of Chlamys farreri during Vibrio stimulation date: 2018-08-22 words: 5169 flesch: 56 summary: Among all the animal origin types, c-type and g-type lysozymes are present in all the vertebrates, while invertebrates mainly produce i-type lysozymes and partially produce c-type, ch-type or g-type lysozymes (Callewaert and Michiels, 2010). Moreover, i-type lysozymes exhibit multiple activities, such as chitinase, isopeptidase, muramidase and non-enzymatic antibacterial activities (Van Herreweghe and Michiels, 2012). keywords: cflyzi; dsrna; et al; expression; gene; lysozyme; mrna; primer; scallops; stimulation; type; vibrio; wang cache: isj-434.pdf plain text: isj-434.txt item: #344 of 465 id: isj-435 author: Wang, M Q; Wang, B J; Liu, M; Jiang, K Y; Wang, L title: Molecular characterization of a defender against apoptotic cell death 1 gene (CfDAD1) from the mollusk Chlamys farreri date: 2018-08-27 words: 4821 flesch: 54 summary: Knock-down of CfDAD1 gene in vivo via dsRNA mediated RNA interference and apoptotic assay T7 promoter adapted primers CfDAD1-dsRNA-T7-F/R and EGFP-dsRNA-T7-F/R (Table 1) were used to amplify cDNA fragments from CfDAD1 and enhanced green fluorescent protein (EGFP), and the PCR products were gel-purified and used as templates to synthesize dsRNA. Bioinformatical analysis of CfDAD1 cDNA and deduced amino acid sequences The blast+ 2.7.1 was employed to perform search for protein sequence similarity. keywords: apoptosis; apoptotic; cfdad1; dsrna; expression; gene; level; mrna; pcr; primer; scallops; sequence; wang cache: isj-435.pdf plain text: isj-435.txt item: #345 of 465 id: isj-439 author: Wang, M; Wang, L; Ni, D; Yi, Q; Wang, X; Jia, Z; Song, L title: The mRNA expression profiles demonstrating versatile roles of glutathione S-transferase genes in the mollusk Chlamys farreri date: 2018-08-27 words: 6426 flesch: 56 summary: Li et al., 2012; Zhang et al., 2012a,b; Li et al., 2015), marine mussels Mytilus galloprovincialis (Wang et al., 2013; Li et al., 2015), pearl oyster Pinctada martensii (Chen et al., 2011), razor clam Solen grandis (Yang et al., 2012), ridge-tail white prawn Exopalaemon carinicauda (Duan et al., 2013), and sea cucumber Apostichopus japonicas (Shao et al., 2017; cDNA cloning of the full-length CfGST genes The full-length cDNA sequences of CfGST genes were obtained by rapid-amplification of cDNA ends (RACE) technique based on the analysis of EST sequences (Wang et al., 2009). keywords: cfgsts; cfgstσ-2; cfmgst; et al; expression; farreri; gene; glutathione; mrna; pcr; primer; profiles; race; scallop; specific; wang cache: isj-439.pdf plain text: isj-439.txt item: #346 of 465 id: isj-440 author: Chen, Y; Wang, B J; Wang, M Q; Liu, M; Jiang, K Y; Wang, L title: Molecular characterization of the dual oxidase (LvDuox) gene from the pacific white shrimp Litopenaeus vannamei date: 2018-08-22 words: 4783 flesch: 56 summary: The level of the H2O2 was detected at different hours (0-36 h) using a hydrogen peroxide assay kit according to the manufacturer’s instructions Analysis of LvDuox expression in various tissues The qRT-PCR was used to detect the tissue distribution of LvDuox gene expression, by using the β-actin gene as a reference. The mRNA transcripts of LvDuox gene were observed in all the detected tissues. keywords: analysis; cdna; domain; et al; expression; fig; gene; h2o2; lvduox; midgut; pacific; sequence; shrimp; vpe1; white cache: isj-440.pdf plain text: isj-440.txt item: #347 of 465 id: isj-441 author: Naeem, A; Freed, S title: Biochemical basis of conventional and novel mode of action insecticides resistance in field population of Diaphorina citri collected from Southern Punjab, Pakistan date: 2018-08-19 words: 4820 flesch: 58 summary: Biochemical assays explain that the insensitivity of different insecticides is likely the biochemical basis of conventional and novel mode of action insecticides resistance in D. citri. Baseline toxicity and activities of esterases (EST), and glutathione-S-transferases (GST) sensitivity to bifenthrin, chlorpyrifos, thiamethoxam, acetamiprid, nitenpyram, chlorfenapyr and imidacloprid were established with field populations of D. citri. keywords: activity; citri; citrus; est; et al; gst; insecticides; min; protein; resistance; µmol cache: isj-441.pdf plain text: isj-441.txt item: #348 of 465 id: isj-442 author: Bodó, K; Ernszt, D; Németh, P; Engelmann, P title: Distinct immune- and defense-related molecular fingerprints in sepatated coelomocyte subsets of Eisenia andrei earthworms date: 2018-09-04 words: 4986 flesch: 54 summary: Homa et al., (2013) found that a phorbol ester (PMA), a potent activator of PKC caused the proliferation of earthworm coelomocytes. Catalase (Cat) is one conserved key enzyme of oxidative stress, and it exists in many different cell types including earthworm coelomocytes (Brulle et al., 2006). keywords: amoebocytes; andrei; cath; cell; coelomocyte; comp; earthworm; eisenia; eleocytes; engelmann; et al; expression; fig; genes; immune; immunol; stress; subsets cache: isj-442.pdf plain text: isj-442.txt item: #349 of 465 id: isj-443 author: Prokhorova, E E; Serebryakova, M K; Tokmakova, A S; Ataev, G L title: Hemocytes of mollusc Biomphalaria glabrata (Gastropoda, Pulmonata) date: 2018-09-28 words: 3331 flesch: 56 summary: Obviously, new methods and approaches ought to be employed in further studies of hemolymph cells. Characteristics FShighSShigh FSlowSSlow Populations identified based on absorption of LysoTracker and SYTO62 Percentage 3.35 (2.06; 3.98) 31.97 (24.26; 37.27) 51.00 (42.92; 62.82) 7.02 (5.33; 11.86) Characteristics LTlowS62low LThighS62high LTlowS62low LThighS62high Discussion The number of hemolymph cells is an important characteristic of the state of the internal environment of the mollusc. keywords: cells; cytometry; flow; glabrata; granulocytes; hemocytes; hemolymph; hyalinocytes; scatter cache: isj-443.pdf plain text: isj-443.txt item: #350 of 465 id: isj-444 author: Esvaran, V G; Gupta, T; Mohanasundaram, A; Ponnuvel, K M title: Development of isothermal amplification assay for detection of Nosema bombycis infection in silkworm Bombyx mori targeting polar tube protein 1 gene date: 2018-09-26 words: 5641 flesch: 55 summary: Optimization of LAMP reaction conditions The optimization of LAMP reaction was achieved by performing the reactions at different temperatures and time points with the optimized components described above. A) Visual detection of LAMP reaction using HNB dye. keywords: amplification; bombycis; detection; dna; gene; isothermal; lamp; loop; min; pcr; primers; ptp1; reaction cache: isj-444.pdf plain text: isj-444.txt item: #351 of 465 id: isj-455 author: Ladhar-Chaabouni, R; Houel, T; Lebel, J M; Hamza-Chaffai, A; Serpentini, A title: Effects of fluoride on primary cultured haemocytes from the marine gastropod Haliotis tuberculata date: 2019-01-03 words: 4117 flesch: 53 summary: The most obvious early toxic effects of fluoride on humans are dental and skeletal fluorosis (Barbier et al., 2010; Ullah et al., 2017). Furthermore, fluoride acts as an inhibitor of the activity of a broad range of enzymes (Reddy et al., 2009; Barbier et al., 2010; Zuo et al., 2018). keywords: activity; cell; effects; et al; exposure; fluoride; haemocytes; ml-1; naf; ros; tuberculata cache: isj-455.pdf plain text: isj-455.txt item: #352 of 465 id: isj-46 author: Benatti, C; Colliva, C; Blom, JMC; Ottaviani, E; Tascedda, F title: Transcriptional effect of serotonin in the ganglia of Lymnaea stagnalis date: 2017-07-31 words: 4916 flesch: 58 summary: This effect is mediated by the phosphorylation of CREB at Ser119, this transcription factor is a key component in regulating synaptic plasticity both in physiologic and pathologic 257 conditions (Kaang et al., 1993; Sadamoto et al. 2010, Blom et al., 2002; Alboni et al., 2011). Sadamoto H, Sato H, Kobayashi S, Murakami J, Aonuma H, Ando H, et al. CREB in the pond snail Lymnaea stagnalis: cloning, gene expression, and function in identifiable neurons of the central nervous system. keywords: effect; et al; expression; flx; htp; lymnaea; serotonin; snails; stagnalis cache: isj-46.pdf plain text: isj-46.txt item: #353 of 465 id: isj-460 author: Mishra, CSK; Nayak, S; Samal, S title: Low intensity light effects on survivability, biomass, tissue protein and enzyme activities of the earthworm Eudrilus eugeniae (Kinberg) date: 2019-02-04 words: 3587 flesch: 60 summary: Sivasankari B, Indumathi S, Anandharaj M. A study on life cycle of earthworm Eudrilus eugeniae. Antioxidants enzyme activities and markers of oxidative stress in the life cycle of earthworm Eudrlus eugeniae. keywords: activities; activity; biomass; earthworm; eugeniae; light; protein; tissue cache: isj-460.pdf plain text: isj-460.txt item: #354 of 465 id: isj-478 author: Cammarata, M; Benenati, G; Dara, M; Parisi, M G; Piazzese, D; Falco, F; Stabili, L title: Sabella spallanzanii mucus contain a galactose-binding lectin able to agglutinate bacteria. Purification and characterization date: 2019-03-15 words: 5783 flesch: 53 summary: Their defensive functions, such as cytotoxicity and lysozyme-like activity, (Canicattì et al., 1992; Stabili et al., 2009; Giangrande et al., 2014) inhibit in vitro the growth of Vibrio anguillarum, Vibrio harveyi, Pseudomonas aeruginosa and Candida albicans (Stabili et al., 2011). Recently, Stabili et al. isolated a lysozyme-like activity and an in vitro antimicrobial activity in S. spallanzanii mucus towards some Gram-negative bacteria (Stabili et al., 2009) clearly indicating the role of this compartment in defending the worms from bacterial attack serving as medium into which the antibacterial substances are exuded. keywords: activity; bacteria; binding; biol; et al; galactose; hemagglutinating; kda; lectin; mucus; spallanzanii; ssgbl cache: isj-478.pdf plain text: isj-478.txt item: #355 of 465 id: isj-480 author: Wang, M Q; Wang, B J; Liu, M; Jiang, K Y; Wang, L title: The first identification of a malectin gene (CfMal) in scallop Chlamys farreri: sequence features and expression profiles date: 2019-03-18 words: 5409 flesch: 62 summary: These PRRs include C-type lectin (Mu et al., 2012), galectin (Song et al., 2011), lipopolysaccharide (LPS) and β-1,3-glucan binding proteins (Su et al., 2004), leucine-rich repeat-only proteins (Wang et al., 2017), peptidoglycan recognition proteins (Ni et al., 2007), scavenger receptors (Liu et al., 2011), thioester containing proteins (Zhang et al., 2007), and Toll-like receptors (Wang et al., 2011). We previously identified a malectin homologue sequence of C. farreri by using available public transcriptomic data (Wang et al., 2018b). keywords: cfmal; et al; expression; gene; hemocytes; immun; malectin; pcr; primer; protein; qrt; scallop; stimulation; wang cache: isj-480.pdf plain text: isj-480.txt item: #356 of 465 id: isj-481 author: Giglio, A; Brandmayr, P; Talarico, F; Mazzei, A; Marsico, S; Naccarato, A; Cavaliere, F; Vommaro, M L; Granieri, M C title: XXth scientific meeting of the Italian Association of Developmental and Comparative Immunobiology (IADCI), 13 - 15 February 2019, Department of Biology, Ecology and Life Sciences, University of Calabria, Rende, Italy date: 2019-03-18 words: 10461 flesch: 29 summary: Evolution of immune responses: similarities between fish lymphocytes and mammalian innate-like lymphocytes G Scapigliati, S Picchietti Department for Innovation in Biological, Agrofood and Forest Systems, University of Tuscia, Viterbo, Italy Innate lymphoid cells (ILCs) of Vertebrates are a cluster of innate immune cells that are classified in three groups for the expression of defined transcription factors, functional characteristics, and phenotype. In vivo isolation and characterization of telocytes using supplemented biomatrices L Pulze, A Grimaldi, F Ferraro, N Baranzini, G Tettamanti, M de Eguileor University of Insubria, Department of Biotechnology and Life Sciences, Varese, Italy The leeches (Hirudo verbana) have proven to be a good model for deciphering basic biological processes for two main reasons: first of all, they have a reduced dimension and, despite a relative anatomical simplicity, share with vertebrates the complexity of immunological mechanisms and wound-healing processes; secondly, in animal kingdom there is a remarkable evolutionary conservation of biological responses, cell types, cellular mechanisms, and molecules. keywords: activity; biology; cells; department; effects; exposure; expression; fish; genes; immune; immunity; innate; italy; life; model; protein; regeneration; response; results; role; sciences; species; study; system; university cache: isj-481.pdf plain text: isj-481.txt item: #357 of 465 id: isj-49 author: Zhang, Y; Tang, H; Yang, Y; Lü, P; Yao, Q; Chen, K title: Comparative proteomic analysis of the silkworm (Bombyx mori L.) silk gland reveals yield heterosis date: 2018-02-26 words: 7943 flesch: 53 summary: Reverse primer (5’-3’) 1 calreticulin GCGACCCAGAGGATGACAAA AGACCTTGAGGTATCCGCCT 5 protein disulfide-isomerase like protein ERp57 precursor CGGCTTCCCCACAATCTTCT TGGCGTTACCCTTTCTGTCC 11 Nd-sD mutant fibroin light chain TCTCACGTGCATGGGACTAC ACCCATACTGTTAGCGGCTG 12 fibroin light chain precursor CTCACGTCGATGGGACTACG CACCGCTGATGCTTGACTTG 13 fibroin L-chain CGATACTCTGTCGGACCAGC AAGTGAGCGGTGATGTAGGC 16 cellular retinoic acid binding protein AAGAGTTCGAAGAGGACCGC AGACTCTGGTGCAAGTCACG 18 farnesoic acid O- methyltransferase AAATCGAAGTGCCACCGACT CAGTCCTGTCCTCCCACAAC 22 fibrohexamerin-like GGCGGATGAGGTAGACTGTG GTACTGGCCCCAGCGTTATT 26 enolase ATGATTGGTCTGCATGGGCA CTCTGTTACGCTGCCGATCT 27 arginine kinase TTGGAGGCTGGTTTCAGCAA AGGAGGGTGGATCCGAATGA Note: a The spot number of identified proteins (see Table 1) binding, phosphopyruvate hydratase activity, glycolytic process 27 gi|827541166 arginine kinase 42% 40.3/5.87 640 355 ATP binding, kinase activity 2.1 Unique proteins in HY-JS 15 gi|512891724 phosphatidylethanola mine-binding protein homolog F40A3.3-like 62% 20.2/5.02 729 185 construction and remodeling of biofilm, signal transduction, nervous system growth and development Unique proteins in JS 8 gi|512894896 uncharacterized protein LOC101739721 46% 32.9/4.56 708 289 JS-HY and HY- JS 1f The results showed that the addition of TiO2 could promote the synthesis of silk protein. keywords: activity; binding; bombyx; chain; cocoon; disulfide; et al; fibroin; gene; gland; heterosis; hybrids; mori; protein; silk; silkworm; weight cache: isj-49.pdf plain text: isj-49.txt item: #358 of 465 id: isj-490 author: Shayegan, D; Sendi, J J; Sahragard, A; Zibaee, A title: Immunological and antioxidant responses of larval Helicoverpa armigera (Lepidoptera: Noctuidae) to gibberellic acid in the diet date: 2019-03-28 words: 7298 flesch: 60 summary: Twelve hours after the latex beads injection, the percentage of plasmatocytes in the control larvae was significantly higher than those in the larvae fed with GA3 diet (F= 6.28; df= 4, 19; p< 0.05). No significant differences were found in the amount of protein and glucose, while the lowest amount of triglyceride was observed in larvae fed on GA3 diet compared to the control (F= 32.40; df= 4, 44; p< 0.05). keywords: acid; activity; armigera; c800; concentrations; df=; diet; effect; et al; ga3; gibberellic; insect; larvae; protein cache: isj-490.pdf plain text: isj-490.txt item: #359 of 465 id: isj-494 author: Genevière, A M title: 2nd general meeting and working group meetings of the COST Action 16203: STEM CELLS OF MARINE/AQUATIC INVERTEBRATES: FROM BASIC RESEARCH TO INNOVATIVE APPLICATIONS (MARISTEM), November 28-30, 2018, Mar. Biol. Station – Lab. Arago, Banyuls-sur-Mer, France date: 2019-04-01 words: 4006 flesch: 29 summary: However, studies on stem cells from organisms outside the classical vertebrate (e.g., human, mouse, and zebrafish) and invertebrate (e.g., Drosophila, Caenorhabditis) models have not been pursued vigorously. Paraoanua et al (2007) report that locally produced acetylcholine might function as an intercellular signal, modulating the proliferation of stem cells. keywords: animal; biology; cells; development; invertebrates; marine; organisms; regeneration; research; stem; stem cells; university cache: isj-494.pdf plain text: isj-494.txt item: #360 of 465 id: isj-50 author: Han, S Y; Wang, B J; Liu, M; Wang, M Q; Jiang, K Y; Qi, C C; Wang, L title: Effect of cyclic serious/medium hypoxia stress on the survival, growth performance and resistance against Vibrio parahemolyticus of white shrimp Litopenaeus vannamei date: 2017-08-01 words: 7109 flesch: 56 summary: Digestive enzyme activity of shrimp under cyclic serious/medium hypoxia The amylase and lipase activities of CSMH shrimp were not significantly (p >0.05) different from N shrimp on days 7, 14; and 7, respectively (Figs 5A, B); but the amylase, lipase, and trypsin activities of CSMH versus A) B) 263 259 Fig. 4 Na + /K + -ATPase transcription (A), CAc transcription (B), and CAg transcription (C) of shrimp during the experimental period. 6 Photomicrographs of the hepatopancreases of N shrimp (A) and CSMH shrimp (B). keywords: biol; csmh; cyclic; days; effects; et al; expression; gene; growth; hepatopancreas; hypoxia; mar; medium; oxygen; shrimp; survival; vannamei cache: isj-50.pdf plain text: isj-50.txt item: #361 of 465 id: isj-502 author: Sułek, M; Vertyporokh, L; Waleczko, P; Wojda, I title: Immune priming of Galleria mellonella larvae with Bacillus thuringiensis affects coagulation and phenoloxidase activity upon subsequent infection date: 2019-04-19 words: 3625 flesch: 52 summary: We compared two related aspects of immune response – hemolymph coagulation and the activity of phenoloxidase in the primed and non-primed larvae after the injection of the lethal dose of B. thuringiensis. Key Words: greater wax moth; hemolymph coagulation; insect immune memory; insect immunity; melanisation Introduction Insects possess only innate immune mechanisms to fight infections (Buchmann, 2014). keywords: coagulation; hemolymph; immune; infection; insect; larvae; primed; thuringiensis cache: isj-502.pdf plain text: isj-502.txt item: #362 of 465 id: isj-51 author: Wang, M; Yu, Q; Li, Y; Zhang, Y; Miao, D; Hu, Z; Yao, Q; Chen, K title: Evaluation of a novel, short polyA signal from the Bombyx mori bidensovirus date: 2017-08-07 words: 6568 flesch: 58 summary: To detect the impact of the BmBDV polyA on firefly luciferase gene expression levels driven by the p5 or ie1 promoters, two small fragments of BDVpA(63) with different restriction endonuclease sites (XbaI/SalI and XbaI/BamHI) were synthesized by annealing, cleaved with XbaI/SalI/BamHI to produce a sticky end, and inserted downstream of the firefly luciferase gene in the long fragments pGL3-p5-SV40 − and pGL3-ie1-SV40 − , which were retrieved from pGL3-p5-SV40 and pGL3-ie1-SV40 that are preserved in our laboratory, to produce two clones carrying the p5 or ie1 promoter upstream of the firefly luciferase gene with a downstream BDVpA(63) To determine the effect of the BmBDV polyA on gene expression, the expression of the green fluorescent protein and firefly luciferase was evaluated with the BmBDV polyA, compared with the much larger SV40 polyA, under the control of the p5 or ie1 promoter. keywords: bdvpa(63; bmbdv; cells; expression; gene; gfp; ie1; luciferase; pgl3; plasmids; polya; sv40 cache: isj-51.pdf plain text: isj-51.txt item: #363 of 465 id: isj-511 author: Gong, C; Liu, C; Li, H; Li, M; Liu, Z; Wang, W; Wang, L; Song, L title: The transformation of energy metabolism and Endoplasmic Reticulum stress regulation in Pacific oyster Crassostrea gigas under air exposure date: 2019-05-14 words: 6521 flesch: 56 summary: The y-axis of heatmaps represents module genes. The color shade of the heatmap represents the FKPM of module genes increasing from green to red. keywords: air; air exposure; day; energy; et al; exposure; expression; fig; genes; gigas; metabolism; module; network; oyster; protein; stress; time cache: isj-511.pdf plain text: isj-511.txt item: #364 of 465 id: isj-513 author: Simonini, R; Iori, D; Forti, L; Righi, S; Prevedelli, D title: Ecotoxicity of hallachrome, an unusual 1-2 anthraquinone excreted by the infaunal polychaete Halla parthenopeia: evidence for a chemical defence? date: 2019-05-21 words: 6108 flesch: 57 summary: Accordingly, to isolate purple mucus pigment, aliquots of centrifuged purple mucus (50-100 mL) were placed in a separating funnel containing 150- 300 mL of chloroform (Carlo Erba reagents). The Mediterranean specimens of H. parthenopeia live in soft bottom habitats at 10-50 m depth and is highly appreciated as fishing bait in France, Spain, Italy and Egypt (see Iori et al., 2014). keywords: concentration; et al; gyrociliatus; hallachrome; iori; lc50; mucus; parthenopeia; pigment; test; toxicity cache: isj-513.pdf plain text: isj-513.txt item: #365 of 465 id: isj-52 author: Hernández-Sámano, A C; Guzmán-García, X; García-Barrientos, R; Ascencio-Valle, F; Sierra-Beltrán, A; Guerrero-Legarreta, I title: Characterization of protease activity from the digestive tract and tentacles of Isostichopus fuscus sea cucumber date: 2017-08-12 words: 7596 flesch: 58 summary: Gao F, Yang H, Xu Q, Wang F, Liu G. Effect of water temperature on digestive enzyme activity and gut mass in sea cucumber Apostichopus japonicas (Selenka), with special reference to aestivation. 282 ISJ 14: 282-294, 2017 ISSN 1824-307X RESEARCH REPORT Characterization of protease activity from the digestive tract and tentacles of Isostichopus fuscus sea cucumber AC Hernández-Sámano 1 , X Guzmán-García 2 , R García-Barrientos 3 , F Ascencio-Valle 4 , A Sierra- Beltrán 4 , I Guerrero-Legarreta 1 1 Biotechnology Department, Universidad Autónoma Metropolitana, 09340 Mexico City, Mexico 2 Hydrobiology Department, Universidad Autónoma Metropolitana, 09340 Mexico City, Mexico 3 Universidad Politécnica de Tlaxcala, 90180 Tlaxcala, Mexico 4 Centro de Investigaciones Biológicas del Noroeste S.C., La Paz, 23096 Baja California Sur, Mexico Accepted August 12, 2017 Abstract Sea cucumbers possess evisceration mechanisms and regeneration capacity. keywords: activity; cucumber; digestive; effect; et al; extracts; fig; fuscus; japonicus; kda; proteases; sea; tentacles; tract cache: isj-52.pdf plain text: isj-52.txt item: #366 of 465 id: isj-522 author: Cavaliere, F; Brandmayr, P; Giulianini, P G; Vommaro, M L; Giglio, A title: Harpalus (Pseudoophonus) rufipes as a model to study cellular and humoral immune defence strategies in coleopteran species date: 2019-07-01 words: 6797 flesch: 56 summary: Four morphological types of circulating cells were identified for their size, morphology and dye-staining properties: prohemocytes (Figs 1A and 2A), plasmatocytes (Figs 1B and 2B-H), granular cells (Figs 1C and 3A- E) and oenocytoids (Figs 1D and 3F). Light and transmission electron microscopy To estimate the number of circulating cells per μL of hemolymph (total hemocyte counts, THCs) without distinction of morphology and function, 3 μL of hemolymph were collected from control animals by puncturing cold anaesthetized adults at the ventral level of the pro-mesothorax articulation with a 29-gauge needle. keywords: activity; adults; beads; cells; fig; figs; granular; hemocytes; hemolymph; immune; insect; latex; plasmatocytes; rufipes cache: isj-522.pdf plain text: isj-522.txt item: #367 of 465 id: isj-523 author: Zhou, X X; Chang, X Q; Zhan, Y Y; Wang, X L; Lin, K title: Expression analysis of miR-2005 and its target genes in Apostichopus japonicus by Vibrio splendidus challenged date: 2019-07-04 words: 5088 flesch: 60 summary: miR-137 and miR-2008 were predicated that could targeted the 3’-UTR of betaine-homocysteine mailto:xiuliwang417@sina.com mailto:yaqingchang@hotmail.com 106 S-methyltransferase (AjBHMT), which induces respiratory bursts and affects Hcy accumulation in coelomocytes (Zhang et al., 2015). Studies of Drosophila and Euarchonta (Lu et al., 2008; Zhang et al., 2008) suggested that gain and loss of miRNAs can be affected by transposition and retrotransposition. keywords: apostichopus; cucumber; et al; expression; genes; immune; japonicus; mir-2005; sea; splendidus; target; zhang cache: isj-523.pdf plain text: isj-523.txt item: #368 of 465 id: isj-524 author: Soñanez-Organis, J G; Miranda-Cruz, M M; Poom-Llamas, J J; Stephens-Camacho, N A; Adan-Bante, N P; Rosas-Rodríguez, J A title: Betaine aldehyde dehydrogenase is regulated during WSSV infection in white shrimp date: 2019-07-04 words: 4205 flesch: 55 summary: 113 ISJ 16: 113-119, 2019 ISSN 1824-307X RESEARCH REPORT Betaine aldehyde dehydrogenase is regulated during WSSV infection in white shrimp JG Soñanez-Organis 1 , MM Miranda-Cruz 1 , JJ Poom-Llamas 1 , NA Stephens-Camacho 2 , NP Adan- Bante 1 , JA Rosas-Rodríguez 1 * 1 Departamento de Ciencias Químico-Biológicas y Agropecuarias, Universidad de Sonora, Navojoa, Sonora, México 2 Universidad Estatal de Sonora, Lic. Nutrición Humana, Navojoa, Sonora, México Accepted June 18, 2019 However, different gene expression studies in shrimp during WSSV infection focused in changes on the mechanisms of energy production and cellular defense genes, without considering genes sensitive to osmotic variation. keywords: activity; aldehyde; betaine; et al; expression; infection; lvbadh; shrimp; stress; virus; white; wssv cache: isj-524.pdf plain text: isj-524.txt item: #369 of 465 id: isj-525 author: Mallahi, M; Zibaee, A; Sendi, J J; Jamali, S title: Effects of Steinernema carpocapsae (Weiser) on immunity and antioxidant responses of Glyphodes pyloalis Walker date: 2019-07-11 words: 5522 flesch: 50 summary: Although these results should be compared with bioassays using other nematode species/isolates, but the mortality after 24 h and median lethal concentration found here may confirm efficiency of S. carpocapsae (IRA18) against G. pyloalis. Results of the current study demonstrated induction of immune system of G. pyloalis larvae though proliferation of hemocytes and higher activity of phenoloxidase. Results The used native isolate of S. carpocapsae imposed significant mortality against fourth instar larvae of G. pyloalis. keywords: activity; antioxidant; carpocapsae; injection; insect; larvae; nematode; peroxidase; pyloalis; ringer cache: isj-525.pdf plain text: isj-525.txt item: #370 of 465 id: isj-532 author: Kausar, S; Abbas, M N; Zhao, Y; Cui, H title: Immune strategies of silkworm, Bombyx mori against microbial infections date: 2019-08-01 words: 8891 flesch: 52 summary: However, following microbial challenge, despite of the variation in experimental methods and species in the immune studies, different species approximately show similar immune response as innate immune system in insects remain conserved during evolutionary period (Wang et al., 2019). While, humoral immunity largely stimulates the immune deficiency (IMD) and Toll pathway, which produce antimicrobial peptides (AMPs) through a signal transduction cascade, melanin and reactive oxygen species (ROS) (Kanost et al., 2004; Kausar et al., 2017a). keywords: abbas; activation; amps; b. mori; bacterial; biol; bombyx; bombyx mori; et al; gene; immune; infection; insect; kausar; molecular; mori; pathway; ppo; production; protein; responses; silkworm; species; wang cache: isj-532.pdf plain text: isj-532.txt item: #371 of 465 id: isj-537 author: Pan, G; Gao, X; Lin, Z; Yao, H; Dong, Y title: Identification of BMP2 and BMP7 genes and association of their SNPs with growth traits in the hard clam (Meretrix meretrix) date: 2019-08-20 words: 6720 flesch: 61 summary: Although a selective breeding program for genetic improvement of growth traits of M. meretrix has begun (Wang et al., 2011), association analysis between phenotype and genotype has still been relatively rare to date. The hard clam (Meretrix meretrix) is a commercially important bivalve species that is distributed in the intertidal zone of South and Primer name Sequence from 5’to 3’ Application MmBMP2-F1 ATGGCGTGTCCTCTCAGTTTAC 3’ RACE cloning MmBMP2-R1 ATCACTCCCCAGCCTGTCCTTCAATG 5’ RACE cloning MmBMP2-F2 GTGGGCAGGATTTCACTGTAGG Verifying the sequence of cDNA MmBMP2-R2 GTAGCATTGAAGGACAGGCTGGGGAGT Verifying the sequence of cDNA MmBMP2-F3 CTAACAGCAGCGACAGTGTGT SNP MmBMP2-R3 CTGGACTTCATCTTCGTGGAA SNP MmBMP2-F4 CCAGTCTACCTACAGAACAGCC SNP MmBMP2-R4 TCCGTTTAGTCCGTGATAAGC SNP MmBMP2-F5 TATCACGGACTAAACGGAGCA SNP MmBMP2-R5 CGTAAACTACCTTGACTGGAAGCA SNP Real-2-F TCAGTCGGGTGTATTTTAGCAGA Real time PCR Real-2-R CATTTTTTCCAGCAGGTCAAGTG Real time PCR MmBMP7-F1 GTCAGGTGAGCGATGTAGGGTCGTTTC 3’ RACE cloning MmBMP7-R1 CAAGTGTCTGCTGGTTCCCGATTCC 5’ RACE cloning MmBMP7-F2 AAGTTGTGATAAAACTGCGCG Verifying the sequence of cDNA MmBMP7-R2 AACTATATATAGCTTGCATC Verifying the sequence of cDNA MmBMP7-F3 TTTAGGCAATTTCCCGAGAC SNP MmBMP7-R3 CCTTGTCGTGCCTAAGATGC SNP MmBMP7-F4 TTCCGCATCTTAGGCACGAC SNP MmBMP7-R4 GGGTAACCTTCAGGGGCGAT SNP MmBMP7-F5 ATTATCGCCCCTGAAGGTTAC SNP MmBMP7-R5 AAACGACCCTACATCGCTCAC SNP Real-7-F GTTTTCGCCTGTTGTGGTG Real time PCR Real-7-R GAGTGTGCGGTGTTCGTGTA Real time PCR 18S-F CTTTCAAATGTCTGCCCTATCAACT Real time PCR 18S-R TCCCGTATTGTTATTTTTCGTCACT Real time PCR 143 Southeast Asia (Liu et al., 2006; Tang et al., 2006). keywords: analysis; bmp7; cdna; clam; development; et al; expression; gene; genotype; growth; growth traits; meretrix; mmbmp2; pcr; shell; snp; snps; traits; weight cache: isj-537.pdf plain text: isj-537.txt item: #372 of 465 id: isj-54 author: Xiong, Y M; Yan, Z H; Zhang, J E; Li, H Y title: Immune related genes expression in juveniles of an invasive snail after challenged with Lipopolysaccharide date: 2017-08-17 words: 3745 flesch: 55 summary: In recent years, using transcriptome sequencing can facilitate understanding the immune responsemechanisms of aquatic animals during pathogen stimulation (Dheilly et al., 2014), the technology has been used in Pelodiscus sinensis (Xu et al., 2016), Biomphalaria glabrata (Zhang et al., 2016) mailto:hyli@scau.edu.cn 295 Fig. In the past, research on bacterial challenge mainly focused on adult molluscs (Liu et al., 2017). keywords: canaliculata; degs; et al; expression; immune; juvenile; lps; pathway; receptor; signaling; unigenes cache: isj-54.pdf plain text: isj-54.txt item: #373 of 465 id: isj-541 author: Auclair, J; André, C; Peyrot, C; Wilkinson, K; Turcotte, P; Gagnon, C; Gagné, F title: Combined effects of surface waters and CeO nanoparticle in zebra mussels date: 2019-09-11 words: 8936 flesch: 57 summary: 152 ISJ 16: 152-163, 2019 ISSN 1824-307X RESEARCH REPORT Combined effects of surface waters and CeO nanoparticle in zebra mussels J Auclair1, C André1, C Peyrot2, K Wilkinson2, P Turcotte1, C Gagnon1, F Gagné1* 1Aquatic Contaminants Research Division, Environment and Climate Change Canada, Montréal, QC, Canada 2Chemistry Department, Montréal University, Montréal, QC, Canada Accepted August 27, 2019 Abstract Cerium oxide nanoparticles (nCeO) are currently used in many sectors of our economy, for instance as fuel additives and in ceramics for catalytic converters. The issue of the interaction of not only the organic matter content but other properties such as conductivity, pH and suspended matter could complicate the behavior of the nanoparticle and resulting toxicity in commonly found types of surface water. keywords: activity; aquarium; brown; ce(iv; dna; effluent; levels; mussels; nceo; surface; types; water cache: isj-541.pdf plain text: isj-541.txt item: #374 of 465 id: isj-548 author: Cui, X Y; Cheng, J W; Wang, Y; Zhou, B title: Sequence feature and expression profile of a tumor suppressor QM protein gene from hard clam Meretrix meretrix date: 2019-10-14 words: 4616 flesch: 54 summary: Key Words: Innate immunity; Meretrix meretrix; QM protein; Vibrio splendidus Introduction The clam Meretrix meretrix is a crucial commercial marine bivalve in coastal and estuarine areas of south and southeast Asia. To identify the evolutionary conservation of characteristic motifs and active sites of QM proteins, multiple alignment was performed using different QM homologues, including mollusks (C. farreri, P. fucata), arthropods (P. japonicus), fish (D. rerio), and mammals (M. musculus, H. sapiens). keywords: analysis; et al; expression; gene; hepatopancreas; liu; meretrix; mmqm; protein; sequence; wang cache: isj-548.pdf plain text: isj-548.txt item: #375 of 465 id: isj-549 author: Liu, Q; Xu, B; Xiao, T title: HC-SPH: A conserved serine protease homolog of S1 superfamily in the triangle-shell pearl mussel (Hyriopsis cumingii) date: 2019-10-14 words: 6361 flesch: 60 summary: Understanding of the reaction process is particularly important in molluscs because their susceptibility to microbial infection and transmitting diseases (Barcia and Ramos-Martinez, 2008) due to the lack of an adaptive immune system (Wang et al., 2013). Up to date, SPH was identified in many invertebrates and some of which were shown to play roles in different biological processes, including antimicrobial activity from horseshoe crab Tachypleus tridentatus (Kawabata et al., 1996), defense of pathogen challenge in Chinese white shrimp Fenneropenaeus chinensis (Ren et al., 2009,2011), cell adhesion in crayfish Pacifastacus leniusculus (Huang et al., 2000) and the tiger shrimp Penaeus monodon (Liu et al., 2006), and activation of the prophenoloxidase (proPO) system (Kwon et al., 2000; Charoensapsri et al., 2009; Cui et al., mailto:xbht568@126.com 174 2010), which represent an important host natural immune system that recognizes foreign invasive substances by molecular pattern of proteins. keywords: amino; analysis; cdna; et al; expression; fig; gene; hpc; immune; protease; protein; sequence; serine; signal; sites; sph; tissues; wang cache: isj-549.pdf plain text: isj-549.txt item: #376 of 465 id: isj-55 author: Cerkowniak, M; Boguś, M I; k, E Włóa; Stepnowski, P; Gołębiowski, M title: Comparison of the volatile compounds of Dermestes maculatus and Dermestes ater pupae: application of headspace solid-phase microextraction-gas chromatography-mass spectrometry (HS-SPME-GC/MS) date: 2017-08-18 words: 5098 flesch: 60 summary: The major compounds in D. ater pupae were pentacosane (54.3 %), tricosane (9.9 %) and hexadecanoic acid (8.5 %), while the major compounds in D. maculatus pupae were octadecadienoic acid methyl ester (35.5 %), octadecenoic acid methyl ester (26.7 %), hexadecenoic acid methyl ester (8.3 %) and hexadecanoic acid methyl ester (7.8 %). Chemical composition of the volatile compounds found in the pupae of D. maculatus Table 2 lists the volatile compounds identified in D. maculatus pupae. keywords: acid; ater; compounds; d. ater; ester; et al; fatty; gołębiowski; hydrocarbons; larvae; maculatus; methyl; methyl ester; pupae cache: isj-55.pdf plain text: isj-55.txt item: #377 of 465 id: isj-556 author: Özyılmaz, d; Özbek, R; Altuntaş, H; Uçkan, F title: Indole-3-Acetic Acid induced oxidative stress in model host Galleria mellonella L. (Lepidoptera: Pyralidae) and its endoparasitoid Pimpla turionellae (L.) (Hymenoptera: Ichneumonidae) date: 2019-11-04 words: 3656 flesch: 49 summary: In addition, selected last stage G. mellonella larvae treated or untreated with IAA doses were used pupated and provided as host to P. turionellae for parasitoid experiments. The results obtained in the experiments were evaluated as being statistically significant at a 95 % confidence interval with p ≤ 0.05. 186 Table 1 Effects of various doses of IAA on CAT, SOD, GST activities and MDA level in larval hemolymph of G. mellonella Mean ± SE* IAA doses (ppm) CAT SOD GST MDA 0 0.62 ± 0.04a 8.51 ± 0.23a keywords: doses; hemolymph; host; iaa; larvae; mellonella; turionellae cache: isj-556.pdf plain text: isj-556.txt item: #378 of 465 id: isj-557 author: Ballarin, L; Rosani, U; Venier, P title: Third International Symposium AMMR 2019. Advances in Marine Mussel Research, August, 26–28, 2019, Palazzo Grassi, Chioggia, Italy date: 2019-11-19 words: 15887 flesch: 31 summary: Depending on the abundance of mussel spat in nature and the market value of specific mussel species, mussel seed are either collected from the wild or produced in hatcheries accordingly. Mytimap: a tool for making publication quality species distribution maps for Mytilus mussels C Riginos1, J Thia1, A Simon2, P Borsa3, I Popovic1 1School of Biological Sciences, The University of Queensland, St. Lucia, Australia 2Institut des Sciences de l’Évolution, Université de Montpellier, Montpellier, France 3Institut de Recherche pour le Developpement, Montpellier, France Creating maps of mussel species distributions can be tedious and time consuming. keywords: analysis; aquaculture; areas; bivalves; blue; conditions; data; edulis; effects; exposure; expression; food; france; galloprovincialis; gene; hemolymph; host; immune; institute; italy; marine; mussel mytilus; mussels; mytilus; mytilus edulis; mytilus galloprovincialis; native; nps; populations; production; proteins; research; response; results; sciences; species; study; system; temperature; university; water cache: isj-557.pdf plain text: isj-557.txt item: #379 of 465 id: isj-56 author: Ahmadniaye Motlagh, H; Safari, O; Farhangi, M; Lashkarizadeh-Bami, M title: Evolution of the digestive enzymes and bacterial changes of the gastrointestinal tract of the Artemia urmiana during growth period date: 2017-08-19 words: 5343 flesch: 56 summary: Abstract As the digestive enzymes and gastro-intestinal (GI) bacterial community contribute to the health and nutrition of the organism, this study aims to evaluate the ontogeny of bacterial population and digestive enzymes activities in the GI tract of Artemia urmiana from nauplii to the adult stage. count and digestive enzyme activities (lipase r 2 = 0.82; amylase r 2 = 0.79; and protease; r 2 = 0.74). keywords: activities; activity; amylase; aquaculture; artemia; bacteria; digestive; enzymes; lipase; protease; protein; urmiana cache: isj-56.pdf plain text: isj-56.txt item: #380 of 465 id: isj-561 author: Mishra, C S K; Samal, S; Rout, A; Pattanayak, A; Acharya, P title: Evaluating the implications of moisture deprivation on certain biochemical parameters of the earthworm Eudrilus eugeniae with microbial population and exoenzyme activities of the organic substrate date: 2020-01-14 words: 4663 flesch: 53 summary: Barros N, Gomez-Orellana I, Feijóo S, Balsa R. The effect of soil moisture on soil microbial activity studied by microcalorimetry. Below ground ecosystems are expected to be affected by soil moisture which could influence nutrient availability and decomposition rates (Trofymow et al., 2002). keywords: activity; control; day; earthworm; experimental; level; microbial; moisture; reduction; soil; substrate cache: isj-561.pdf plain text: isj-561.txt item: #381 of 465 id: isj-57 author: Kerchev, I A; Kryukova, N A; Kryukov, V Y; Glupov, V V title: Entomoparasitic nematodes Sychnotylenchus sp. (Anguinidae) on the four-eyed fir bark beetle Polygraphus proximus: effects on the host's immunity and its susceptibility to Beauveria bassiana date: 2017-08-30 words: 3704 flesch: 49 summary: Rearing of the bark beetle culture and experimental infection by nematodes Sychnotylenchus sp. on sandwich plates: A) Sychnotylenchus sp. female; B) juvenile stage of nematode from bark beetle hemocel; C) dissection of Polygraphus proximus infected by nematodes; D) piece of fir phloem mounted on glass and sandwich plate prepared for rearing of bark beetles; E) washed eggs of bark beetle in the phloem incision. Nematodes from the genus Sychnotylenchus are always associated with bark beetles and their ___________________________________________________________________________ keywords: activity; bark; beetles; fir; host; immune; infection; nematode; proximus; sychnotylenchus cache: isj-57.pdf plain text: isj-57.txt item: #382 of 465 id: isj-576 author: Grimaldi, A; de Eguileor, M A; Tettamanti, G; Valvassori, R; Baranzini, N; Bruno, D; Montali, A; Pulze, L title: XXIst scientific meeting of the Italian Association of Developmental and Comparative Immunobiology (IADCI), 12 - 14 February 2020, Department of Biotechnology and Life sciences (DBSV), University of Insubria, Varese, Italy date: 2020-02-28 words: 11550 flesch: 27 summary: It is largely unexplored how immune system reacts against AgNPs, albeit those particles can be effectively recognized and engulfed by innate immune cells. Hemocyte depletion as a tool for studying immune cell dynamics and contribution to fundamental biological processes in the freshwater snail Pomacea canaliculata G Bergamini1, A Accorsi2, D Malagoli3 1Department of Chemical and Geological Sciences- Department of Life Sciences, University of Modena and Reggio Emilia, Modena, Italy 2Stowers Institute for Medical Research, Howard Hughes Medical Institute, Kansas City (MO), USA 3Department of Life Sciences, University of Modena and Reggio Emilia, Modena, Italy Pomacea canaliculata is an invasive freshwater gastropod native to South America which spread all over Asia, with severe consequences on ecosystems and public health. keywords: activity; analysis; antarctic; biology; cells; data; department; effects; evolution; expression; fish; gene; immune; innate; insubria; italy; life; new; nps; padua; peptide; research; response; role; sciences; species; stress; study; system; trieste; university; varese cache: isj-576.pdf plain text: isj-576.txt item: #383 of 465 id: isj-577 author: Varela Coelho, A; Herrera, F; Blanchoud, S; Leandro, S M title: 2nd workshop of the COST Action 16203 MARISTEM: OMIC APPROACHES TO IDENTIFY AND CHARACTERIZE MARINE/AQUATIC INVERTEBRATE STEM CELLS, Escola Superior de Turismo e Tecnologia do Mar, Peniche, Portugal date: 2020-03-02 words: 5439 flesch: 29 summary: Here, we highlight B. schlosseri potential for the study of stem cells in asexual reproduction and regeneration. Stem cells are, therefore, essential for asexual development. keywords: biology; body; botryllus; cells; development; genes; marine; model; portugal; regeneration; research; schlosseri; species; stem; study; university cache: isj-577.pdf plain text: isj-577.txt item: #384 of 465 id: isj-58 author: Liu, X; Li, J; Wang, Q; Xia, H; Chen, K title: Functional analysis of hemolin gene from silkworm, Bombyx mori - immune and development date: 2017-08-31 words: 6421 flesch: 57 summary: The final immunoprecipitates were subjected to Western blot analysis using anti-BmHemolin poly- clonal antiserum to detect BmHemolin protein in co-precipitates. 4 Western blot analysis for the expression of BmHemolin protein from stimulants challenged midgut at larval stage. keywords: anti; bmhemolin; bmyippee; cell; development; expression; gene; hemolin; injection; pair; protein; silkworm; sirna; wing cache: isj-58.pdf plain text: isj-58.txt item: #385 of 465 id: isj-580 author: Karahan, A title: 3rd general meeting and working group meetings of the COST Action 16203: STEM CELLS OF MARINE/AQUATIC INVERTEBRATES: FROM BASIC RESEARCH TO INNOVATIVE APPLICATIONS (MARISTEM), December 3, 2019, METU-Culture and Convention Center (METU-CCC), METU-Ankara, T date: 2020-03-10 words: 2462 flesch: 36 summary: Crosstalk between stem cells and differentiated tissues in planarians G Gambino, L Rossi, A Salvetti Department of Clinical and Experimental Medicine, University of Pisa, Pisa, Italy Stem cell fate depends on surrounding microenvironment, the so called niche. The appearance of stem cell systems should be studied from the simplest Metazoa. keywords: aging; cell; jellagen; level; marine; meats; organisms; regeneration; stem; university cache: isj-580.pdf plain text: isj-580.txt item: #386 of 465 id: isj-59 author: Lu, G; Wang, F; Yu, Z; Lu, M; Wang, Y; Liu, C; Xue, Z; Wu, Y; Wang, L; Song, L title: Bacterial communities in gills and intestines of yesso scallop (Patinopecten yessoensis) and its habitat waters in Changhai (Dalian, China) date: 2017-09-05 words: 7122 flesch: 56 summary: In the present study, Proteobacteria was found to be the dominant phyla in the organs of Yesso scallop and its habitat waters, which was consistent with previous reports (Wu et al., 2012; Zhang et al., 2016). The symbiotic microbiota and habitat environment have been recognized as the most important factors impacting on the fitness of aquatic animals (Li et al., 2007b; Liu et al., 2011;Yan et al., 2012; Ye et al., 2013). keywords: abundance; bacterial; china; communities; community; diversity; et al; fig; fragilis; gills; habitat; intestine; microbiota; rectum; samples; scallop; total; waters; yesso cache: isj-59.pdf plain text: isj-59.txt item: #387 of 465 id: isj-591 author: Han, S Y; Wang, L; Wang, Y L; Chen, Y; Wang, B J; Wang, M Q; Lin, J title: Effects of the glutathione administration via dietary on intestinal microbiota of white shrimp, Penaeus vannamei, under cyclic hypoxia conditions date: 2020-05-04 words: 7280 flesch: 56 summary: The short reads that overlapped were assembled with FLASH (Edgar, 2013), and the poor-quality assembled reads were filtered with Quantitative Insights Into Microbial Ecology (QIIME) (Wang et al., 2007). Histology assays of the intestines After the 28-day experiment, the intestinal villi and the lamina propria of N shrimp were arranged regularly. keywords: abundance; bacteria; csmh; csmh.gsh150; et al; fig; group; growth; gsh; intestine; javascript; kg−1; l−1; ros; shrimp; survival; vannamei cache: isj-591.pdf plain text: isj-591.txt item: #388 of 465 id: isj-593 author: Tokmakova, A S; Serebryakova, M K; Prokhorova, E E; Ataev, G L title: Study of the proliferative activity of hemolymph cells in pulmonate molluscs date: 2020-05-14 words: 5567 flesch: 57 summary: 63 ISJ 17: 63-74, 2020 ISSN 1824-307X RESEARCH REPORT Study of the proliferative activity of hemolymph cells in pulmonate molluscs AS Tokmakova1, MK Serebryakova2, EE Prokhorova1, GL Ataev1* 1Laboratory of Experimental zoology, Department of Zoology, Faculty of Biology, Herzen State Pedagogical University of Russia, St. Petersburg, Russia 2Department of Immunology, Institute of Experimental Medicine, St. Petersburg, Russia (2019) successfully used it to determine proliferative activity of hemolymph cells in molluscs 64 Fig. keywords: analysis; cells; corneus; edu; et al; fig; glabrata; hemocytes; hemolymph; molluscs; planorbis; snails; stagnalis cache: isj-593.pdf plain text: isj-593.txt item: #389 of 465 id: isj-595 author: André, C; Vaudreuil, M A; Vo Duy, S; Sauvé, S; Gagné, F title: Long-term and comparative impacts of combined sewers and municipal effluents to freshwater mussels date: 2020-05-19 words: 9276 flesch: 49 summary: The levels of Sugars Lipids Proteins UPS OVFL1 OVFL2 DOWNS Sites 0 1 2 3 N o rm a li z e d v a lu e ( u p s tr e a m ) * * Fig. 3 Energy reserves in mussel gonad tissues. A group of 10 mussels per site and surface waters (4L) at the time of cage retrieval were retained for chemical analysis of surface waters and mussel tissues using high performance liquid chromatography mass spectrometry (Boisvert et al., 2012; Darwano et al., 2014). keywords: air; analysis; data; digestive; dna; downstream; effects; effluent; gland; gonad; gst; levels; mussels; overflows; proteins; rainfall; site; tissues; total; upstream; water; weight cache: isj-595.pdf plain text: isj-595.txt item: #390 of 465 id: isj-598 author: Baranzini, N; Pulze, L; Acquati, F; Grimaldi, A title: Hirudo verbana as an alternative model to dissect the relationship between innate immunity and regeneration date: 2020-05-25 words: 7259 flesch: 50 summary: Subsequently, several AIF-1- like factors showing both a highly conserved aminoacid sequence and a well preserved functional role have been identified in other vertebrate species (Deininger et al., 2000; Watano et al., 2001; Mentshel et al., 2002; Autieri and Chen, 2005) and in several invertebrates, including the genus Hirudineae (Kruse et al., 1999; De Zoysa et al., 2010; Zhang et al., 2011; Ovando et al., 2012; Li et al., 2013; Drago et al., 2014; Schorn et al., 2015b). et al. Allograft inflammatory factor-1 augments production of interleukin-6, -10 and -12 by a mouse macrophage line. keywords: allograft; baranzini; cd45; cell; et al; expression; grimaldi; healing; immunol; inflammatory; innate; leech; macrophages; processes; regeneration; response; rnaset2; role; tettamanti; tissue; wound cache: isj-598.pdf plain text: isj-598.txt item: #391 of 465 id: isj-599 author: Zibaee, A; Malagoli, D title: The potential immune alterations in insect pests and pollinators after insecticide exposure in agroecosystem‎ date: 2020-05-25 words: 6844 flesch: 48 summary: A loss of almost 78 % of fruit production, 54 % of vegetables and 32 % of cereals is estimated in absence of pesticides (Liu et al., 2002; Cai, 2008; Zhang et al., 2011; Zhang, 2018). Besides the most relevant and known effects, chemical insecticides may also cause widespread discrepancies on intermediary metabolism and immunity of insects (Zibaee and Bandani, 2010; Zibaee et al., 2011; Zibaee et al., 2012; Mirhaghparast et al., 2015a, b; Mirhaghparast et al., 2016). keywords: activity; azadirachtin; control; effects; et al; hemocyte; iis; imidacloprid; immune; insect; insecticides; larvae; lepidoptera; number; physiol; response; system; total; zibaee cache: isj-599.pdf plain text: isj-599.txt item: #392 of 465 id: isj-60 author: Gagné, F; André, C; Pilote, M; Turcotte, P; Gagnon, C title: Toxicological properties of a major release of untreated wastewaters into the St. Lawrence River to quagga mussels Dreissena bugensis date: 2017-09-19 words: 6611 flesch: 57 summary: Key Words: quagga mussels; untreated wastewater; cytochrome P4501A activity; oxidative damage; DNA damage; energy expenses Introduction In November 2015, the City of Montreal (Quebec, Canada) had to release billions of litres of untreated wastewaters from its sewage system’s southeast interceptor in order to empty it before upgrading the interceptor and a snow collection chute. The biomarker data were analyzed using discriminant and factorial analysis to determine differences in the toxicity profile of untreated waters collected at increasing distance from downtown. keywords: activity; control; distance; dna; downtown; levels; mussels; river; wastewaters; water cache: isj-60.pdf plain text: isj-60.txt item: #393 of 465 id: isj-600 author: Wang, Y; Wang, B J; Liu, M; Jiang, K Y; Wang, M Q; Wang, L title: The first identification of a C-type lectin gene (CqCTL) in Cherax quadricarinatus: sequence features and expression profiles date: 2020-05-25 words: 4806 flesch: 57 summary: Result Cloning and characterization of CqCTL cDNA The full-length cDNA sequence of CqCTL was obtained by RACE and submitted to GenBank under the accession No. MN944107. Quantification analysis of CqCTL mRNA expression The mRNA expression quantities of CqCTL in different tissues were checked by the qPCR technique. keywords: amino; cdna; china; cqctl; ctls; et al; expression; gene; immune; innate; lectin; quadricarinatus; race; sequence; type; wang cache: isj-600.pdf plain text: isj-600.txt item: #394 of 465 id: isj-605 author: Samal, S; Mishra, C S K; Sahoo, S title: Dermal, histological anomalies with variations in enzyme activities of the earthworms Lampito mauritii and Drawida willsi after short term exposure to organophosphate pesticides date: 2020-06-12 words: 6135 flesch: 52 summary: Gobi M, Gunasekaran P. Effect of butachlor herbicide on earthworm Eisenia fetida-its histological perspicuity. Depleted AChE activity is impaired with altered neural conduction in earthworms due to pesticide toxicity (Patnaik and Dash, 1992; Pradhan and Mishra, 1998; Reddy and Rao, 2008; Samal et al., 2017; Nayak et al., 2018; Samal et al., 2019a). keywords: activity; concentration; earthworms; environ; et al; exposure; fig; glyphosate; low; mauritii; monocrotophos; muscle; protein; region; soil; willsi cache: isj-605.pdf plain text: isj-605.txt item: #395 of 465 id: isj-609 author: Benatti, C; Rivi, V; Colliva, C; Radighieri, G; Tascedda, F; Blom, J M C title: Redefining operant conditioning of escape behaviour in Lymnaea stagnalis date: 2020-06-29 words: 5797 flesch: 55 summary: Key Words: associative learning; memory; behaviour; pond snails; aging Introduction Escape behaviour is the result of a complex integration of information from sensory systems, internal states and expectations arising from experience and prior beliefs (Evans et al., 2019). Experiments on pond snails are not subject to the approval of our ethics committee. keywords: day; escape; kcl; session; snails; test; training cache: isj-609.pdf plain text: isj-609.txt item: #396 of 465 id: isj-610 author: Dang, H F; Han, X; Guo, Y; Li, Q; Ye, S G; Liu, J; Li, R J title: Expression profiles of immune-related genes in coelomocytes during regeneration after evisceration in Apostichopus japonicus date: 2020-06-29 words: 6107 flesch: 51 summary: (Zhou et al., 2011), Myeloid differentiation factor 88 (MYD88) (Lu et al., 2013b), NF-κB (Wang et al., 2013), NF-κB inhibitor (IKB) (Lu, et al., 2013), TNF receptor-associated factor 6 (TRAF6) (Lu et al., 2013a), Peroxiredoxins (PRX) (Wang et al., 2011), Nitric oxide synthase (NOS) (Shao et al., 2016), Caspase-2 (CASP-2) (Ye et al., 2016), Phenoloxidase (PO) (Jiang et al., 2014), Glutathione peroxidase (GPX) (Wang et al., 2011b ), Heat shock protein 70 (Li et al., 2018) and other immune-related factors are reported to be involved in response and removal of invading pathogens. Primer sequences (from 5′ to 3′) References Pattern recognition receptors (PRRs) Toll-like receptor JQ743247 F: ACGAAAGCGATTTAGCC R: GAGCCCGTGGTGAGATG Jiang et al., 2018 Myeloid differentiation factor 88 KF032818.1 F: GGAAACGAGAGGAGGAGAGACG R: TCCAGACAGTAGCAGACGAAAGC Lu et al., 2013 TNF receptor-associated factor 6 KF032819.1 F: AGGAGCGGGAAAGGAAGCAG R: TAGCCGTAGAGCGCCGTGTAG Lu et al., 2013 NF-κB JF828765.1 F: TGAAGGTGGTATGCGTCTGG R: TTGGGCTGCTCGGTTATG Li et al., 2018 IKB KF032816 F: ACAGGAGTCGTTTGATGATTGG R: GTTTCTTCTTGTGTTTGGCGTTC Lu et al.,2013 Complement 3 HQ214156 F: GCGTTGTTTCGTTCAACAAGGGGA R: GCCATTCACTGGAGGTGTGGCA Jiang et al., 2018 Cytochrome B 7802877 F: TGAGCCGCAACAGTAATC R: AAGGGAAAAGGAAGTGAAAG Wang et al.,2016 Enzymes Phenoloxidase KF040052 F: CAGCAGTTACAAGTGGGATG R: CCAGTCACGAAGACCAGAAT Jiang et al.,2014 Cu/Zn superoxide dismutase JX097096 F: TCGGGCACTATTACCTTC R: ACCATTATCATCGGCTTC Jiang et al., 2018 Catalase JQ776634 F: CTCCCAACTACTTCCCAAAC R: GTCCGACAAGACCTCACG Jiang et al., 2018 C-type lysozyme KF773759 F: GTACCACGGAGCAGGAGT R: CACAGACAAGCGGAGACC Jiang et al., 2018 Cathepsin D JF430592 F: CTCCCAACTACTTCCCAAAC R: GTCCGACAAGACCTCACG Jiang et al., 2018 Glutathione peroxidase JF769857 F: GGATGTGTGTGTCTAGTGGTGAA R: GAATTACTCCCAGGTTCCTGACT Wang et al., 2011 Nitric oxide synthase KT366016.1 F: TTGGGCTGCTCGGTTATG R: TGATGCAAGAGACTGCTGGA Li et al., 2018 Peroxiredoxins JF769853 F: TATTCACTCCTGGCTGCTCTAAG R: TGTGAAGTCACAGCAGGTATCAG Wang et al., 2011 Other immune-related factors Caspase 2 KC972624 F: CAAGTTCCACACGACACAGG R: GCAGTCTTTGTTCGTTCCGT Li et al., 2018 Heat shock protein 70 EU930813.1 F: GCCGCATCCCTTGTAAGAAG R: AGTTCAAATTGACCGAGGCG Li et al., 2018 Melanotransferrin HQ260578 F: GGTGGGTGATGCCTGTTG R: AGCTGAGGTGGGTTCGTT Jiang et al., 2018 C-type lectin HQ728281 F: TCGGATCTAACTTGGACG R: TTACCCTGCGAATGACTT Jiang et al., 2018 http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=search&db=nucleotide&doptcmdl=genbank&term=KC972624 140 Materials and methods Experimental animals and sampling Healthy Apostichopus japonicus (55 ± 10.2 g, mean ± SD) were collected from a local aquatic farm (Dalian, Liaoning Province, China) and acclimated in an indoor aquarium with well-aerated sea water at 17 - 19 °C for 1 week before experiments. keywords: coelomocytes; control; cucumber; dpe; et al; evisceration; expression; factors; group; hpe; immune; regeneration; sea; wang cache: isj-610.pdf plain text: isj-610.txt item: #397 of 465 id: isj-612 author: Al Mutawa, M Y; Ayaad, T H; Shaurub, E H title: Hemocyte profile, phagocytosis, and antibacterial activity in response to immune challenge of the date fruit stalk borer, Oryctes elegans date: 2020-07-19 words: 7588 flesch: 53 summary: For instance, hemocytes counts have been conducted, and phagocytosis (Manachini et al., 2011) and antibacterial activity have been reported (Mazza et al., 2011; Mastore et al., 2015; Sewify et al., 2017). In agreement with our results, the antibacterial activity of hemolymph of R. ferrugineus and the coconut palm rhinoceros beetle, Oryctes rhinoceros (L.) (Coleoptera: Scarabaeidae), against the same tested bacteria has also been reported (Mazza et al., 2011; Rabeeth et al., 2012; Mastore et al., 2015). keywords: activity; agar; df =; elegans; et al; fig; hemocyte; injection; insect; larvae; lps; post; protein; t = cache: isj-612.pdf plain text: isj-612.txt item: #398 of 465 id: isj-623 author: Sun, L; Gao, L; Zhu, F; Lü, P; Li, C; Yuan, Y; Chen, K title: Discovery and functional analysis of a new gene (Bm123) in silkworm (Bombyx mori) date: 2020-09-02 words: 7060 flesch: 56 summary: The reaction process of Bm123 gene expression by Northern blot Composition Dosage Bm123 PCR amplified fragment 50 ng Random primer (0.2 μg/μL) 4 μL Sterilized water Add to 10 μL Incubate at 70 °C for 5 min, quickly place on ice dNTP mix (2.5 mM each) 2 μL Bovine serum albumin (BSA) (10 mg/mL) 2 μL 10×buffer 2 μL Klenow enzyme (5 u/μL) 1 μL α-32P-dCTP 1 μL Sterilized water Add to 20 μL Incubation was done at 37 °C for 1 h. silkworm can inactivate BmNPV (Hayashiya, 1978). Identification of Bm123 gene expression using Northern blot A random primer method was used to synthesize the silkworm Bm123 specific probe and α-32P-dCTP purchased from Beijing Furui Corporation, China. keywords: analysis; bc10; bm123; bmnpv; bombyx; et al; expression; fig; gene; level; midgut; mori; protein; resistance; silkworm; strain cache: isj-623.pdf plain text: isj-623.txt item: #399 of 465 id: isj-624 author: Ebrahimi, M; Ajamhassani, M title: Investigating the effect of starvation and various nutritional types on the hemocytic profile and phenoloxidase activity in the Indian meal moth Plodia interpunctella (Hübner) (Lepidoptera: Pyralidae) date: 2020-09-07 words: 6457 flesch: 58 summary: These larvae also had a more melanized cuticle, and thus nutrition was also effective as a key factor in the melanization (Lee et al., 2008). Hemocytes were observed under a light microscope (Olympus BH2) at 40 X magnification (Ghasemi et al., 2013). keywords: activity; count; diet; effect; et al; hemocyte; hemolymph; immune; immunity; insect; interpunctella; larvae; moth; number; phenoloxidase; starvation cache: isj-624.pdf plain text: isj-624.txt item: #400 of 465 id: isj-63 author: Cheng, S; Chang, Y; Wang, Y; Li, G; Chen, Y; Ning, J; Li, K title: Molecular cloning and functional characterization of a calreticulin gene from the sea cucumber Apostichopus japonicus date: 2017-09-18 words: 6438 flesch: 59 summary: Calreticulin (CRT) is a highly conserved protein that modulates calcium binding to proteins and storage (Wang et al., 2012; Zhang et al., 2014). Some of these genes (Wang et al., 2011, 2015a, b; Lu et al., 2013; Sun et al., 2013; Ji et al., 2014; Jiang et al., 2014; Zhang et al., 2015; Shao et al., 2015a, b, 2016; Yang et al., 2015, 2016; Lv et al., 2016) are listed in this study. keywords: ajcrt; apostichopus; binding; cucumber; et al; expression; gene; immunol; intracellular; japonicus; protein; sea; wang; zhang cache: isj-63.pdf plain text: isj-63.txt item: #401 of 465 id: isj-634 author: Li, D; Chen, X; Zhu, F; Chen, K title: Insulin-like peptides in model insects date: 2020-09-30 words: 7589 flesch: 65 summary: These ILPs were found primarily expressed in the nervous system, and differs in disulfide bond arrangement (Matsunaga et al., 2017; Zheng et al., 2018). Among them, 32 bombyxin genes have been successfully cloned, and based on their sequence similarities, have been divided into 7 families, namely families A-G (Ingvarsson et al., 1988; Ikuyo et al., 1997; Tsuzuki et al., 1997; Iwami et al., 2008; Iwami et al., 1990; Kawakami et al., 1989; Kondo et al., 1996). keywords: biol; bombyxin; brain; cells; chain; et al; expression; gene; growth; ilps; insect; insulin; like; mori; peptide; protein cache: isj-634.pdf plain text: isj-634.txt item: #402 of 465 id: isj-638 author: Jerónimo-Juárez, J R; Matadamas-Guzman, M L; Guerrero Legarreta, I; Segoviano-Ramírez, J C; del Rocío Zarate-Hernández, M; Arteaga-Silva, M; Guzmán-García, X title: Tissue biomarkers as vulnerability indicators in the clam Polymesoda caroliniana date: 2020-10-28 words: 7962 flesch: 44 summary: The gills, digestive gland, and foot constitute the preferred organs to evaluate this (Moraga et al., 2005; Usheva et al., 2006; Boscolo Papo et al., 2014a; Cuevas et al., 2015). Histopathological and 187 immunohistochemical analyses evaluate the effects of environmental stress at the tissue level (Costa et al., 2013; Cuevas et al., 2015). keywords: alterations; biomarkers; capacity; clams; control; digestive; environment; et al; exposure; group; health; level; organisms; prevalence; recovery; sensitivity; stress; tecolutla; vulnerability cache: isj-638.pdf plain text: isj-638.txt item: #403 of 465 id: isj-64 author: Kwizera, V; Susurluk, I A title: Evaluation of the effects of some insecticides based on neonicotinoids on entomopathogenic nematodes, Steinernema feltiae and S. carpocapsae date: 2017-09-21 words: 1955 flesch: 58 summary: Despite their side effects on bees and other beneficial insects, there are some researches showing synergism of neonicotinoid insecticides with EPNs (Pisa et al, 2014). Neonicotinoids ere today recognized as the first bee killer (Jennifer et al., 2012). keywords: control; effects; epns; imidacloprid; insecticides cache: isj-64.pdf plain text: isj-64.txt item: #404 of 465 id: isj-644 author: Jerónimo-Juárez, J R; Matadamas-Guzman, ML; Guerrero Legarreta, I; Segoviano-Ramírez, J C; del Rocío Zarate-Hernández, M; Arteaga-Silva, M; Guzmán-García, X title: Erratum to: Tissue biomarkers as vulnerability indicators in the clam Polymesoda caroliniana [17: 186-197, 2020] date: 2020-12-04 words: 311 flesch: 23 summary: en Energía y Medio Ambiente, Universidad Autónoma Metropolitana, 09340, Ciudad de México, México 2Doctorado en Ciencias Biomédicas, UNAM, Ciudad de México, México 3Departamento de Biotecnología, Universidad Autónoma Metropolitana, Unidad Iztapalapa, 09340, Ciudad de México, México 4Unidad de Bioimagen, Centro de Investigación y Desarrollo en Ciencias de la Salud, Universidad Autónoma de Nuevo León, Monterrey, Nuevo León, México 5Laboratorio de Peces, Departamento de Biología, Universidad Autónoma Metropolitana, 09340, Ciudad de México, México 6Laboratorio de Neuroendocrinología Reproductiva, Departamento de Biología de la Reproducción, Universidad Autónoma Metropolitana, 09340, Ciudad de México, México 7Departamento de Hidrobiología, Laboratorio de Ecotoxicología, Universidad Autónoma Metropolitana, Unidad Iztapalapa, 09340, Ciudad de México, México In the above article Table 2 was reproduced incorrectly, the table and caption should have appeared as below: Table 2 Relations between the prevalence of histopathological alterations and level of exposure. Corresponding author: Xochitl Guzmán-García Universidad Autónoma Metropolitana, Unidad Iztapalapa San Rafael Atlixco 186, Vicentina, C.P. 09340, Iztapalapa, Ciudad de México, México E-mail: xgg@xanum.uam.mx keywords: méxico cache: isj-644.pdf plain text: isj-644.txt item: #405 of 465 id: isj-649 author: Wang , L; Chen , H; Qiu , L; Wang, L; Song, L title: A putative insulin receptor involved in immune response of Chinese mitten crab Eriocheir sinensis date: 2021-01-14 words: 4016 flesch: 48 summary: The binding of insulin to its receptor initiates a cascade of intracellular signal transduction, including autophosphorylation of tyrosine kinase domain and the interaction of multiple molecules with insulin receptor. Corresponding author: Linsheng Song Key Laboratory of Experimental Marine Biology Institute of Oceanology, Chinese Academy of Sciences Qingdao 266071 E-mail: lshsong@dlou.edu.cn receptor substrates (IRSs), which are protein substrates of the intrinsic tyrosine kinase activity of insulin receptor, transmitting the signal to downstream cascades (Taniguchi et al., 2006). keywords: domain; esir; expression; fig; hepatopancreas; insulin; mrna; protein; receptor; signaling; sinensis cache: isj-649.pdf plain text: isj-649.txt item: #406 of 465 id: isj-65 author: Beer Ljubić, B; Čolak, S; Aladrović, J; Strunjak-Perović, I; Topić Popović, N; Vranković, L; Čož-Rakovac, R title: Oxidative stability of the hemolymph in different crustacean species date: 2017-09-25 words: 4987 flesch: 54 summary: Lipid content of hemolymph supernatant The highest values of cholesterol and triacylglycerols concentration were found in the hemolymph supernatant of M. squinado and these values were significantly higher than those determined in E. verrucosa and P. elephas (p < 0.05; Table 2). GSH-Px activity was expressed in U/L and SOD activity was presented in U/mL of hemolymph supernatant. keywords: activity; cholesterol; concentration; elephas; hemolymph; pon; sea; species; squinado; supernatant; triacylglycerols; verrucosa cache: isj-65.pdf plain text: isj-65.txt item: #407 of 465 id: isj-650 author: Cannavacciuolo, A; Chiarore, A; Munari, M title: A cold bath for a formalin-free laboratory: alternative fixative methods in early developmental stages of the sea urchin Paracentrotus lividus (Lamarck, 1816) date: 2021-01-15 words: 4831 flesch: 57 summary: Before the fertilization, both sperms and eggs were checked for anomalies with an optic microscope (Chiarore et al., 2020). Formalin is also used to fix vegetal tissues of seaweeds (Falace et al., 2005; Pinna et al., 2020) and seagrasses (Vasapollo and Gambi, 2012). keywords: et al; fixation; fixatives; formalin; fsw; larvae; method; nv nv; sea cache: isj-650.pdf plain text: isj-650.txt item: #408 of 465 id: isj-651 author: Bortoletto, E; Venier, P; Figueras , A; Novoa , B; Rosani, U title: Evolutionary insights on a novel mussel-specific foot protein-3 gene family date: 2021-01-20 words: 7848 flesch: 60 summary: Basically, we considered 14 bivalve genomes sequenced up to now, including Argopecten irradians (Liu et al., 2020), Bathymodiolus platifrons (Sun et al., 2017), Crassostrea gigas (Zhang et al., 2012), Crassostrea virginica (Gómez-Chiarri et al., 2015), Dreissena polymorpha (McCartney et al., 2019), Limnoperna fortunei (Uliano-Silva et al., 2018), Mizuhopecten yessoensis (Wang et al., 2017), Modiolus philippinarum (Sun et al., 2017), 1 Phylogenetic tree representing main orders of Bivalvia (based on González et al., 2015; Combosch et al., 2017; Lee et al., 2019). keywords: alignment; biol; bivalve; byssus; data; edulis; et al; exon; expression; foot; fp-3α; fp-3α genes; galloprovincialis; genes; genome; introns; mussel; mytilus; peptide; proteins; rna; sequences; species; structure; trossulus; viridis; waite; zhang cache: isj-651.pdf plain text: isj-651.txt item: #409 of 465 id: isj-657 author: Auclair, J; Turcotte, P; Gagnon, C; Gagné, C title: The influence of surface waters on the bioavailability and toxicity of copper oxide nanoparticles to freshwater mussels date: 2021-02-17 words: 9809 flesch: 47 summary: The influence of surface water types (aquarium, green, brown and 10 % effluent) and Cu forms (nCuO and Cu (II)) were examined using 2-way factorial analysis of variance. Significant from MilliQ water; 2. Significant compared to 1h 37 A qu ar iu m nC uO aq ua C u( II) aq ua G re en nC uO gr ee n C u( II) gr ee n B ro w n nC uO B ro w n C u( II) B ro w n E ffl ue nt nC uO E ff C u( II) E ff Conditions (ug/L) 0,0 0,5 1,0 1,5 C u ( u g /g ) * * * * * Fig. 1 Cu levels in mussels exposed to Cu forms and surface water types. keywords: activity; aquarium; b b; brown; c u; effluent; forms; green; levels; matter; mussels; nanoparticles; ncuo; surface; types; water cache: isj-657.pdf plain text: isj-657.txt item: #410 of 465 id: isj-658 author: Zhang, C; Yu, Z; Xue, Z; Li, H; Zhu, J; Wang, L; Song, L title: The temporal dynamics of bacteria in the coelomic fluid of sea cucumber Apostichopus japonicus after evisceration date: 2021-02-24 words: 5833 flesch: 51 summary: Increasing evidences indicate the important roles of microbiota in organ regeneration of animals (Zhang et al., 2020; Stedman et al., 2016; Khosravi et al., 2014; Arnold et al., 2016; Zhang et al., 2019; Wang et al., 2018). The results were consistent with previous report on the bacterial community in intestine of A. japonicus that the intestinal bacterial community varied significantly and tended to be stable when the regeneration was accomplished (Zhang et al., 2019). keywords: bacterial; coelomic; community; cucumber; dpe; et al; evisceration; fig; fluid; japonicus; regeneration; sea; time; zhang cache: isj-658.pdf plain text: isj-658.txt item: #411 of 465 id: isj-66 author: Yang, Y; Chen, L; Tang, Q; Zhang, Y; Tang, H; Lü, P; Yao, Q; Chen, K title: Comparative proteomic analysis reveals that juvenile hormone binding protein and adenylate kinase may be involved in the molting process of silkworm, Bombyx mori date: 2017-10-13 words: 6984 flesch: 56 summary: , these 35 proteins can be divided into the following nine categories: cell structure proteins, metabolism-related proteins, disease/defense-related proteins, transporter, transcription, molecular chaperone, secondary metabolism, protein synthesis, and unknown function proteins (Fig. 4). Following the Ye’s method (Ye et al., 2006), the annotation information of identified proteins was gathered and then uploaded as Web Gene Ontology Annotation Plot (WEGO) keywords: analysis; atp; binding; cell; et al; fig; hormone; juvenile; metabolism; molting; precursor; protein; silkworm; spot; structure; subunit cache: isj-66.pdf plain text: isj-66.txt item: #412 of 465 id: isj-668 author: Sun, Q; Zheng, Y; Chen, X; Kong, N; Wang, Y; Zhang, Y; Zong, Y; Liu, Z; Wang, L; Song, L title: A diet rich in diatom improves the antibacterial capacity of Pacific oyster Crassostrea gigas by enhancing norepinephrine-regulated immunomodulation date: 2021-04-14 words: 6440 flesch: 53 summary: After the oysters were fed with a diet rich in diatom for 21 and 40 d, the NE contents in oyster serum, as well as the mRNA expression of CgMAO in oyster haemocytes, increased significantly compared with control group. Our previous research demonstrated that NE could regulate the antibacterial activity mediated by oyster haemocytes by binding to the transmembrane receptor CgA1AR-1, and up-regulate the activity of SOD and LYZ in oyster serum (Liu et al., 2016b). keywords: activity; cgmao; control; diatom; dinoflagellate; dominant; et al; expression; gigas; group; immune; microalgae; mrna; oyster; serum; wang cache: isj-668.pdf plain text: isj-668.txt item: #413 of 465 id: isj-67 author: Wang, M Q; Wang, B J; Jiang, Ke Y; Liu, M; Han, Si Y; Wang, L title: Molecular characterization and transcriptional analysis of a crustacean heat shock protein 10 gene in shrimp Litopenaeus vannamei date: 2017-10-20 words: 5428 flesch: 59 summary: The hepatopancreas was considered as the main immune related organ in mollusks and crustaceans (Liu et al., 2009; Song et al., 2015), hemocytes are the major immune cells and respond to invaders mainly through phagocytosis (Canesi et al., 2002), gill has been reported as the first defense line against invading pathogens in lower animals (Ellis, 2001), while intestine was observed to be involve in immune responses with hepatopancreas via the ‘liver-gut axis’ (Chang et al., 2012). And relatively little of gene information regarding HSP10 has been obtained from marine animals, such as Apostichopus japonicas (Xu et al., 2014), Lutjanus sanguineus (Zhang et al., 2011), Oryzias latipes (Hirayama et al., 2006), Penaeus monodon (Shi et al., 2016), Salmo salar (Andreassen et al., 2009), Scylla paramamosain (Ding et al., 2013) and Xenopus tropicalis (Klein et al., 2002). keywords: challenge; et al; expression; fold; hepatopancreas; level; lvhsp10; mrna; pcr; post; protein; shrimp; stimulation; wang; white cache: isj-67.pdf plain text: isj-67.txt item: #414 of 465 id: isj-68 author: Cheng, S; Chen, Y; Chang, Y; Li, K; Zhang, X; Shang, S; Li, G; Li, L title: Cloning and expression analysis of a stomatin gene from the sea cucumber Apostichopus japonicas date: 2017-10-25 words: 4835 flesch: 55 summary: 3 3D structure prediction of AjSto protein (A) and mouse stomatin protein (B). The secondary structure and three dimensional (3D) structure of AjSto protein were predicted using PSIPRED v3.3 software (http://bioinf.cs.ucl.ac.uk/psipred/) and the SwissModel Workspace (https://swissmodel.expasy.org/) which was evaluated by Swiss-PdbViewer (version 4.1). keywords: ajsto; analysis; apostichopus; cucumber; domain; et al; expression; gene; japonicus; protein; sea; stomatin cache: isj-68.pdf plain text: isj-68.txt item: #415 of 465 id: isj-681 author: Sivaprasad, V; Satish, L; Mallikarjuna, G; Chandrakanth , N; Mary Josepha, A V; Moorthy, S M title: A Field-Friendly Loop-Mediated Isothermal Amplification (FF-LAMP) method for rapid detection of Nosema bombycis in silkworm, Bombyx mori date: 2021-06-21 words: 5108 flesch: 55 summary: Results revealed that the primers were specific to N. bombycis DNA. The loci of each LAMP primer in the small ribosomal subunit of N. bombycis DNA (Accession No.AY259631) are shown in Fig. keywords: amplification; assay; bombycis; detection; dna; lamp; method; pcr; pebrine; silkworm cache: isj-681.pdf plain text: isj-681.txt item: #416 of 465 id: isj-682 author: Afraze, Z; Sendi, J J title: Immunological and oxidative responses of the lesser mulberry pyralid, Glyphodes pyloalis by an aqueous extract of Artemisia annua L. date: 2021-06-24 words: 7844 flesch: 65 summary: Decreased insect hemocytes count can be due to the antimitotic effects of plant extracts (Huang et al., 2011). Artemisia anuua, also known as sweet wormwood or annual wormwood, is a medicinal plant in many parts of the world and is now of great economic importance due to its biological activity against various pests (Khosravi et al., 2011; Seixas et al., 2018; Liu et al., 2019; Oftadeh et al., 2021). keywords: activity; annua; antioxidant; artemisia; biochem; control; effect; enzymes; et al; extract; hemocytes; immune; insect; larvae; lepidoptera; mulberry; plant; pyloalis cache: isj-682.pdf plain text: isj-682.txt item: #417 of 465 id: isj-683 author: Zhao, Q; Wang, H; Wang, W; Li, J; Liu, Y; Xue, Z; Liu, Z; Wang, L; Song, L title: A C-type lectin (AjSJL-1) containing DPN/WVD motifs in Apostichopus japonicus recognizes multiple microbes date: 2021-06-29 words: 7189 flesch: 63 summary: When the sea cucumbers were challenged by V. splendidus, the expression level of AjSJL-1 mRNA in coelomocyte increased significantly (p < 0.01) at 12 h, suggesting it was induced by immune stimulation similar to the CTLs in other invertebrates (Wang et al., 2012; Drummond and Brown, 2013; Huang et al., 2013a; Huang et al., 2013b; Li et al., 2015a; Yang et al., 2015; Zhou and Sun, 2015). In the past decades, an increasing number of CTLs have been identified in various species (Mcnulty et al., 2012; Zhang et al., 2012; Huang et al., 2014; Zhang et al., 2017), which function in immune response either as cytomembrane receptors in immunocytes or as soluble proteins existing in tissue fluids (Wang et al., 2012; Huang et al., 2013a; Hoving et al., 2014). keywords: ajsjl-1; binding; ca2; crd; ctls; cucumber; et al; immune; immunol; japonicus; lectin; sea; type; wang cache: isj-683.pdf plain text: isj-683.txt item: #418 of 465 id: isj-688 author: He, S; Xu, J; Fan, Y; Zhu, F; Chen, K title: Transcriptomic analysis of strain-specific and gender-specific response of silkworm to BmNPV infection date: 2021-08-27 words: 5092 flesch: 57 summary: By comparing the expression abundance of these 18 genes in NB♀-V and NB♂-V, nine genes were found to have different expression abundance, of which 8 genes had higher expression abundance in NB♂-V and 1 gene had higher expression abundance in NB♀-V (Table 5). And gene expression abundance was then analyzed. keywords: analysis; bmnpv; degs; et al; expression; genes; response; silkworm cache: isj-688.pdf plain text: isj-688.txt item: #419 of 465 id: isj-69 author: Ding, J; Li, L X; Liu, X H; Wang, H; Ding, S Y; Han, L S; Chang, Y Q title: Molecular characterization and expression of AjNLRP3 in the antibacterial host defense of the sea cucumber (Apostichopus japonicus) date: 2017-10-24 words: 5318 flesch: 57 summary: In recent years, outbreaks of diseases such as skin ulcer syndrome (Wang et al., 2006), stomach atrophy (Deng et al., 2008), red body disease (Hao et al., 2013), and bad side disease (Zhang et al., 2010) have severely affected the development of sea cucumber aquaculture. Tohno M, Shinkai H, Toki D, Okumura N, Tajima K, Uenishi H, et al. Identification of the Q969R gain-of-function polymorphism in the gene encoding porcine NLRP3 and its distribution in pigs of Asian and European origin. keywords: ajnlrp3; amino; analysis; apostichopus; body; cucumber; et al; expression; gene; immune; japonicus; level; pcr; sea; sequence cache: isj-69.pdf plain text: isj-69.txt item: #420 of 465 id: isj-691 author: Ahmed, R; Freed, S; Naeem, A; Akmal, M title: Activity of detoxification enzymes in Rhynchophorus ferrugineus (Olivier) (Coleoptera: Curculionidae) after exposure to Beauveria bassiana (Balsamo) date: 2021-09-10 words: 6739 flesch: 69 summary: In conclusion, current study has described that R. ferrugineus infection with B. bassiana sharply increased detoxification enzyme activities mediating 117 detoxification and degradation of B. bassiana. The samples were spun at 10,000 rpm for 10 min, and supernatants were used to determine enzyme activities. keywords: b s; bassiana; e b; ferrugineus cache: isj-691.pdf plain text: isj-691.txt item: #421 of 465 id: isj-694 author: Abdel-Halim, K Y; Osman, S R; El-Danasoury, H T M; Ziada, R M title: Potential toxic effects of titanium dioxide nanoparticles and carbon nanotubes on land snail Helix aspersa: use of oxidative stress as a reliable biomarker for ecotoxicology assessment date: 2021-10-07 words: 6490 flesch: 60 summary: All boxes were sprayed with water to provide suitable humidity for snail activity. In another study, SWCNTs exhibited a significant reduction in GSH, GST, and GPx in hepatopancreas of L. luteola after exposure to different concentrations for 96 h (Ali et al., 2013). keywords: activity; aspersa; control; environ; gland; glutathione; gsh; haemolymph; ld50; mg-1; nanoparticles; nps; oxidative; protein; snail; stress; swcnts; tio2 cache: isj-694.pdf plain text: isj-694.txt item: #422 of 465 id: isj-697 author: Peronato, A; Minervini, G; Franchi, N; Ballarin, L title: New data on C1qDC from the colonial ascidian Botryllus schlosseri date: 2021-10-29 words: 4974 flesch: 55 summary: In invertebrates, acting as lectins and opsonins (Gerlach et al., 2004; Zhang et al., 2008; Carland and Gerwick, 2010; Gerdol et al., 2011; Li et al., 2011; Yang et al., 2012; Jiang et al., 2015; Huang et al., 2017; Wang, 2017; Gorbushin, 2019). Corresponding author: Loriano Ballarin Department of Biology University of Padova Via Ugo Bassi 58/B, 35143 Padova, Italy E-mail: loriano.ballarin@unipd.it range of PAMPs (Medzhitov, 2002; Bohlson et al., 2007). keywords: antibody; botryllus; bsc1qdc; cells; et al; hctrp4; min; morula; peronato; phagocytosis; presence; protein cache: isj-697.pdf plain text: isj-697.txt item: #423 of 465 id: isj-7 author: Blom, Johanna Maria Catharina title: ENZO OTTAVIANI Founder of ISJ-Invertebrate Survival Journal 1945 - 2017 date: 2018-01-24 words: 464 flesch: 45 summary: In more recent years, Ottaviani turned his attention in particular to how his field of research might be linked to stress related disorders and inflammation, both because of their importance to human public health and as potential windows into the mechanisms that underlie human defense mechanisms and resistance to stress. During the last forty years, research performed by Enzo Ottaviani, provided significant insights to these old questions, which led to an innovative comprehension of how basic immune, environmental and more recently, genetic factors interact to give rise to different outcomes in individuals. keywords: enzo; ottaviani cache: isj-7.pdf plain text: isj-7.txt item: #424 of 465 id: isj-70 author: Jielian, W; Baoqing, H; Chungen, W; Peipei, Y title: Characterization and roles of lysozyme in molluscs date: 2017-10-31 words: 8838 flesch: 60 summary: Thammasirirak S, Torikata T, Takami K, Murata K, Araki T. Purification and characterization of goose type lysozyme from cassowary (Casuarius casuarius) egg white. The genetic structure of i-type lysozyme has is similar to that of c-type lysozyme, and both have 4 exons and 3 introns (Nilsen et al., 1999, 2001; Paskewitz et al., 2008). keywords: activity; bacteria; cell; digestive; discus; et al; evolution; expression; function; galloprovincialis; gene; gram; hepatopancreas; immune; jollès; lysozyme; molluscs; philippinarum; type; type lysozyme; wang et; yang; zhao cache: isj-70.pdf plain text: isj-70.txt item: #425 of 465 id: isj-71 author: Gao, L; Li, A; Li, N; Liu, X; Deng, H; Zhao, B; Pang, Q title: Innate and intrinsic immunity in planarians date: 2017-11-04 words: 6997 flesch: 49 summary: No reference Complement factors or integrins Von Willebrand factor type A domain SmedGD Peiris et al., 2014 Antioxidant enzyme Catalase (CAT) catalase_clade_3 domain Sm-MPD Bocchinfuso et al., 2012; Zhang et al., 2014; Zhang et al., 2016 Superoxide dismutase (SOD) SodA domain Sm-MPD Bocchinfuso et al., 2012; Zhang et al., 2014; Zhang et al., 2016 Glutathione peroxidase (GPx) GRX_GRXh_1_2_like domain SmedGD Zhang et al., 2014; Zhang et al., 2016 Peroxiredoxin PRX5_like domain Sm-MPD Bocchinfuso et al., 2012 Thioredoxin peroxidase (TPx) PRX_Typ2cys domain SmedGD keywords: bacteria; cells; defense; domain; et al; genes; immune; immunol; innate; like; pang; pathogens; pharynx; planarian; protein; recognition; regeneration; responses; system; type; zhang cache: isj-71.pdf plain text: isj-71.txt item: #426 of 465 id: isj-710 author: Zhang, D; Dong, X; Zhu, J; Yang, J; Tian, Y; Wang, L; Mao, J; Wang, X; Chang, Y; Hao, Z title: Effect of water temperature on the behavior of Neptunea cumingii and the histology, immune enzyme activity, and transcriptome of its gills and kidneys date: 2022-01-22 words: 7499 flesch: 58 summary: N. cumingii has a spindle-shaped exterior shell with a bulged center and pointy ends as well as a horny operculum. N. cumingii is a popular and highly valued edible species due to its delicious and nutrient-rich meat, which contains a variety of amino acids, glycogen, protein, and essential trace elements that are good for human health (Cai, 2001). keywords: activities; activity; aoc; behavior; cat; cells; china; cumingii; enzyme; et al; genes; gill; kidney; results; sod; stress; temperature cache: isj-710.pdf plain text: isj-710.txt item: #427 of 465 id: isj-713 author: von Bredow, C R; Trenczek, T E title: Distinguishing Manduca sexta haemocyte types by cytometric methods date: 2022-01-22 words: 8505 flesch: 64 summary: However, even trained researchers may encounter difficulties in haemocyte type determination due to similarities between cell types and variable size and shapes within the same cell type. Cell types occuring in different morphs (spread and non-spread) are indicated by same colour. keywords: animals; area; cells; cells n; fig; granular; haemocyte; length; nucleus; round; spread; types cache: isj-713.pdf plain text: isj-713.txt item: #428 of 465 id: isj-717 author: Scapolatiello, A; Rosani, U; Manfrin, C; Puljas, S; Pallavicini, A; Gerdol, M title: Identification of five picorna-like viruses associated with the endangered cave-dwelling bivalve Congeria kusceri (Bole, 1962) date: 2022-02-09 words: 5885 flesch: 54 summary: This included the Trichosanthes kirilowii picorna-like virus, the Forsythia suspensa picorna-like virus (Yang et al., 2021), the snail Beihai picorna-like virus 105/niflavirus (Ng et al., 2012; Shi et al., 2016) and with the freshwater mussel Clinch dicistro-like virus 1 (Richard et al., 2020). Corresponding author: Marco Gerdol University of Trieste Department of Life Sciences Via Giorgieri 5, 34127 Trieste, Italy E-mail: mgerdol@units.it lifespan (Morton and Puljas, 2013), allowed the survival of this species in the subterranean environment to the present day (Stepien et al., 2001; Bilandžija et al., 2013). keywords: bivalve; congeria; et al; fig; freshwater; genome; karst; kusceri; picorna; picornaviridae; protein; rdrp; sequence; species; tissues; viruses cache: isj-717.pdf plain text: isj-717.txt item: #429 of 465 id: isj-72 author: Wang, M; Wang, B; Liu, M; Jiang, K; Wang, L title: A novel macrophage migration inhibitory factor gene from the Pacific white shrimp Litopenaeus vannamei (LvMIF2): comparative sequence and transcription analysis with LvMIF1 date: 2017-11-11 words: 5664 flesch: 54 summary: MIF from Zhikong scallop Chlamys farreri (CfMIF) was involved in innate immune responses mailto:wanglei@qdio.ac.cn 454 by promoting fibroblast migration (Li et al., 2011a). For examples, in small abalone Haliotis diversicolor supertexta, the mRNA expression level of HdsMIF was significantly upregulated in hepatopancreas post Vibrio parahaemolyticus stimulation (Wang et al., 2009). keywords: et al; expression; fold; hemocytes; hepatopancreas; level; lvmif2; mrna; mrna expression; pcr; qrt; sequence; shrimp; stimulation cache: isj-72.pdf plain text: isj-72.txt item: #430 of 465 id: isj-720 author: Ballarin, L title: 4th general meeting of the COST Action 16203: STEM CELLS OF MARINE/AQUATIC INVERTEBRATES: FROM BASIC RESEARCH TO INNOVATIVE APPLICATIONS (MARISTEM), October 20, 2021, Palazzo Bo, University of Padova, ITALY date: 2022-03-01 words: 3905 flesch: 33 summary: 37 ISJ 19: 37-41, 2022 ISSN 1824-307X REPORT OF MEETING 4th general meeting of the COST Action 16203: STEM CELLS OF MARINE/AQUATIC INVERTEBRATES: FROM BASIC RESEARCH TO INNOVATIVE APPLICATIONS (MARISTEM), October 20, 2021, Palazzo Bo, University of Padova, ITALY Organizer: L Ballarin University of Padova, Italy The 4th MARISTEM general meeting was supported by COST through the COST Action 16203 Studying stem cells and differentiation with ACME dissociation J Solana Department of Biological and Medical Sciences, Faculty of Health and Life Sciences, Oxford Brookes University, Oxford, England, UK How do stem cells give rise to a myriad of different cell types? The study of stem cells and their differentiation processes is being largely enabled by single-cell transcriptomic approaches. keywords: cell; marine; model; myc; protein; regeneration; schlosseri; species; stem; stem cells; tissue; types; university cache: isj-720.pdf plain text: isj-720.txt item: #431 of 465 id: isj-73 author: Bilal, M; Freed, S; Zubair Ashraf, M; Muhammad, S title: Enhanced activities of acetylcholinesterase, acid and alkaline phosphatases in Helicoverpa armigera after exposure to entomopathogenic fungi date: 2017-11-11 words: 3510 flesch: 52 summary: The supernatants were used for determining enzyme activity and the samples were made for three durations (72, 120 and 168 h) after 48 h of treatment to allow EPF infection in the treated H. armigera larvae. Saleem MA, Shakoori A. Joint effects of Dimilin and Ambush on enzyme activities of Tribolium castaneum larvae. keywords: ache; activity; anisopliae; armigera; enzyme; fumosorosea; hemolymph; samples cache: isj-73.pdf plain text: isj-73.txt item: #432 of 465 id: isj-730 author: Wang, D; Huang, B; Yu, J; Bai, C; Li, C; Wang, C; Xin, L; Zhou, H title: Characterization of a Novel C-type Lectin against OsHV-1 infection in Scapharca broughtonii date: 2022-03-31 words: 5966 flesch: 61 summary: Each value was shown as mean ± S.D. (N = 3) 50 signal pathways against pathogens (Wang et al., 2007; Zhang et al., 2009b; Kong et al., 2011). SbCTL mRNA expression levels in mantle, gills, hemocytes, foot, muscle and hepatopancreas were all normalized to that of muscle. keywords: ark; binding; ca2; clams; crd; ctls; expression; fig; group; infection; mrna; oshv-1; recognition; sbctl; type cache: isj-730.pdf plain text: isj-730.txt item: #433 of 465 id: isj-731 author: Aghaeepour, S; Zibaee, A; Ramzi, S; Hoda, H title: Host-pathogen interactions of the two native isolates of Beauveria bassiana to a predatory coccinellid, Cryptolaemous montrouzieri Mulsant (Coleoptera: Coccinellidae) date: 2022-03-31 words: 6860 flesch: 57 summary: Cellular immune reactions depend on circulating hemocytes such as prohemocyte, granulocyte and plasmatocyte (Zibaee et al., 2014). Nodulation occurs rapidly after microbial infection by micro-aggregation of hemocytes and assembling of additional hemocytes (Zibaee et al., 2014; Aghaee Pour et al., 2021; Shahriari et al., 2021b). keywords: activity; adults; am-118; bassiana; bb3; et al; isolates; larvae; montrouzieri cache: isj-731.pdf plain text: isj-731.txt item: #434 of 465 id: isj-737 author: Ballarin, L; Matozzo, V; Sandrelli, F; Santovito, G; Venier, P title: XXIst scientific meeting of the Italian Association of Developmental and Comparative Immunobiology (IADCI), February 16-18 2022, Didactic Pole, Department of Biology, University of Padua, Italy date: 2022-05-16 words: 13052 flesch: 30 summary: Traditionally, stem cells and immune cells are considered as parts of two branches of biological research with few interconnections between them. Molecular biology and gene expression studies revealed complex defense mechanisms involving different inflammatory hemocytes. keywords: analysis; biology; cells; data; department; effects; expression; fish; genes; hemocytes; host; immune; immunity; italy; life; like; marine; modena; molecular; organisms; padua; presence; proteins; research; response; results; role; sciences; species; specific; stress; study; system; time; tissue; university cache: isj-737.pdf plain text: isj-737.txt item: #435 of 465 id: isj-740 author: Sokolova, E; Mager, S; Grizanova, E; Kalmykova, G; Akulova, N; Dubovskiy, I title: Stimulation effect of probiotic bacteria Bacillus spp. and inactivated yeast on the honey bees Apis mellifera physiology and honey productivity date: 2022-06-15 words: 4368 flesch: 58 summary: In order to find effective and safe ways to prevent the weakening and death of honey bee colonies from various stress factors, it is necessary to focus on the stimulation of physiological processes in the bee’s body, activating their own mechanisms of resistance. High mortality in honey bee colonies has been reported worldwide in recent decades without definitive identification of the causes (Benaets et al., 2017). keywords: activity; apis; bacillus; bacteria; bees; body; control; et al; honey; mellifera; protein; subtilis; yeast cache: isj-740.pdf plain text: isj-740.txt item: #436 of 465 id: isj-742 author: Geng, Z; Gao, L; Yu, Z; Fu, Q; Liu, R; Lin, X; Wang, L; Song, L title: The isolation and identification of a pathogenic Vibrio neocaledonicus from Yesso scallop (Patinopecten yessoensis) date: 2022-07-01 words: 8029 flesch: 57 summary: (Wang et al., 2021). In crab Charybdis japonica, CAT activity in the serum increased significantly at 4 h and reached the highest at 24 h after infection with V. parahaemolyticus (Wang et al., 2010), which was earlier than the result of SOD activity after M-08 challenge. keywords: bacterial; challenge; china; control; disease; et al; fig; group; m-08; min; ml-1; neocaledonicus; pcr; scallops; vibrio; yesso cache: isj-742.pdf plain text: isj-742.txt item: #437 of 465 id: isj-745 author: Zhou, Q Q; Wang, Y; Hu, J J; Zhang, L; Li, J B; Xu, Y J; Wang, M Q title: Identification and characterization of a cyclophilin A gene from Chinese shrimp Fenneropenaeus chinensis: sequence features and expression profiles date: 2022-08-18 words: 5731 flesch: 55 summary: There are also some studies on CypA transcriptional expression in fish, mollusks and amphibians, overall, no consistent pattern of CypA gene expression was found among tissues in different species (Dorfman et al., 1997; Tu et al., 2003; Massé et al., 2004). The higher expression level of FcCypA is hemocytes，which also play an important role in the immune defense system of animals, especially for invertebrates that have no adaptive immune system (Yang et al., 2015; Koiwai et al., 2018). keywords: acid; amino; analysis; cdna; cyclophilin; cypa; et al; expression; fccypa; gene; hemocytes; hepatopancreas; level; mrna; pcr; sequence cache: isj-745.pdf plain text: isj-745.txt item: #438 of 465 id: isj-746 author: Zhang, L; Wang, Y; Hu, J J; Li, J B; Xu, Y J; Zhou, Q Q; Wang, M Q title: Molecular characterization and expression ananlysis of a QM protein gene from Chinese shrimp Fenneropenaeus chinensis date: 2022-08-18 words: 6344 flesch: 54 summary: In grass carp, QM protein was significantly up-regulated by Aeromonas hydrophila and grass carp hemorrhagic virus (GCHV) infection, suggesting that QM protein gene is associated with anti-pathogens inflammatory response (Wen et al., 2005). The homolog of QM in chicken (JIF-1), a negative transcription regulator of c-Jun, could bind to the protooncogene c-Jun and suppressed AP-1 function, suggesting that QM protein gene may be involved in transcriptional regulation (Imafuku et al., 1999). keywords: cdna; et al; expression; fcqm; gene; hemocytes; hepatopancreas; hpi; level; pcr; protein; qm protein; sequence; shrimp; stimulation; wang cache: isj-746.pdf plain text: isj-746.txt item: #439 of 465 id: isj-756 author: Sun, J; Wang, Y; Hu, F; Hu, J J; Wang, M Q title: Comparative study of two novel extracellular copper/zinc superoxide dismutase (Cu-Zn SOD) genes from white shrimp Litopenaeus vannamei date: 2022-12-09 words: 5265 flesch: 52 summary: Previous studies have shown that hepatopancreas and hemocytes are considered to be the main immune organ and immune cells in crustaceans (Wang et al., 2013; Wang et al., 2017). Tissue distribution of SOD expression As shown in Figure 4, LvEcSOD1 and LvEcSOD2 was widely detectable in the eyestalk, gill, gonad, heart, hemocytes, hepatopancreas, intestine, muscle, nerve and stomach of L. vannamei. keywords: dismutase; et al; expression; extracellular; gene; hemocytes; hepatopancreas; lvecsod1; mrna; primer; ros; shrimp; superoxide; vannamei; wang cache: isj-756.pdf plain text: isj-756.txt item: #440 of 465 id: isj-757 author: Pirillo, V; Baranzini, N title: Current research on the effects of plastics pollution in marine and freshwater aquatic invertebrates date: 2022-12-09 words: 10730 flesch: 51 summary: Likewise, other reported protocols are based on the cutting and fragmentation of commercially plastics fibers or row pellets (Jemec et al., 2016; Kim et al., 2021). Transmission Electron Microscopy fluorescent MPs and NPs are those of PS, in particular available as blue-dyed (345 nm excitation and 435 nm emission, Phosphorex), red-dye (552 nm excitation and 580 nm emission, Micromer®- redF), and yellow-green microspheres (441 nm excitation and 486 nm emission, Fluoresbrite® Plain YG) (Della Torre et al., 2014; Canesi et al., 2015; Bergami et al., 2017; Gambardella et al., 2017; Capolupo et al., 2018; Liu et al., 2019; Rist et al., 2019; Cappello et al., 2021; Gonçalves et al., 2022). keywords: chemical; concentrations; effects; environ; et al; exposure; freshwater; impact; invertebrates; levels; marine; microplastics; mps; nps; organisms; particles; pet; plastics; pollut; pollution; polymers; polystyrene; potential; sci; species; stress; studies; tissues; toxicity; types cache: isj-757.pdf plain text: isj-757.txt item: #441 of 465 id: isj-759 author: Song, W; Zhu, F ; Andoh, V; Chen, K title: Analysis of genes influencing the feeding of Bombyx mori by genome resequencing date: 2022-12-21 words: 17791 flesch: 79 summary: H 0.842;355 C 0.973*;410 S 0.948;412 Q 0.969*;424 L 0.559;498 S 0.952*;499 S 0.994**; ribonuclease H2 subunit R 0.612;645 S 0.910;714 A 0.638; signal recognition particle 14 kDa protein-like protein keywords: acid; activity; analysis; bmj; bombyx; bombyx mori; cyclic; enrichment; families; family; feeding; genes; genome; glucosyltransferase precursor; glycosyltransferase; glycosyltransferase ugt33r2; insect; isoform; jiangsu; kda; kegg; leaves; like; lipoprotein; metabolism; molecular; mori; mulberry; olfactory; phospholipase; positive; precursor; protein; results; selection; sequencing; silkworm; species; subunit; table; udp; ugt33r1; ugt33r2 precursor; ugt46a1 cache: isj-759.pdf plain text: isj-759.txt item: #442 of 465 id: isj-76 author: Tascedda, F title: Lymnaea stagnalis as model of neuropsychiatric disorders date: 2017-11-14 words: 1712 flesch: 56 summary: These pathologies are extremely widespread and contribute in an important way to the high cost of public health (Nestler et al., 2010; Tascedda et al., 2015; Kaiser et al., 2015). Many researchers have attempted to solve the problem by using in vitro cell systems (Alboni et al.; 2013, 2014; Caraci et al., 2016) that have many important advantages (Tascedda et al., 2015). keywords: benatti; brain; et al; models; tascedda cache: isj-76.pdf plain text: isj-76.txt item: #443 of 465 id: isj-763 author: Shahriari, M ; Zibaee, A; Dinan, MF; Armand, A; Tabari, M; Hoda, H title: Induction of antioxidant and detoxifying systems of Chilo suppressalis Walker after exposure to entomopathogenic fungi date: 2023-02-02 words: 5163 flesch: 52 summary: Zibaee A, Bandani AR, Tork M. Effect of the entomopathogenic fungus, Beauveria bassiana, and its secondary metabolite on detoxifying enzyme activities and acetylcholinesterase (AChE) of the Sunn pest, Eurygaster integriceps (Heteroptera: Scutellaridae). Effect of entomopathogenic fungi on detoxification enzyme activity in greater wax moth Galleria mellonella L. (Lepidoptera, Pyralidae) and role of detoxification enzymes in development of insect resistance to entomopathogenic fungi. keywords: activities; activity; antioxidant; bbal1; bbln1; bbrr1; entomopathogenic; et al; fungi; isolates; larvae; suppressalis cache: isj-763.pdf plain text: isj-763.txt item: #444 of 465 id: isj-767 author: Coscia, MR; Melillo, D; Ametrano, A; Marino, R; Malagoli, D; Parisi, MG title: XXIII scientific meeting of the Italian Association of Developmental and Comparative Immunology (IADCI), February 13-15, 2023, DaDoM - Darwin Dohrn Museum, Villa Comunale, Naples, Italy date: 2023-05-08 words: 13228 flesch: 29 summary: For this purpose, our study focused on assessing the potential cytotoxicity and genotoxicity of four different PFAS congeners (PFOA, HFPO-DA, PF4MOBA, PF3MOPrA) on immune system cells 35 (coelomocytes) of sexually mature earthworm Eisenia foetida in a range concentration of 0.6-229 microM. In the last decades, we have identified and characterized different cell types in the medicinal leeches Hirudo verbana and Hirudo medicinalis, such as hemopoietic precursor cells, monocytes/macrophages, granulocytes, natural killers, fibroblasts, telocytes, myofibroblast and myoendothelial cells, all sharing the same morphofunctional and molecular features with vertebrates. keywords: activity; analysis; antarctic; biology; cells; data; department; editing; expression; fish; gene; immune; italy; life; marine; model; molecular; naples; organisms; padua; potential; presence; research; response; results; role; sciences; species; stress; studies; study; system; temperature; trieste; university cache: isj-767.pdf plain text: isj-767.txt item: #445 of 465 id: isj-77 author: Napiórkowska, T; Templin, J title: Teratological changes on the prosoma of Eratigena atrica spiders caused by alternating temperatures date: 2017-11-14 words: 5170 flesch: 58 summary: 40 individuals had leg anomalies. Napiórkowska T, Napiórkowski P, Templin J. Morphological and anatomical changes related to leg anomalies in Tegenaria atrica. keywords: anomalies; atrica; deformities; jacuński; legs; napiórkowska; prosoma; sci; spider; tegenaria; temperature cache: isj-77.pdf plain text: isj-77.txt item: #446 of 465 id: isj-771 author: Pan, Y; Lü, P; Tang, M; Chen, K title: Pathological changes in the main immune organs of silkworm infected with Staphylococcus aureus date: 2023-05-31 words: 2707 flesch: 61 summary: Bmintegrin β3 of plasmatocytes may triggered by S. aureus infection of silkworm, it may relate to the extensibility and adhesion of plasmatocytes cells (Zhang et al. 2017; 42 Fig. Our results imply plasmacytes of hemocytes can adhere to and spread over S. aureus in the hemolymph and may play an important role in the resistance of the silkworms to S. aureus infection. keywords: aureus; hemolymph; infection; mori; s. aureus; silkworm cache: isj-771.pdf plain text: isj-771.txt item: #447 of 465 id: isj-78 author: Vetvicka, V; Sima, P title: Various roles of β-glucan in invertebrates date: 2017-11-15 words: 4248 flesch: 50 summary: These data suggest that with prolonged application of glucan in shrimp aquaculture, caution should be prudent as more is not always better (Wang et al., 2013). Subsequent study showed that the recombinant LGBP triggers the whole hemolymph-dependent melanization and stimulates the proPO cascade (Zhang et al., 2016). keywords: binding; characterization; et al; expression; gbp; glucan; immune; immunol; invertebrates; lgbp; molecular; propo; protein; recognition; shrimp cache: isj-78.pdf plain text: isj-78.txt item: #448 of 465 id: isj-79 author: Liu, C; Lin, D; Dong, Y; Xue, Q; Yao, H; Lin, Z title: Association of α-amylase gene with growth traits in the razor clam Sinonovacula constricta date: 2017-11-24 words: 5711 flesch: 63 summary: We explored the possible effects of starvation and refeeding on Scamy gene expression levels and enzyme activities using adult clams with an average shell length of 6.0 cm. We compared Scamy expression levels between starved and refed clams based on four individuals from each replicates selected at random every day throughout the experiments. keywords: activity; amylase; analysis; cdna; clams; constricta; expression; gene; growth; pcr; scamy; sequence; starvation; traits cache: isj-79.pdf plain text: isj-79.txt item: #449 of 465 id: isj-80 author: Zhan, Y; Yang, M; Cui, D; Li, J; Sun, J; Ning, J; Hao, Z; Zhang, W; Chang, Y title: Combined effects of temperature and salinity on growth, survival, gill morphology, and antioxidant capabilities in the horse mussel Modiolus modiolus date: 2018-03-04 words: 5953 flesch: 56 summary: Key Words: horse mussel; gill lumen; SOD; T-AOC; GPx; superoxide dismutase; total antioxidant capacity; glutathione peroxidase; SGR Introduction The horse mussel, Modiolus modiolus (Mollusca: Bivalvia), is a benthic, sessile species distributed worldwide in coastal areas (Hutchison et al., 2016). Fariñas-Franco JM, Sanderson WG, Roberts D. Phenotypic differences may limit the potential for habitat restoration involving species translocation: a case study of shape ecophenotypes in different populations of Modiolus modiolus (Mollusca: Bivalvia). keywords: anova; effects; gill; modiolus; psu; salinity; temperature; way; way anova cache: isj-80.pdf plain text: isj-80.txt item: #450 of 465 id: isj-81 author: Dong, Y; Gao, X; Sheng, W; Yao, H; Lin, Z title: Characteristics of α-Amylase gene and its association with growth traits in Meretrix meretrix date: 2018-03-17 words: 5790 flesch: 62 summary: On the basis of 454 cDNA library of M. meretrix (GenBank accession no. SRA021052), EST sequences of MmAmy gene were retrieved. 2 Analysis of sequence and structure of MmAmy gene. keywords: activity; amylase; analysis; cdna; cloning; color; et al; expression; gene; growth; intron; meretrix; mmamy; shell; traits cache: isj-81.pdf plain text: isj-81.txt item: #451 of 465 id: isj-82 author: Ramšak, A title: 1st general meeting and working group meetings of the COST Action 16203: STEM CELLS OF MARINE/AQUATIC INVERTEBRATES: FROM BASIC RESEARCH TO INNOVATIVE APPLICATIONS (MARISTEM), February 5-6, 2018, Marine Biology Station, National Institute of Biology, Pira date: 2018-02-06 words: 9391 flesch: 30 summary: Paris Scleractinian corals are evolutionary ancient, long-lived marine animals with high regeneration abilities, which can provide perspectives to research on stem cells, aging and regeneration processes. Platynereis dumerlilii, a new model to study the involvement of stem cells during growth and regeneration E Gazav1, A Planque2, J Male2, P Alvarez- Campos2, M Vervoort1 1Institut keywords: adult; aging; animals; biology; cells; coral; development; differentiation; expression; genes; gsc; hydra; marine; mechanisms; model; organisms; processes; proteins; regeneration; research; species; stem; stem cells; stress; study; system; tissue; university cache: isj-82.pdf plain text: isj-82.txt item: #452 of 465 id: isj-83 author: Canesi, L; Balbi, T; Auguste, M; Grasselli, E; Vergani, L; Demori, I; Fabbri, R; Montagna, M; Voci, A title: XIXth scientific meeting of the Italian Association of Developmental and Comparative Immunobiology (IADCI), 7 - 9 February 2018, Department of Earth, Environment and Life Sciences (DISTAV), University of Genoa, Genoa, Italy date: 2018-02-09 words: 11916 flesch: 30 summary: Some of these approaches include high doses of intravenously and sometimes repetitively injected Gold NPs which then can spread throughout the body coming in contact with many different cell types including immune cells. Since this is a branch of science in active development and still little is known about the potential effects of NPs on the immune system, especially in the context of long term and chronic exposure with concomitant pathologies, there is an urgent need to better understand the possible functions of AuNPs on immune cells with phagocytic properties such as macrophages and dendritic cells (DCs). keywords: activity; amps; analysis; cells; data; effects; environment; expression; gene; genoa; hemocytes; immune; immunity; inflammatory; italy; life; like; lps; macrophages; marine; nps; padua; protein; response; results; role; sciences; sea; species; system; trieste; university; vertebrates; vitro cache: isj-83.pdf plain text: isj-83.txt item: #453 of 465 id: isj-84 author: Ottaviani, E title: Welcome to ISJ date: 2004-04-01 words: 258 flesch: 41 summary: Consequently, we have decided to launch an online journal that will allow rapid publication of papers without distribution expenses, while also offering additional important advantages such as linking to referenced articles, database entries, supplier information, etc. ISJ000.PDF 1 ISJ 1: 1, 2004 ISSN 1824-307X Editorial Welcome to ISJ ISJ is not only a free online journal, but also the first publication specifically dedicated to the basic defense mechanisms in invertebrates. keywords: isj cache: isj-84.pdf plain text: isj-84.txt item: #454 of 465 id: isj-86 author: Moorthy, S M; Chandrakanth, N; Krishnan, N title: Inheritance of heat stable esterase in near isogenic lines and functional classification of esterase in silkworm Bombyx mori date: 2015-12-30 words: 6700 flesch: 56 summary: RESEARCH REPORT ISJ 13: 1-10, 2016 ISSN 1824-307X RESEARCH REPORT Inheritance of heat stable esterase in near isogenic lines and functional classification of esterase in silkworm Bombyx mori SM Moorthy1, N Chandrakanth1, N Krishnan2 1Silkworm Breeding Laboratory, Central Sericultural Research and Training Institute, Mysore 570 008, India 2Department of Biochemistry, Molecular Biology, Entomology and Plant Pathology, Mississippi State University, Mississippi State, MS 39762, USA Accepted December 30, 2015 Abstract Esterases are ubiquitous in living organisms and perform multiple functions in animals, plants, insects and microorganisms. The present work aims towards identifying heat stable esterase in the hemolymph of near isogenic lines (NILs) and their parents, and further to classify esterases based on substrate-inhibition reactions in silkworm, Bombyx mori. keywords: bivoltine; bombyx; breeds; esterases; et al; heat; mori; multivoltine; nils; parents; silkworm; survival; thermotolerance cache: isj-86.pdf plain text: isj-86.txt item: #455 of 465 id: isj-87 author: Ottaviani, E title: The mollusc as a suitable model for mammalian immune-neuroendocrine investigations date: 2004-06-30 words: 1816 flesch: 47 summary: The humoral factors are represented by agglutinins, lectins, nitric oxide, cytokine-like molecules (lm), corticotropin-releasing hormone (CRH)-lm, enkephalin-lm, pro-opiomelanocortin (POMC)-derived peptide-lm, e.g. adrenocorticotropin hormone (ACTH), α-melanocyte-stimulating hormone (α-MSH) and β -endorphin (for reviews, see Stefano et al., 1989; Ottaviani, 1992; Ottaviani et al., 1997). Humoral and cellular experiments, bacterial clearance studies, and the specific responses found in molluscan transplantations suggest the presence of a memory- type response of short duration (Ottaviani et al., 1986; Ottaviani, 1990; Ottaviani and Vergine, 1990). keywords: acth; immunocytes; neuroendocrine; ottaviani; stefano cache: isj-87.pdf plain text: isj-87.txt item: #456 of 465 id: isj-9 author: Ding, J; Wang, H; Yin, C; Zhao, X W; Sun, X; Liu, X H; Han, L S; Chang, Y Q title: Molecular cloning of the heat shock protein 90 gene in scallop Mizuhopecten yessoensis and the effects of temperature stress on gene expression date: 2017-11-24 words: 6320 flesch: 58 summary: In the gill, MyHSP90 expression was the highest level at 26 °C, and the maximal expression level was 130 times higher than that of the control temperature (15 °C) (p < 0.05). Unlike with HSP70, only a few studies have demonstrated that thermal stressors stimulate HSP90 expression in molluscs (Choi et al., 2008; Liu et al., 2015), including two species of scallop Azumapecten (Chlamys) farreri and A. irradians (Gao et al., 2007, 2008). keywords: analysis; cdna; china; et al; expression; gene; heat; molecular; mrna; myhsp90; protein; scallop; sequence; shock; stress; temperature; yessoensis cache: isj-9.pdf plain text: isj-9.txt item: #457 of 465 id: isj-91 author: Borsatti, F; Casarini, L; Mandrioli, M title: Analysis of the expression pattern of the defensin gene in the lepidopteran Mamestra brassicae date: 2004-06-30 words: 2188 flesch: 58 summary: RT-PCR experiments indicated that defensin gene is expressed despite gene methylation. Key words: epigenetics; DNA methylation; defensin gene expression; lepidopteran Introduction Defensins are 4kDa cationic peptides with a characteristic six cysteine/three disulfide bridge pattern and three domains consisting in a flexible amino- terminal loop, a central α-helix and a carboxy-terminal antiparallel β-sheet (Hoffmann and Hetru, 1992; Hetru et al., 1998; Bulet et al., 1999). keywords: defensin; dna; expression; gene; insect; mandrioli; methylation cache: isj-91.pdf plain text: isj-91.txt item: #458 of 465 id: isj-92 author: Grimaldi, A; Tettamanti, G; Rinaldi, L; Perletti, G; Valvassori, R; de Eguileor, M title: Role of cathepsin B in leech wound healing date: 2004-06-30 words: 5100 flesch: 56 summary: ISSN 1824-307X Research Report Role of cathepsin B in leech wound healing A Grimaldi1, G Tettamanti1, L Rinaldi1, G Perletti2, R Valvassori1, M de Eguileor1* 1 Department of Structural and Functional Biology, University of Insubria, Varese, Italy 2 Department of Structural and Functional Biology, University of Insubria, Busto Arsizio, Italy Accepted June 30, 2004 Interstingly the cellular function of cathepsin B in invertebrates appear to be equivalent to that of vertebrates, where the secreted enzyme plays a role in basement membrane and matrix disruption operated by cells involved in angiogenesis, wound repair and immune defence. keywords: cathepsin; cells; eguileor; et al; fibers; fig; leeches; medicinalis; muscle; tissue cache: isj-92.pdf plain text: isj-92.txt item: #459 of 465 id: isj-93 author: Ballarin, L; Burighel, P; Zaniolo, G title: VIth scientific meeting of the Italian Association for Developmental and Comparative Immunology (IADCI), 12 and 13 February 2004, University of Padova, Padova, Italy date: 2004-02-13 words: 11229 flesch: 36 summary: Different antigens can selectively stimulate both proliferation and migration of immune cells that can be classified as macrophage- like cells, NK-like cells or granulocytes (not only for their morphological aspect but also for the expression of specific CD antigens). In leeches, the granulation tissue stage is characterized by a massive angiogenesis and fibroplasia: -the formation of new vessels is a complex process based on a finely regulated network of cellular and molecular events, involving a great variety of ECM proteins and cytokines; -the production of connective tissue, with the maturation of collagen fibrils, leads to the formation of new solid extracellular matrix network, which can be used as a scaffold not only for tissue reconstruction, but also for migration of immune cells and for directing new vessels growth. keywords: activity; bass; biologia; cells; control; data; dipartimento; expression; fish; genes; il-1β; immune; increase; italy; labrax; number; padova; presence; proteins; responses; results; role; sea; sequence; species; studies; study; system; teleost; tissue; università; università di cache: isj-93.pdf plain text: isj-93.txt item: #460 of 465 id: isj-94 author: Vetvicka, V; Sima, P title: β-Glucan in invertebrates date: 2004-11-08 words: 4677 flesch: 56 summary: Specific non-self recognition mechanisms of the PPO system, as a basic part of immune defense of invertebrates, are involved during a row of hierarchized processes like cell cooperation and communication in the course of phagocytosis (Smith and Söderhäll, 1983; Söderhäll et al., 1990), nodule and capsule formation (Kobayashi et al., 1990), melanin synthesis (melanization of foreign bodies) and sclerotization (cuticle tanning and hardening) (Lackie, 1988; In crayfish Pacifastacus leniusculus the administration of β-1,3 glucan induces a rapid decrease of hemocytes followed by an accelerated increase of maturation of new cells expressing PPO transcript and their release into circulation (Söderhäll et al., 2003). keywords: activation; binding; biol; defense; et al; glucan; insect; ppo; protein; recognition; system; söderhäll; β-1,3 cache: isj-94.pdf plain text: isj-94.txt item: #461 of 465 id: isj-95 author: Auriemma, R; Battistella, S title: Biochemical and histological alterations of Mytilus galloprovincialis digestive gland after exposure to okadaic acid and derivatives date: 2004-11-24 words: 3580 flesch: 54 summary: This test provides only qualitative information on toxin presence, has a low sensitivity (limit detection 20 µg/100 gr of mussel digestive gland) and can give false positive results. ISJ008.PDF 66 ISJ 1: 66-71, 2004 ISSN 1824-307X Research Report Biochemical and histological alterations of Mytilus galloprovincialis digestive gland after exposure to okadaic acid and derivatives R Auriemma, S Battistella Department of Biology, University of Trieste, Trieste, Italy Accepted November 24, 2004 Abstract Electrophoretical and histological analysis were performed on Mytilus galloprovincialis digestive gland samples, in order to detect the presence of a previously identified protein ca 30 kDa MW, synthesized during Dinophysis spp. keywords: assay; digestive; galloprovincialis; gland; kda; mussels; protein; toxins cache: isj-95.pdf plain text: isj-95.txt item: #462 of 465 id: isj-96 author: Gigliotti, S; Cavaliere, V; Gargiulo, G; Graziani, F; Malva, C title: Molecular genetics of oogenesis in Drosophila melanogaster date: 2004-12-09 words: 6539 flesch: 51 summary: Only one cell within a cyst adopts the oocyte fate, while the remaining 15 develop into nurse cells, which provide the synthetically quiescent oocyte with RNAs and proteins. The programmed cell death of nurse cells shows distinct differences compared to cell death in other Drosophila tissues. keywords: cell; chambers; death; development; drosophila; egg; et al; fig; follicle; germline; hup; nuclear; nurse; oocyte; oogenesis; posterior cache: isj-96.pdf plain text: isj-96.txt item: #463 of 465 id: isj-97 author: Ballarin, L; Menin, A; Franchi, N; Bertoloni, G; Cima, F title: Morula cells and non-self recognition in the compound ascidian Botryllus schlosseri date: 2005-01-25 words: 3189 flesch: 52 summary: Influence of foreign cells on PO activity in the culture medium and cytotoxicity When hemocytes were incubated in the presence of either Bacillus spores or yeast cells, PO activity in the medium significantly increased (p < 0.001 Here, we demonstrate that a change in the morphology of MC occurs in response to the recognition of foreign cells, such as bacterial spores or yeast cells: it is similar to what observed when hemocytes are incubated with blood plasma from genetically incompatible colonies (Ballarin et al., 1998) and, therefore, ascribable to a degranulation event. keywords: anti; ballarin; cells; cytotoxicity; spores cache: isj-97.pdf plain text: isj-97.txt item: #464 of 465 id: isj-98 author: Volpi, N title: Occurrence and structural characterization of heparin from molluscs date: 2005-02-25 words: 6041 flesch: 51 summary: Sinay P. Sugars slide into heparin activity. Heparin binding sites, commonly observed on the external surface of proteins, correspond to shallow pockets of positive charge. keywords: activity; anticoagulant; atiii; binding; et al; fig; heparin; linhardt; mer; phylippinarum; species; sulfate cache: isj-98.pdf plain text: isj-98.txt item: #465 of 465 id: isj-99 author: Parrinello, N; Arizza, V; Cammarata, M; Vazzana, M title: VIIth scientific meeting of the Italian Association for Developmental and Comparative Immunology (IADCI), 10 and 11 February 2005, Consorzio Universitario Provincia di Trapani, Trapani, Italy date: 2005-02-11 words: 8973 flesch: 37 summary: With the aim to study the appearance and distribution of T cells, sea bass TcRβ probes were prepared and used for in situ hybridization studies. In mammals, CD8 is a dimeric membrane-bound glycoprotein, present on cytotoxic T cells and consisting of either CD8 αα homodimers or CD8 αβ heterodimers. keywords: activity; anti; bacteria; bass; cells; cytotoxic; days; effects; expression; fish; gene; hemocytes; immune; immunity; italy; lymphocytes; molecules; non; palermo; pbl; present; response; sea; specific; system; università cache: isj-99.pdf plain text: isj-99.txt