item: #1 of 143 id: cord-000434-ff2zadol author: Zhao, Rongmao title: Identification of a Highly Conserved H1 Subtype-Specific Epitope with Diagnostic Potential in the Hemagglutinin Protein of Influenza A Virus date: 2011-08-19 words: 5789 flesch: 46 summary: The structure and function of the hemagglutinin membrane glycoprotein of influenza virus Influenza vaccines for the future Characterization of a novel influenza hemagglutinin, H15: criteria for determination of influenza A subtypes Manual of Diagnostic Tests and Vaccines for Terrestrial Animals Development of blocking ELISA for detection of antibodies against avian influenza virus of the H7 subtype Development of epitope-blocking ELISA for universal detection of antibodies to human H5N1 influenza viruses A laboratory manual for the isolation and identification of avian pathogens Comparison of the hemagglutination-inhibiting and neutralizing antibody responses of volunteers given 400 chick cellagglutinating units of influenza A/New Jersey/76 split-virus vaccine Role of the laboratory in diagnosis of influenza during seasonal epidemics and potential pandemics Development of rHA1-ELISA for specific and sensitive detection of H9 subtype influenza virus Prokaryotic expression and purification of HA1 and HA2 polypeptides for serological analysis of the 2009 pandemic H1N1 influenza virus Utility of pandemic H1N1 2009 influenza virus recombinant hemagglutinin protein-based enzymelinked immunosorbent assay for serosurveillance Ab and T cell epitopes of influenza A virus, knowledge and opportunities Epitope analysis for influenza vaccine design Quantifying influenza vaccine efficacy and antigenic distance Antigenic characterization of recombinant hemagglutinin proteins derived from different avian influenza virus subtypes Epitope mapping of the hemagglutinin molecule of a highly pathogenic H5N1 influenza virus by using monoclonal antibodies Evaluation of the subtype specificity of monoclonal antibodies raised against H1 and H3 subtypes of human influenza A virus hemagglutinins Establishment of retroviral pseudotypes with influenza hemagglutinins from H1, H3, and H5 subtypes for sensitive and specific detection of neutralizing antibodies Minimum requirements for immunogenic and antigenic activities of homologs of a synthetic peptide of influenza virus hemagglutinin Genetic control and fine specificity of the immune response to a synthetic peptide of influenza virus hemagglutinin Microneutralizing test is an alternative method to type and subtype influenza viruses. keywords: antibodies; antibody; elisa; epitopes; fig; iav; influenza; p31; peptides; subtype; virus cache: cord-000434-ff2zadol.txt plain text: cord-000434-ff2zadol.txt item: #2 of 143 id: cord-001446-mpuovmeb author: Bratcher, Preston E. title: Factors Influencing the Measurement of Plasma/Serum Surfactant Protein D Levels by ELISA date: 2014-11-03 words: 4876 flesch: 37 summary: Integrating lung and plasma expression of pneumo-proteins in developing biomarkers in COPD: a case study of surfactant protein D Ageing and smoking contribute to plasma surfactant proteins and protease imbalance with correlations to airway obstruction Inflammatory biomarkers improve clinical prediction of mortality in chronic obstructive pulmonary disease Budesonide/formoterol enhances the expression of pro Surfactant Protein-B in lungs of COPD patients Exhaled metallic elements and serum pneumoproteins in asymptomatic smokers and patients with COPD or asthma Circulating surfactant protein D as a potential lung-specific biomarker of health outcomes in COPD: a pilot study The effects of fluticasone with or without salmeterol on systemic biomarkers of inflammation in chronic obstructive pulmonary disease Serum surfactant protein D is steroid sensitive and associated with exacerbations of COPD Serum surfactant protein D during acute exacerbations of chronic obstructive pulmonary disease Comprehensive characterisation of pulmonary and serum surfactant protein D in COPD Serum surfactant protein D: biomarker of chronic obstructive pulmonary disease Value of serum and induced sputum surfactant protein-D in chronic obstructive pulmonary disease Surfactant protein d, soluble intercellular adhesion molecule-1 and highsensitivity C-reactive protein as biomarkers of chronic obstructive pulmonary disease The role of matrix metalloproteinase-9 in cigarette smoke-induced emphysema Surfactant protein D in serum from patients with allergic bronchopulmonary aspergillosis Serum-surfactant SP-D correlates inversely to lung function in cystic fibrosis Circulating surfactant protein-D and the risk of cardiovascular morbidity and mortality The utility of lung epithelium specific biomarkers in cardiac surgery: a comparison of biomarker profiles in on-and off-pump coronary bypass surgery Can serum surfactant protein D or CC-chemokine ligand 18 predict outcome of interstitial lung disease in patients with early systemic sclerosis? Serum levels of surfactant proteins A and D are useful biomarkers for interstitial lung disease in patients with progressive systemic sclerosis Clinical significance of surfactant protein D as a serum marker for evaluating pulmonary fibrosis in patients with systemic sclerosis Comparative study of serum surfactant protein-D and KL-6 concentrations in patients with systemic sclerosis as markers for monitoring the activity of pulmonary fibrosis Surfactant protein D and KL-6 as serum biomarkers of interstitial lung disease in patients with scleroderma Clinical significance of serum pulmonary surfactant proteins a and d for the early detection of radiation pneumonitis Diagnostic significance of surfactant proteins A and D in sera from patients with radiation pneumonitis Study of Clara cell 16, KL-6, and surfactant protein-D in serum as disease markers in pulmonary sarcoidosis Serum surfactant protein D is elevated in allergic patients Involvement of eicosanoids and surfactant protein D in extrinsic allergic alveolitis Functional and biological characteristics of asthma in cleaning workers Circulating surfactant protein D is decreased in early rheumatoid arthritis: a 1-year prospective study Circulating surfactant protein -D is low and correlates negatively with systemic inflammation in early, untreated rheumatoid arthritis Elevated plasma surfactant protein D (SP-D) levels and a direct correlation with anti-severe acute respiratory syndrome coronavirus-specific IgG antibody in SARS patients Analysis of plasma surfactant protein D levels in lung transplant recipients Clinical significance of the serum surfactant protein D and KL-6 levels in patients with measles complicated by interstitial pneumonia Surfactant protein D (SP-D) serum levels in patients with community-acquired pneumonia small star, filled Serum SP-D levels as a biomarker of lung injury in respiratory syncytial virus bronchiolitis Serum KL-6 and surfactant protein D in children with 2009 pandemic H1N1 influenza infection Serum KL-6 and surfactant proteins A and D in pediatric interstitial lung disease Polymorphisms in the human surfactant protein-D (SFTPD) gene: strong evidence that serum levels of surfactant protein-D (SP-D) are genetically influenced Surfactant protein d, a marker of lung innate immunity, is positively associated with insulin sensitivity Circulating levels of Clara cell protein 16 but not surfactant protein D identify and quantify lung damage in patients with multiple injuries Blood biomarkers and measures of pulmonary function-a study from the Swedish twin registry Surfactant protein D of the innate immune defence is inversely associated with human obesity and SP-D deficiency infers increased body weight in mice Long-term stability and circadian variation in circulating levels of surfactant protein D A common polymorphism in the SFTPD gene influences assembly, function, and concentration of surfactant protein D Plasma surfactant protein D levels and the relation to body mass index in a chinese population Plasma C3d levels of young farmers correlate with respirable dust exposure levels during normal work in swine confinement buildings Respiratory effects associated with wood fuel use: a cross-sectional biomarker study among adolescents Roles of serum clara cell protein 16 and surfactant protein-D in the early diagnosis and progression of silicosis Serum surfactant protein-A, but not surfactant protein-D or KL-6, can predict preclinical lung damage induced by smoking Biomarkers of early respiratory effects in smoking adolescents Circulating markers of interstitial lung disease and subsequent risk of lung cancer Inhaled LPS challenges in smokers: a study of pulmonary and systemic effects Lung epithelium injury biomarkers in workers exposed to sulphur dioxide in a nonferrous smelter The effects of GH and hormone replacement therapy on serum concentrations of mannan-binding lectin, surfactant protein D and vitamin D binding protein in Turner syndrome Plasma surfactant D in patients following acute paraquat intoxication Respiratory function and changes in lung epithelium biomarkers after a short-training intervention in chlorinated vs. ozone indoor pools A panel of lung injury biomarkers enhances the definition of primary graft dysfunction (PGD) Surfactant protein D in atopic dermatitis and psoriasis Plasma surfactant protein levels and clinical outcomes in patients with acute lung injury Effects of leukoreduced blood on acute lung injury after trauma: a randomized controlled trial Surfactant phospholipids, surfactant proteins, and inflammatory markers during acute lung injury in children Prognostic and pathogenetic value of combining clinical and biochemical indices in patients with acute lung injury Plasma CC16 levels are associated with development of ALI/ARDS in patients with ventilator-associated pneumonia: a retrospective observational study Plasma levels of surfactant protein D and KL-6 for evaluation of lung injury in critically ill mechanically ventilated patients Plasma biomarker profiles in acute exacerbation of idiopathic pulmonary fibrosis Biomarkers of lung epithelial injury and inflammation distinguish severe sepsis patients with acute respiratory distress syndrome Serum surfactant proteins-A and -D as biomarkers in idiopathic pulmonary fibrosis Serial changes in surfactant-associated proteins in lung and serum before and after onset of ARDS Increased plasma concentration of surfactant protein D in chronic periodontitis independent of SFTPD genotype: potential role as a biomarker Effect of single vs bilateral lung transplantation on plasma surfactant protein D levels in idiopathic pulmonary fibrosis Pulmonary surfactant protein D in sera and bronchoalveolar lavage fluids Enzymelinked immunosorbent assay using F(ab')2 fragment for the detection of human pulmonary surfactant protein D in sera Comparative study of KL-6, surfactant protein-A, surfactant protein-D, and monocyte chemoattractant protein-1 as serum markers for interstitial lung diseases Increased circulating levels of soluble Fas ligand are correlated with disease activity in patients with fibrosing lung diseases Monitoring markers of disease activity for interstitial lung diseases with serum surfactant proteins A and D Clinical importance of bronchoalveolar lavage fluid and blood cytokines, surfactant protein D, and Kerbs von Lungren 6 antigen in idiopathic pulmonary alveolar proteinosis Significance of serum vascular endothelial growth factor level in patients with idiopathic pulmonary fibrosis Pneumocyte biomarkers KL-6 and surfactant protein D reflect the distinct findings of high-resolution computed tomography in nonspecific interstitial pneumonia keywords: antibody; elisa; levels; lung; plasma; protein; serum; surfactant cache: cord-001446-mpuovmeb.txt plain text: cord-001446-mpuovmeb.txt item: #3 of 143 id: cord-001521-l36f1gp7 author: None title: Oral and Poster Manuscripts date: 2011-04-08 words: 183853 flesch: 46 summary: The concept that swine are a mixing-vessel for the reassortment of influenza viruses and for the emergence of pandemic influenza viruses has been re-enforced by the emergence of the recent pandemic. This study was supported by Contract HHSN266200700005C from the National Institute of Allergy and Infectious Diseases, National Institutes of Pigs have been considered as hypothetical 'mixing vessels' facilitating the genesis of pandemic influenza viruses. keywords: age; analysis; animals; antibodies; antibody; antiviral; assay; associated; avian; b viruses; b ⁄; balb ⁄; binding; c virus; c ⁄; cases; cells; challenge; children; control; cross; culture; data; days; detection; disease; dk ⁄; dose; effect; ferrets; figure; following; gene; group; h1n1 influenza; h1n1 pandemic; h1n1 virus; h5n1 infection; h5n1 viruses; h9n2; health; high; hong; hours; human h1n1; human influenza; humans; immunity; infected; infections; influenza antigenic; influenza c; influenza epidemic; influenza infection; influenza influenza; influenza neuraminidase; influenza outbreaks; influenza pandemic; influenza patients; influenza research; influenza samples; influenza season; influenza strains; influenza surveillance; influenza transmission; influenza vaccination; influenza vaccine; influenza virus; isolates; kong ⁄; laboratory; laiv; lg ⁄; like; low; lung; mallard ⁄; mdck; method; mg ⁄; mice; model; mutation; nasal; new; non; novel; number; observed; origin influenza; oseltamivir; patients; pcr; period; pigs; population; positive; post; potential; potsdam ⁄; protection; protein; public; rate; research; resistance; respiratory; response; results; risk; rna; samples; school; seasonal; sensitivity; sequence; serum; severe; specific; specimens; studies; study; subjects; subtype influenza; sw ⁄; swine influenza; swine viruses; system; t ⁄; table; test; time; treatment; type virus; vaccines; values; virus gene; virus infection; virus isolation; virus ns1; virus replication; virus strains; virus titers; virus transmission; virus vaccine; virus ⁄; viruses; wave; years; ⁄ brisbane; ⁄ california; ⁄ genoa; ⁄ h1n1; ⁄ h3n2; ⁄ h5n1; ⁄ hk; ⁄ hok; ⁄ lee; ⁄ leningrad; ⁄ ml; ⁄ netherlands; ⁄ ns1; ⁄ panama; ⁄ pr8; ⁄ vietnam cache: cord-001521-l36f1gp7.txt plain text: cord-001521-l36f1gp7.txt item: #4 of 143 id: cord-003208-lwirkob3 author: Yan, Liping title: Novel protein chip for the detection of antibodies against infectious bronchitis virus date: 2018-09-17 words: 3979 flesch: 47 summary: To further evaluate IBV nsp5 protein chip, 186 clinical serum samples were detected by the IBV nsp5 protein chip and the nsp5 ELISA antibody test kit. The agar gel precipitation test is used in IBV antibody detection; however, this method has low sensitivity. keywords: antibodies; detection; ibv; nsp5; positive; protein; samples; serum; virus cache: cord-003208-lwirkob3.txt plain text: cord-003208-lwirkob3.txt item: #5 of 143 id: cord-003315-r1wkx0ml author: Jacobs, Sophie title: Species Specificity of Type III Interferon Activity and Development of a Sensitive Luciferase-Based Bioassay for Quantitation of Mouse Interferon-λ date: 2018-11-01 words: 6248 flesch: 52 summary: Species specificity index was calculated as the ratio between the relative antiviral activity on cells of homologous to nonhomologous species (eg, for mouse IFN: relative activity in mouse cells/relative activity in human cells). IFN activity was measured in Fawa-l-luc cells for IFN concentrations that yielded equivalent luciferase activities (20,000 RLU) before UV treatment (250 pg/mL mIFN-l2 and mIFN-l3, 125 pg/mL human IFN-l1, 10 ng/mL huIFN-l2, 500 pg/mL huIFN-l3, and 62.5 pg/mL huIFN-l4). keywords: activity; assay; cells; detection; human; ifn; ifns; iii; mouse; mouse ifn; samples; species; type cache: cord-003315-r1wkx0ml.txt plain text: cord-003315-r1wkx0ml.txt item: #6 of 143 id: cord-003471-tr3ageky author: Gaikwad, Satish S. title: Expression and serological application of recombinant epitope-repeat protein carrying an immunodominant epitope of Newcastle disease virus nucleoprotein date: 2019-01-31 words: 3405 flesch: 47 summary: Specificity and sensitivity of recombinant protein was evaluated. The construct designed to express recombinant protein was codon optimized for Sf9 cells. keywords: anti; baculovirus; chicken; elisa; epitope; ndv; protein; rerp; sera; serum cache: cord-003471-tr3ageky.txt plain text: cord-003471-tr3ageky.txt item: #7 of 143 id: cord-003623-n01rgqyv author: Schuh, Amy J. title: Comparative analysis of serologic cross-reactivity using convalescent sera from filovirus-experimentally infected fruit bats date: 2019-04-30 words: 6366 flesch: 30 summary: The mean group adjusted sum OD values ranged from 3.43 (±1.77 SD) for the IgG antibody indirect ELISA using Marburg virus antigen to 5.69 (±2.06 SD) for the IgG antibody indirect ELISA using Ebola virus antigen. Modelling filovirus maintenance in nature by experimental transmission of Marburg virus between Egyptian rousette bats Egyptian rousette bats maintain long-term protective immunity against Marburg virus infection despite diminished antibody levels Clinical virology of Ebola hemorrhagic fever (EHF): virus, virus antigen, and IgG and IgM antibody findings among EHF patients in Kikwit, Democratic Republic of the Congo ELISA for the detection of antibodies to Ebola viruses Serologic cross-reactivity of human IgM and IgG antibodies to five species of Ebola virus Enzyme-linked immunosorbent assay for detection of filovirus species-specific antibodies Serological evidence of Ebola virus infection in Indonesian orangutans Human survivors of disease outbreaks caused by Ebola or Marburg virus exhibit cross-reactive and long-lived antibody responses Development of a sensitive and specific serological assay based on Luminex technology for detection of antibodies to Zaire Ebola virus False-positive results in a recombinant severe acute respiratory syndrome-associated coronavirus (SARS-CoV) nucleocapsid enzyme-linked immunosorbent assay due to HCoV-OC43 and HCoV-229E rectified by Western blotting with recombinant SARS-CoV spike polypeptide Cross-reactivity between caprine arthritisencephalitis virus and type 1 human immunodeficiency virus Variability in seroprevalence of rabies virus neutralizing antibodies and associated factors in a Colorado population of big brown bats (Eptesicus fuscus) Serologic survey of Eptesicus fuscus from Georgia, USA for Rickettsia and Borrelia and laboratory transmission of a Rickettsia by bat ticks Coronavirus antibodies in African bat species Immunogenicity difference between the SARS coronavirus and the bat SARS-like coronavirus spike (S) proteins Bats worldwide carry hepatitis E virus-related viruses that form a putative novel genus within the family. keywords: antibody; antigen; antisera; bats; ebola; filovirus; igg; indirect; infection; marburg; reactivity; serological; species; system cache: cord-003623-n01rgqyv.txt plain text: cord-003623-n01rgqyv.txt item: #8 of 143 id: cord-003656-7mzsaz7a author: Wium, Martha title: DNA Vaccines Against Mycoplasma Elicit Humoral Immune Responses in Ostriches date: 2019-05-14 words: 5578 flesch: 45 summary: Elsenburg: Western Cape Department of Agriculture Cross-protection among lethal H5N2 influenza viruses induced by DNA vaccine to the hemagglutinin Protective efficacy of DNA vaccines against duck hepatitis B virus infection Turkeys are protected from infection with Chlamydia psittaci by plasmid DNA vaccination against the major outer membrane protein DNA vaccination in the avian A DNA prime-protein boost vaccination strategy targeting turkey coronavirus spike protein fragment containing neutralizing epitope against infectious challenge Protection of chickens against infectious bronchitis virus with a multivalent DNA vaccine and boosting with an inactivated vaccine Induction of a protective response in ducks vaccinated with a DNA vaccine encoding engineered duck circovirus Capsid protein Sequential DNA immunization of chickens with bivalent heterologous vaccines induce highly reactive and cross-specific antibodies against influenza hemagglutinin key: cord-003656-7mzsaz7a authors: Wium, Martha; Jonker, Hester Isabella; Olivier, Adriaan Jacobus; Bellstedt, Dirk Uwe; Botes, Annelise title: DNA Vaccines Against Mycoplasma Elicit Humoral Immune Responses in Ostriches date: 2019-05-14 journal: keywords: antigen; dna; infections; mycoplasma; oppa; ostriches; pci; plasmid; protein; response; trial; vaccination; vaccine; week cache: cord-003656-7mzsaz7a.txt plain text: cord-003656-7mzsaz7a.txt item: #9 of 143 id: cord-003859-k8wfyj9b author: Paweska, Janusz T. title: Evaluation of Diagnostic Performance of Three Indirect Enzyme-Linked Immunosorbent Assays for the Detection of IgG Antibodies to Ebola Virus in Human Sera date: 2019-07-24 words: 6410 flesch: 43 summary: Impact on outbreak response, case management and laboratory systems strengthening Lateral flow immunoassays for Ebola virus disease detection in Liberia Comparative performance of four rapid Ebola antigen-detection lateral flow immunoassays during the 2014-2016 Ebola epidemic in West Africa Serologic cross-reactivity of human IgM and IgG antibodies to five species of Ebola virus Serological investigation of laboratory-confirmed and suspected Ebola virus disease patients during the late phase of the Ebola outbreak in Sierra Leone Production of antigens for ELISA Analysis of linear B-cell epitopes of the nucleoprotein of Ebola virus that distinguish Ebola virus subtypes Sequence analysis of the Ebola virus genome: Organization, genetic elements, and comparison with the genome of Marburg virus Enzyme-linked immunosorbent assays for detection of antibodies to Ebola and Marburg viruses using recombinant nucleoproteins Human survivors of disease outbreaks caused by Ebola or Marburg virus exhibit cross-reactive and long-lived antibody responses Enzyme-linked immunosorbent assay for detection of filovirus species-specific antibodies Protective efficacy of neutralizing antibodies against Ebola virus infection Recombinant Ebola virus nucleoprotein and glycoprotein (Gabon 94 strain) provide new tools for the detection of human infections Serological reactivity of baculovirus-expressed Ebola virus VP35 and nucleoproteins Nucleoprotein-based indirect enzyme-linked immunosorbent assay (indirect ELISA) for detecting antibodies specific to Ebola virus and Marburg virus Quantitative serology assays for determination of antibody responses to Ebola virus glycoprotein and matrix protein in nonhuman primates and humans Recombinant protein expression in Escherichia coli: Advances and challenges Engineering N-glycosylation pathways in the baculovirus-insect cell system Asymptomatic infection and unrecognised Ebola virus disease in Ebola-affected households in Sierra Leone: A cross-sectional study using a new non-invasive assay for antibodies to Ebola virus Standardization of the filovirus plaque assay for use in preclinical studies South African Ebola diagnostic response in Sierra Leone: A modular high biosafety field laboratory Diagnostic reverse-transcription polymerase chain reaction kit for filoviruses based on the strain collections of all European biosafety level 4 laboratories World Health Organization. Ebola virus disease in West Africa-the first 9 months of the epidemic and forward projections World Health Organization-Ebola virus Disease-Democratic Republic of the Congo DRC Ebola outbreak crisis update 11 313 unnecessary Ebola-related deaths: keywords: control; cut; ebola; ebov; elisa; igg; negative; sera; serum; virus; wag cache: cord-003859-k8wfyj9b.txt plain text: cord-003859-k8wfyj9b.txt item: #10 of 143 id: cord-004101-0r2g5p1i author: Wang, Yu title: Self-assembly into virus–like particles of the recombinant capsid protein of porcine circovirus type 3 and its application on antibodies detection date: 2020-01-07 words: 4245 flesch: 50 summary: Currently, PCV3 Cap proteins harvested from insect cells or E. coli have been used as antigens to detect PCV3-specific antibodies in an ELISA (Deng et al. 2018; Zhang et al. 2019 ). Opti-eCap-1 was fully optimized for the full-length gene of PCV3 Cap protein based on factors such as codon bias and GC content, while opti-eCap-2 and opti-eCap-3 were partially optimized. keywords: ecap; elisa; opti; particles; pcv3; porcine; serum; virus; vlps cache: cord-004101-0r2g5p1i.txt plain text: cord-004101-0r2g5p1i.txt item: #11 of 143 id: cord-006828-i88on326 author: None title: Abstracts DGRh-Kongress 2013 date: 2013-09-15 words: 30854 flesch: 47 summary: Es zeigen sich keine signifikanten Unterschiede in der Krankheitsaktivität der beiden Gruppen (vor Einleitung der ADA-Therapie nach DMARD-und nach anti-TNF-Versagen). key: cord-006828-i88on326 authors: nan title: Abstracts DGRh-Kongress 2013 date: 2013-09-15 journal: Z Rheumatol DOI: 10.1007/s00393-013-1255-1 sha: doc_id: 6828 cord_uid: i88on326 nan im Namen der DGRh, der DGORh und der GKJR begrüßen wir Sie ganz herzlich zu unserem diesjährigen Kongress Visualisierung therapeutischer Effekte von Vasodilatantien beim sekundären Raynaud-Syndrom mittels fluoreszenzoptischer Bildgebung DI.14 Stellenwert der Gelenksonographie bezüglich Diagnose, Behandlung und Therapiekontrolle der Bursitis intermetatarsalis -einer häufig übersehenen Differenzialdiagnose. keywords: abatacept; active; activity; adiponectin; als; analysis; anti; antibodies; arthritis; auch; auf; b cells; background; baseline; bei; bei der; blood; bone; cd4; cells; changes; conclusion; das; das28; data; days; den; der; des; die; disease; dose; effects; eine; elisa; expression; für; human; hypoxia; ifn; igg; il-6; immune; inflammation; ist; joint; levels; lupus; marrow; methods; mice; mit; monocytes; months; mri; mtx; nach; new; non; patienten; patients; plasma; plasma cells; positive; production; progression; ra patients; receptor; remission; response; results; rheumatoid; role; serum; sich; sle; sle patients; sowie; stimulation; study; synovial; t cells; therapie; therapy; time; tnf; treatment; und; von; week; werden; wurde; years; zur cache: cord-006828-i88on326.txt plain text: cord-006828-i88on326.txt item: #12 of 143 id: cord-006860-a3b8hyyr author: None title: 40th Annual Meeting of the GTH (Gesellschaft für Thrombose- und Hämostaseforschung) date: 1996 words: 90772 flesch: 46 summary: The data show that children with low risk did in part receive higher doses of heparin and/or AT III concentrate than did high risk patients, whereas plasma therapy was adjusted to severity of eoagnlopathy. Inhibitor testing was done on patients plasma samples using the Bethesda method. keywords: activation; activity; acute; addition; age; agents; aggregation; analysis; antibodies; anticoagulant; anticoagulation; antigen; antithrombin; apc; aptt; assay; binding; bleeding; blood; blood coagulation; blood samples; cases; cells; children; clinical; clotting; coagulation; coagulation factor; complex; complications; concentrations; conclusion; contrast; control; coronary; correlation; count; data; day; days; deficiency; diagnosis; disease; dose; effect; elevated; endothelial; events; expression; factor; factor v; factor viii; family; fibrin; fibrinogen; formation; group; heparin; hirudin; hours; human; incidence; increase; influence; infusion; inhibitor; inr; laboratory; levels; low; mean; median; method; months; mutation; normal; order; parameters; patients; period; phase; plasma; plasma samples; plasminogen; platelet; platelet activation; platelet factor; present; products; protein; protein c; prothrombin; pts; range; reagent; receptor; reduced; release; resistance; response; results; risk; risk factor; role; samples; specific; studies; study; surface; surgery; system; test; therapy; thrombin; thrombosis; time; tissue; total; treatment; type; use; values; vascular; vein; venous; viii; vwf; weight; years cache: cord-006860-a3b8hyyr.txt plain text: cord-006860-a3b8hyyr.txt item: #13 of 143 id: cord-007480-grndfx7b author: Koopmans, M. title: Seroepidemiology of Breda virus in cattle using ELISA date: 2002-11-13 words: 3366 flesch: 50 summary: In view of the regular occurrence of winter dysentery in The Netherlands, we were interested to know whether seroconversion to Breda virus antigens would occur. Detection of Breda virus antigen and antibody in humans and animals by enzyme immunoassay Prevalence of rotavirus and coronavirus antigens in the feces of normal cows Introduction to Statistical Analysis. keywords: antibodies; blocking; calves; elisa; sera; virus cache: cord-007480-grndfx7b.txt plain text: cord-007480-grndfx7b.txt item: #14 of 143 id: cord-007495-gpz4gkv3 author: Weiss, M. title: Antibodies to berne virus in horses and other animals date: 2002-11-13 words: 2119 flesch: 45 summary: key: cord-007495-gpz4gkv3 authors: Weiss, M.; Steck, F.; Kaderli, R.; Horzinek, M.C. title: Antibodies to berne virus in horses and other animals date: 2002-11-13 journal: Vet Microbiol DOI: 10.1016/0378-1135(84)90014-2 sha: doc_id: 7495 cord_uid: gpz4gkv3 After inoculation into 2 foals, Berne virus induced neutralizing antibody, but did not cause clinical symptoms. Berne virus was shown to be serologically unrelated to known equine viruses as well as to representatives of the 3 main antigenic clusters of the Coronaviridae family (infectious bronchitis, mouse hepatitis and transmissible gastroenteritis viruses), which it resembles superficially in negatively stained preparations. keywords: berne; neutralization; sera; virus cache: cord-007495-gpz4gkv3.txt plain text: cord-007495-gpz4gkv3.txt item: #15 of 143 id: cord-007497-nn5l5rai author: Garcia-Sanchez, J. title: Survey of rotavirus infection in a dairy herd: comparison between polycrylamide gel electrophoresis and two commercial tests date: 2002-11-13 words: 3581 flesch: 49 summary: latex agglutination for detection of rotavirus in faecal specimens Quantitative observations on experimental reo-like virus (rotavirus) infection in colostrum-deprived calves An assessment of the sensitivity of three methods for the detection of rotavirus Longitudinal survey of rotavirus infection in calves Comparison of six commercial kits for the diagnosis of rotavirus infection in man and calves Pathogenic relationships of rotavirus, Escherichia coli and other agents in mixed infections in calves Comparison of six methods for detecting human rotavirus in stools A survey on bovine rotavirus type l-associated neonatal calf diarrhea in a beef herd Direct appraisal of latex agglutination testing, a convenient alternative to enzyme immunoassay for the detection of rotavirus in childhood gastroenteritis, by comparison of two enzyme immunoassays and two latex tests ELISA for the detection of rotavirus and rotavirus/antibody complexes in faeces A follow-up study on bovine rotavirus dissemination among calves of a large dairy herd Rotavirus and enterotoxigenic Escherichia coli infections of calves on a closed finnish dairy farm Evaluation of seven immunoassays for detection of rotavirus in pediatric stool samples The aetiology and diagnosis of calf diarrhoea Epizootology of bovine rotavirus infection Viral enteritis of calves Morphological and antigenic relationships between viruses (rotaviruses) from acute gastroenteritis of children, calves, piglets, mice and foals key: cord-007497-nn5l5rai authors: Garcia-Sanchez, J.; Corral, C.; Halaihel, N.G.; Simon, M.C.; Alonso, J.L.; Muzquiz, J.L.; Ortega, C.; Girones, O. title: Survey of rotavirus infection in a dairy herd: comparison between polycrylamide gel electrophoresis and two commercial tests date: 2002-11-13 journal: Vet Microbiol DOI: 10.1016/0378-1135(93)90057-e sha: doc_id: 7497 cord_uid: nn5l5rai A survey of rotavirus infection in a dairy herd with a history of neonatal diarrhoea was carried out. keywords: calves; faeces; latex; page; rotavirus; samples cache: cord-007497-nn5l5rai.txt plain text: cord-007497-nn5l5rai.txt item: #16 of 143 id: cord-007644-7bsixsgd author: Chirnside, E.D. title: Development and evaluation of an ELISA using recombinant fusion protein to detect the presence of host antibody to equine arteritis virus date: 2000-04-04 words: 4059 flesch: 38 summary: Naunyn-Schmiedebergs Arch Lactate dehydrogenaseelevating virus (LDV): subgenomic mRNAs, mRNA leader and comparison of 3'terminal sequences of two LDV isolates The recovery of virus from horses with experimental cases of equine arteritis using monolayer cell cultures of equine kidney Responses of vaccinated and non-vaccinated mares to artificial insemination with semen from stallions persistently infected with equine arteritis virus Lelystad virus, the causative agent of porcine epidemic abortion and respiratory syndrome (PEARS), is related to LDV and EAV Analysis of genetic variation among strains of equine arteritis virus Genomic variability among globally distributed isolates of equine arteritis virus Persistent infection of the reproductive tract of stallions persistently infected with equine arteritis virus Serological evidence of equine arteritis virus in donkeys in South Africa Lactate dehydrogenase-elevating virus, equine arteritis virus and simian hemorrhagic fever virus: a new group of positive-strand RNA viruses Molecular Cloning: A Laboratory Manual Equine viral arteritis: a standard procedure for the virus neutralisation test and comparison of results of a proficiency test performed at five laboratories Single-step purification of polypeptides expressed in Escherichia coli as fusion proteins with glutathioneS-transferase The coronaviruslike superfamily Demonstration of the carrier state in naturally acquired equine arteritis virus infection in the stallion Fatal, congenitally acquired infection with equine arteritis virus in a neonatal Thoroughbred The first recorded outbreak of equine viral arteritis virus in the United Kingdom Laboratory-based serological tests include EAV virus neutralization test (NT), complement fixation (CF) and enzyme-linked immunosorbent assay (ELISA) (Senne et al., 1985; Fukunaga and McCollum, 1977; Cook et al, 1989) . keywords: arteritis; eav; elisa; equine; neutralizing; protein; sera; virus cache: cord-007644-7bsixsgd.txt plain text: cord-007644-7bsixsgd.txt item: #17 of 143 id: cord-009784-kxa68zbc author: Bolton, Jessica S. title: Comparison of ELISA with electro-chemiluminescence technology for the qualitative and quantitative assessment of serological responses to vaccination date: 2020-04-17 words: 6179 flesch: 43 summary: Second, to assess linearity directly, the change in signal intensity (Intensity, I) was calculated as a result of a change in antibody concentration (Concentration, C), or ΔIntensity/ΔConcentration, across the range of antibody concentrations and dilutions measured. To determine whether there was a systematic trend in the difference between ECLIA and ELISA titres (ECLIA titre-ELISA titre) as a function of antibody concentration ((ECLIA titre + ELISA titre)/2), a linear regression analysis using lm function was carried out in the R statistical package. keywords: antibody; antigens; assay; concentration; csp; dilutions; eclia; elisa; malaria; range; serum; titres cache: cord-009784-kxa68zbc.txt plain text: cord-009784-kxa68zbc.txt item: #18 of 143 id: cord-009877-3cyz6o9c author: Barclay, Wendy S. title: Evaluation of an enzyme‐linked immunosorbent assay that measures rhinovirus‐specific antibodies in human sera and nasal secretions date: 2005-12-07 words: 3092 flesch: 44 summary: Prophylaxis and treatment of rhinovirus colds with zinc gluconate lozenges An ELISA for the detection of rhinovirus specific antibody in serum and nasal secretion Chemoprophylaxis and Virus Infections of the Respiratory Tract Effect of specific humoraI immunity and some non-specific factors on resistance of volunteers to respiratory coronavirus infection The common cold: Control? Our data confirm the importance of IgA anti-rhinovirus immunoglobulins in protection against re-infection and/or illness; we provide evidence that a rise in specific serum IgA following infection is a good indicator of a recent infection. keywords: antibody; elisa; hrv-2; iga; serum; volunteers cache: cord-009877-3cyz6o9c.txt plain text: cord-009877-3cyz6o9c.txt item: #19 of 143 id: cord-009922-t1hoox6e author: Dearden, C. J. title: Direct detection of rhinoviruses by an enzyme‐linked immunosorbent assay date: 2005-12-07 words: 4078 flesch: 50 summary: Of 36 clinical specimens tested by virus isolation, cell‐culture‐amplified (CCA) ELISA, and direct ELISA, 15 were positive by isolation, 11 by CCA‐ELISA, and 11 by direct ELISA. The overall correlation of the CCA and direct ELISA techniques with virus isolation was found to be 88.9% and 66.7%, respectively. keywords: antigen; control; elisa; hrv; isolation; rhinovirus; test; virus cache: cord-009922-t1hoox6e.txt plain text: cord-009922-t1hoox6e.txt item: #20 of 143 id: cord-010247-cug21fnf author: Hollingshead, Melinda G. title: An ELISA system for evaluating antiretroviral activity against Rauscher murine leukemia virus date: 1992-06-15 words: 2423 flesch: 46 summary: Each well then received XC cells (Svoboda, 1961) . Chemotherapy of virus-induced lymphoid leukemia An improved murine leukemia virus immunofluorescence assay An enzyme immunoassay for dengue antibody using infected cultured mosquito cells as antigen Clonal cell lines from a feral mouse embryo which lack hostrange restrictions for murine leukemia viruses Bovine viral diarrhea virusinfected MDBK monolayer as antigen in enzyme-linked immunosorbent assay (ELISA) for the measurement of antibodies in bovine sera Rapid colorimetric assay for cellular growth and survival application to proliferation and cytotoxicity assays A plaque assay for murine leukemia virus using enzyme-coupled antibodies A virus-induced disease of mice characterized by erythrocytopoiesis and lymphoid leukemia In situ hybridization: general infectivity assay for retroviruses Rapid herpes simplex virus susceptibility testing using an enzyme-linked immunosorbent assay performed in situ on fixed virus-infected monolayers Suppression of retroviral propagation and disease by suramin in murine systems Suppression of mouse viraemia and retroviral disease by 3'-azido-3'-deoxythymidine Radioimmunoassay of mammalian type C viral proteins I. Species-specific reactions ofmurine and feline viruses Inhibition of Gross leukemia virus-induced plaque formation in XC cells by 3-deazauridine Use of a focal immunofluorescence assay on live cells for quantitation of retroviruses: distinction of host range classes in virus mixtures and biological cloning of dual-tropic murine leukemia viruses Two enzyme immunoassays for the detection of antibody to rodent coronaviruses A new method for titration of murine leukemia virus using purothionin A This work was supported by Contract N01-CM8-7274 from the National Cancer Institute. keywords: assay; cells; elisa; reduction; virus cache: cord-010247-cug21fnf.txt plain text: cord-010247-cug21fnf.txt item: #21 of 143 id: cord-010578-uib9h1lb author: Mawle, Alison C. title: Seroepidemiology of Chronic Fatigue Syndrome: A Case-Control Study date: 1995-12-17 words: 2573 flesch: 45 summary: Reports that viral antibody titers are elevated in CFS cases has led to the speculation that latent viruses may be reactivated in this illness as a result of an underlying perturbation of immune function, and that elevated titers of antibody to common agents may be a reflection of this disturbance. Epstein-Barr virus (EBV) early antigen antibody titers were determined with a commercial ELISA (Gull Laboratories, Salt Lake City), and a titer of~I: 10 was considered positive. keywords: agents; antibodies; antibody; cases; cfs; controls; infection; patients; virus cache: cord-010578-uib9h1lb.txt plain text: cord-010578-uib9h1lb.txt item: #22 of 143 id: cord-011212-ovjdzyxv author: Pan, Qing title: Development and application of a novel ELISA for detecting antibodies against group I fowl adenoviruses date: 2019-12-14 words: 3891 flesch: 33 summary: However, there are currently no commercial FAdV-I or FAdV-4 ELISA kits in China for detection of antibodies against the pathogenic FAdVs or FAdV-4 specifically. SPF chicken serum as negative control; FAdV-4 positive serum as positive control Fig. keywords: adenovirus; antibodies; chickens; elisa; fadv; fadv-4; fowl; serotypes cache: cord-011212-ovjdzyxv.txt plain text: cord-011212-ovjdzyxv.txt item: #23 of 143 id: cord-011840-neowfhwg author: Liu, Weixiao title: Development of a sensitive monoclonal antibody-based sandwich ELISA to detect Vip3Aa in genetically modified crops date: 2020-03-05 words: 3932 flesch: 46 summary: ELISA is a specific, sensitive, and convenient method for protein detection. To the best of our knowledge, this is the first quantitative monoclonal antibody-based ELISA method reported for the sensitive detection of Vip3Aa proteins. keywords: antibody; crops; detection; elisa; method; monoclonal; proteins; vip3aa20 cache: cord-011840-neowfhwg.txt plain text: cord-011840-neowfhwg.txt item: #24 of 143 id: cord-012891-heqsfzkm author: Blanco Vázquez, Cristina title: Detection of latent forms of Mycobacterium avium subsp. paratuberculosis infection using host biomarker-based ELISAs greatly improves paratuberculosis diagnostic sensitivity date: 2020-09-03 words: 7838 flesch: 38 summary: Logistic regression analysis indicated that biomarker FAM84A was excluded and biomarkers DES, ABCA13, MMP8 and SPARC-based ELISAs included in the diagnostic model for discrimination of infected animals and non-infected control animals. Up-regulation of MMP-8 expression in peripheral blood of MAP infected animals may indicate that MMP-8 plays an important role in the inflammation and destruction of tissue observed in the development of PTB. SPARC, also known as osteonectin, is a matrix protein that binds collagen, and is required for the development of granuloma-like structures during chronic infections keywords: abca13; animals; control; detection; diffuse; elisa; fecal; lesions; map; mmp8; ptb; sensitivity; sparc cache: cord-012891-heqsfzkm.txt plain text: cord-012891-heqsfzkm.txt item: #25 of 143 id: cord-013348-lsksys56 author: Goto, Keiko title: Development of Monoclonal Antibodies and Antigen-Capture ELISA for Human Parechovirus Type 3 date: 2020-09-19 words: 4782 flesch: 45 summary: Epitope mapping showed that these mAbs recognized three distinct domains in HPeV3 VP0. Recently, Chen et al. generated polyclonal antibodies for HPeV3 VP0, and proposed an immunofluorescence-based diagnostic assay [27] . keywords: antigen; detection; elisa; figure; hpev3; human; mabs; parechovirus; protein; system; vp0 cache: cord-013348-lsksys56.txt plain text: cord-013348-lsksys56.txt item: #26 of 143 id: cord-014462-11ggaqf1 author: None title: Abstracts of the Papers Presented in the XIX National Conference of Indian Virological Society, “Recent Trends in Viral Disease Problems and Management”, on 18–20 March, 2010, at S.V. University, Tirupati, Andhra Pradesh date: 2011-04-21 words: 35463 flesch: 47 summary: The following virus isolates have been used in the analysis: GTPV-Uttarkashi, P60, vaccine virus; GTPV Mukteswar, P10, Challenge virus; GTPV (Akola), GTPV Bareilly/00, GTPV Ladakh/01 and GTPV Sambalpur/82, field isolates and SPPV Srinagar, P40; SPPV Ranipet, P50; SPPV-RF, P50, vaccine viruses and SPPV Makdhoom/07, SPPV CIRG/08, SPPV Pune/08, SPPV Bareilly, SPPV 183/03 and SPPV 125/02, field isolates. Present paper discusses about virus disease of quarantine importance affecting ornamental and fruit plants such as Chrysanthimum, Dahlia, Dianthus, Rosabengalensis, Cattleya, Cymbidium, Dendrobium, Lilium, Citrus, Vitis etc. keywords: acid; analysis; animals; antibodies; antigen; assay; cases; cells; cloned; control; crop; curl; dengue; detection; development; disease; dna; elisa; expression; field; food; gene; host; india; infection; isolates; leaf; management; methods; molecular; mosaic; mosaic virus; nucleotide; pathogens; patients; pcr; plant; positive; present; primers; production; protein; region; resistance; response; results; rna; samples; sequence; specific; study; symptoms; time; tomato; total; vaccine; vector; viral; virus; virus infection; viruses; world; yellow cache: cord-014462-11ggaqf1.txt plain text: cord-014462-11ggaqf1.txt item: #27 of 143 id: cord-014965-efmozngq author: None title: Infectious diseases other than CMV (1st Section) date: 2001-06-11 words: 8012 flesch: 47 summary: First signs of LPD appeared 64, 64 and 67 days after last dose of ATG (16mg/kg) in transplant patients, 30 days after last dose of ATG (30mg/kg) in patient treated with ATG+CsA for relapsing SAA. In transplant patients, cure rate was 41 % and an overall mortality was 58 %. keywords: cell; days; dose; fungal; infection; median; patients; pcr; positive; prophylaxis; pts; results; therapy; treatment cache: cord-014965-efmozngq.txt plain text: cord-014965-efmozngq.txt item: #28 of 143 id: cord-015021-pol2qm74 author: None title: Third International Congress on the Immune Consequences of Trauma, Shock and Sepsis —Mechanisms and Therapeutic Approaches date: 1994 words: 162543 flesch: 45 summary: Ever since we know the role of endotoxins in the pathophysiology of sepsis, antibodies against the S-and R-LPS have also been detected in sepsis patients. In sepsis patients, the CD]4+/CD16+ cells can become a major population with more than 50% of all monocytes in 3 of 18 patients and with more than 500 cells/mm 3 in 4 of 18 cases. keywords: acid; activation; activity; acute; addition; adhesion; administration; aim; analysis; animals; anti; antibodies; antibody; ards; arterial; bacteria; binding; blood; blood cells; blood levels; blood samples; body; burn; capacity; cardiac; cause; cd14; cells; cellular; challenge; changes; circulating; clinical; clp; complement; complications; concentrations; conclusion; conditions; contrast; control; control group; control patients; correlation; course; csf; cultured; cytokine levels; cytokine production; cytokines; damage; data; days; death; decrease; development; differences; disease; dose; dysfunction; effect; elevated; elisa; endothelial; endotoxin; endotoxin levels; evidence; experimental; expression; factor; failure; flow; following; formation; function; gene; gram; group; growth; gut; hepatic; high; host; hours; hrs; human; il-1; il-6; il-6 levels; il-8; ill; immune; increased; induction; infection; inflammation; inflammatory; infusion; inhibitor; injury; ischemia; leukocytes; levels; lipid; liver; lps; lung; lymphocytes; macrophages; mean; mechanisms; mediators; membrane; methods; mice; model; mof; molecules; monoclonal; monocytes; mortality; multiple; necrosis; negative; neutrophils; new; non; normal; number; operation; organ; organ failure; organ injury; outcome; oxygen; p<0.05; parameters; patients; period; peritoneal; phase; placebo; plasma; plasma levels; plasma tnf; play; pmn; positive; post; postoperative; potential; presence; present; pressure; process; production; protein; pulmonary; rate; rats; receptor; reduced; related; release; reperfusion; response; results; risk; role; saline; samples; score; sepsis; sepsis patients; septic; serum; serum levels; severity; sham; shock; sirs; soluble; specific; state; stimulation; studies; study; surface; surgery; survival; syndrome; synthesis; system; systemic; t cells; test; therapeutic; therapy; time; tissue; tnf; tnf levels; tnf production; tnf release; total; trauma patients; treated; treatment; tumor; type; use; values; vascular; vitro; vivo; wound cache: cord-015021-pol2qm74.txt plain text: cord-015021-pol2qm74.txt item: #29 of 143 id: cord-015147-h0o0yqv8 author: None title: Oral Communications and Posters date: 2014-09-12 words: 73903 flesch: 39 summary: After 3 months of exposures, inflammatory cells in bronchoalveolar lavage fluid were increased in both the HCR-and LCR-smokeexposed(SE) animals compared to air-exposed controls (p<0.001); however there was a 2-3-fold increase in the number of neutrophils and lymphocytes in the LCR-over the HCR-SE group (p<0.001).Histopathology revealed there was greater inflammation and lung damage present in the LCR-versus HCR-SE group (p<0.05). This causes the symptoms of the early phase of AI and the onset of the late phase characterized by the penetration in the inflamed tissue of inflammatory cells, notably the eosinophils. keywords: activation; activity; acute; addition; adhesion; administration; aim; alpha; analysis; animals; anti; antibodies; antibody; arthritis; associated; beta; binding; blood; bone; cancer; cartilage; cells; chronic; complex; conditions; control; cox-2; cytokines; data; day; days; development; disease; dose; effect; expression; factor; function; gene; group; hours; human; il-1b; il-6; immune; increase; induction; inflammation; inflammatory; inhibited; inhibition; inhibitors; injection; injury; joint; kinase; leukocyte; levels; lps; lung; macrophages; mechanisms; mediators; methods; mice; mif; model; molecular; molecules; monocytes; mouse; mrna; neutrophils; new; novel; number; p38; pathways; patients; pcr; plasma; potential; presence; present; production; protein; rats; receptor; reduced; regulation; release; research; response; results; rheumatoid; role; selective; serum; signaling; skin; specific; stimulation; studies; study; synthesis; system; t cells; therapeutic; time; tissue; tnf; tnfa; treatment; tumor; type; university; vitro; vivo cache: cord-015147-h0o0yqv8.txt plain text: cord-015147-h0o0yqv8.txt item: #30 of 143 id: cord-015394-uj7fe5y6 author: None title: Scientific Abstracts date: 2008-12-23 words: 242809 flesch: 48 summary: The highest level of -tubulin acetylation (2.5-fold) was observed with Vinblastine at 10-fold IC 50 after 48 h. Exposure to Microtubule interacting agents and TSA resulted in increased cell surface expression of Ep-CAM in a time and dose dependent manner. Finally, we elucidated a link between the RA and TGF-pathways by assessing the impact of RA treatment of TGF-3 expression, demonstrating that TGF-3 template decreased to levels comparable to myometrial cell expression (0.84±0.12 fold). keywords: acid; activation; activity; addition; administration; adult; aea; age; aim; analysis; animals; anova; anti; antibodies; antibody; apoptosis; arteries; artery; assay; associated; association; background; baseline; binding; birth; blood; blood cells; blot; bmi; body; brain; cancer; cancer cells; cases; cells; center; cervix; cesarean; changes; clinical; collagen; concentrations; conclusions; conditions; contractions; contrast; contribute; control; control cells; control group; correlation; cortisol; crf; culture; cycle; cytokines; data; day; days; decidua; decrease; delivery; design; development; differences; differentiation; disease; dna; dose; effect; elisa; endometriosis; endometrium; endothelial; eoc cells; epithelial; estradiol; estrogen; evidence; explants; exposure; expression; expression levels; factor; fat; female; fetal; fetuses; findings; flow; fluid; fold; following; free; function; gene; gestation; glucose; gnrh; group; growth; gynecology; hcg; high; hormone; hospital; hours; human; hypertension; hypothesis; hypoxia; il-6; il-8; immune; immunohistochemistry; implantation; increase; induction; infection; inflammation; inhibitor; insulin; introduction; invasion; iugr; ivf; kinase; labor; leptin; levels; lps; male; maternal; mean; mechanisms; media; medical; medicine; medium; membranes; menstrual; methods; mice; min; model; mouse; mrna expression; mrna levels; muscle cells; myometrial; n=6; neonatal; new; non; normal; novel; nuclear; number; obesity; objective; obstetrics; offspring; onset; oocytes; outcome; ovarian; oxygen; p<0.001; p<0.05; pathway; patients; pattern; pcos; pcr; period; phase; phosphorylation; placental; placental cells; plasma; play; population; positive; post; potential; preeclampsia; pregnancies; pregnancy; pregnant; presence; present; pressure; preterm; primary; production; progesterone; proliferation; protein expression; protein levels; proteins; range; rate; rats; receptor; receptor expression; reduced; regulation; relative; release; reproductive; response; restriction; results; risk; role; samples; secretion; sections; serum; sheep; signaling; smooth; specific; staining; stress; studies; study; study group; subjects; syndrome; system; t cells; term; test; time; tissue; tnf; total; treatment; trimester; trophoblast cells; tumor; type; university; usa; uterine; uterus; vascular; vegf; vehicle; vitro; vivo; weeks; weight; western; women; years cache: cord-015394-uj7fe5y6.txt plain text: cord-015394-uj7fe5y6.txt item: #31 of 143 id: cord-015683-a9a82of4 author: Gupta, Varsha title: Molecular Diagnostics date: 2016-10-23 words: 4776 flesch: 49 summary: This is an alternative strategy where samples containing several proteins are arrayed on slide and probed with labeled antibodies. Traditional PCR procedure includes amplification of specifi c genes ( Fig. 9.4 ) of the microorganisms and running the product on a gel. keywords: antibodies; antibody; antigen; detection; diagnosis; diseases; dna; elisa; pcr; protein; specifi; tests cache: cord-015683-a9a82of4.txt plain text: cord-015683-a9a82of4.txt item: #32 of 143 id: cord-019347-tj3ye1mx author: None title: ABSTRACT BOOK date: 2010-02-19 words: 108161 flesch: 50 summary: in allergic patients and 250 and 500 ug. In allergic patients after histamine threshold challenge mean decrease was for FEV1 19, 2% and for FEV1/VC 17, 3%. keywords: age; airway; allergen; allergic; allergy; allergy asthma; analysis; anti; antibody; asthma; asthma control; asthma diagnosis; asthma patients; asthma symptoms; atopic; background; baseline; blood; care; case; cd4; cells; chest; children; chronic; conclusion; control; daily; data; day; days; deficiency; desensitization; diagnosis; disease; dose; drug; effect; efficacy; evaluation; exposure; female; following; food; function; group; histamine; history; hours; ics; ige; igg; immune; improvement; increase; infections; inflammatory; introduction; levels; life; low; lung; male; mean; medical; medication; methods; minutes; months; nasal; negative; new; non; normal; number; objective; ova; patients; period; persistent; placebo; pollen; population; positive; prednisone; prevalence; prick; primary; production; pulmonary; quality; rate; reactions; recurrent; report; response; results; rhinitis; rhinitis patients; risk; serum; severity; significant; skin; specific; spray; studies; study; subjects; symptoms; syndrome; testing; tests; therapy; time; total; treatment; urticaria; use; visits; weeks; wheezing; years cache: cord-019347-tj3ye1mx.txt plain text: cord-019347-tj3ye1mx.txt item: #33 of 143 id: cord-022310-yc6xtw0s author: Lappin, Michael R. title: Microbiology and Infectious Disease date: 2011-12-15 words: 14122 flesch: 35 summary: In cats, the combination of serum antigen test results with serum antibody test results is more sensitive than performing either test alone (see Heartworm Antibody Titer, next). In addition, positive serum antibody tests do not document infection by R. rickettsii because infection with nonpathogenic spotted fever group agents induce cross-reacting antibodies. keywords: analysis; antibodies; antibody; assay; blood; cats; culture; diagnosis; disease; dogs; elisa; feline; infection; interpretation; negative; organism; pcr; results; serum; spp; test; titers cache: cord-022310-yc6xtw0s.txt plain text: cord-022310-yc6xtw0s.txt item: #34 of 143 id: cord-022353-q2k2krnm author: W. Quimby, Fred title: Clinical Chemistry of the Laboratory Mouse date: 2007-09-02 words: 30268 flesch: 42 summary: Although we hope all readers of this chapter will benefit from this section on assays and instruments, the primary purpose of this chapter is to briefly introduce the reader to areas where methods in clinical chemistry are changing and provide sources of information for services, reagents (including test kits), and instrumentation, specifically for testing biomarkers (including traditional analytes) in mouse serum, plasma, or urine. Growth in the number of reagents capable of quantitating analytes in mouse serum is illustrated in Table 6 -2. keywords: acid; activity; addition; age; analytes; assays; atherosclerosis; binding; biomarkers; blood; cells; chemistry; chemokines; cholesterol; complement; corticosterone; development; disease; effects; elisa; enzyme; et al; expression; factor; function; gene; glucose; growth; hdl; hepatic; hormone; human; insulin; kits; ldl; levels; liver; metabolism; mice; mouse; murine; muscle; new; plasma; production; protein; quimby; receptor; response; role; secretion; serum; strains; surface; tissue; total; transgenic; type cache: cord-022353-q2k2krnm.txt plain text: cord-022353-q2k2krnm.txt item: #35 of 143 id: cord-022501-9wnmdvg5 author: None title: P1460 – P1884 date: 2015-12-28 words: 128422 flesch: 46 summary: In the first half-year of 2005 family doctors most often prescribed penicyllins -(44.8%), makrolids -(27.1%), cephalosporins -(12.5%), tetracyclins -(9.4%) and lincozamidsbased (3.1%) treatments Specialist doctors, on the other hand, prescribed penicllins (41.7%), makrolids (17.9%), cephalosporins (17.7%), tetracyclins (12.1%), lincozamids (5.2%) and chinolons (3%). State-wide antibiotic consumption in the AC setting during the same time was 12 DID (~85% of total consumption). keywords: acid; activity; acute; aeruginosa; agar; age; agents; aim; analysis; antibiotic; antimicrobial; assay; aureus; bacteria; beta; blood; care; cases; cause; cfu; children; ciprofloxacin; clinical; coli; common; community; concentrations; conclusion; consumption; control; cost; culture; daily; data; days; detection; diagnosis; diarrhoea; differences; different; difficile; disease; distribution; dna; dose; drug; duration; effect; efficacy; erythromycin; factors; faecium; following; frequency; gene; gram; group; guidelines; health; hospital; hours; human; identification; imipenem; incidence; increase; infections; information; isolates; laboratory; level; levofloxacin; linezolid; mean; medical; meningitis; methicillin; methods; mic; mics; model; months; mortality; moxifloxacin; mrsa; n =; negative; new; non; number; objectives; pathogens; patients; pcr; penicillin; period; phenotype; pneumoniae; population; positive; presence; prevalence; protein; range; rates; resistance; respiratory; results; risk; s. aureus; samples; sequence; sequencing; serum; skin; species; specific; specimens; spectrum; spp; standard; staphylococcus; strains; streptococcus; studies; study; subjects; susceptibility; susceptible; test; tetracycline; therapy; tigecycline; time; tissue; total; toxin; tract; treatment; type; use; values; vancomycin; vitro; years cache: cord-022501-9wnmdvg5.txt plain text: cord-022501-9wnmdvg5.txt item: #36 of 143 id: cord-022650-phsr10jp author: None title: Abstracts TPS date: 2018-08-14 words: 119916 flesch: 51 summary: Method: Postal questionnaires were distributed to an unselected group of asthma patients (n = 190). NHR was reported in 71% of asthma patients and 22% in non-asthmatic controls (P < 0.0001), with changes in temperature being the most important inducer of nasal symptoms (74% of asthmatics), followed by strong odours (62%) and cigarette smoke (61%). keywords: adults; age; aim; allergen; allergies; allergy; analysis; anaphylaxis; angioedema; anti; ara; asthma; asthma control; asthma patients; asthma symptoms; asthmatic; atopic; background; blood; case; cells; challenge; children; chronic; clinic; concentration; conclusion; control; control group; correlation; cross; data; days; dermatitis; diagnosis; differences; disease; dose; drug; dust; effect; efficacy; egg; episodes; exposure; extracts; factors; food; food allergy; grass; group; hae; high; history; hospital; hours; house; ige; ige levels; igg; immunotherapy; improvement; increase; levels; life; low; male; mean; median; medical; medication; method; milk; minutes; mite; months; nasal; non; number; p 1; p =; patients; peanut; period; pollen; pollen allergy; population; positive; present; prevalence; prick; protein; questionnaire; rate; reaction; reactivity; reduction; report; respiratory; response; results; rhinitis; rhinitis patients; risk; scit; score; sensitization; serum; severity; sige; skin; skin prick; slit; specific; spt; studies; study; subjects; symptoms; syndrome; test; testing; time; total; treatment; type; urticaria; use; weeks; years cache: cord-022650-phsr10jp.txt plain text: cord-022650-phsr10jp.txt item: #37 of 143 id: cord-022653-qa1uph35 author: None title: Poster Discussion Session PDS date: 2017-08-30 words: 58403 flesch: 49 summary: Out of all maxillary sinuses (n=72) from study patients, 62 (86.11%) were opacified, and only these sinuses were included in further analyses. We studied three groups of subjects: peach allergic patients who received Prup3-enriched-SLIT for 1 year, peach allergic patients non treated, and healthy controls who tolerated peach. keywords: age; aim; allergen; allergic; allergy; analysis; anaphylaxis; anti; associated; asthma; asthma patients; atopic; blood; cases; cells; changes; children; conclusions; control; correlation; data; diagnosis; differences; disease; dose; drug; effect; exposure; expression; food; food allergy; group; hdm; healthy; history; ige; ige levels; immune; immunotherapy; increase; inflammation; introduction; levels; low; mean; methods; mice; milk; months; nasal; non; number; objectives; patients; period; pollen; production; protein; reactions; reactivity; response; results; rhinitis; risk; samples; score; sensitization; serum; skin; slit; specific; studies; study; subjects; symptoms; test; therapy; time; total; treatment; use; years cache: cord-022653-qa1uph35.txt plain text: cord-022653-qa1uph35.txt item: #38 of 143 id: cord-022888-dnsdg04n author: None title: Poster Sessions date: 2009-08-19 words: 189173 flesch: 41 summary: Our aim is to describe how B cell lymphoma cells respond to TGF-b compared to normal peripheral B cells, to create an overview of the different signaling pathways involved, and to characterize the mechanisms behind the loss of sensitivity to TGF-b. Methods: Proliferation assays were performed on 11 different B-cell lymphoma cell lines and normal peripheral B cells to screen for TGF-b-induced effects. Using a CD3 and CD28 activation model system -TLR4 presence on CD4+ cells is found in mouse T cells, human T cells and Jurkat cell lines. keywords: + cells; ability; absence; activity; addition; analysis; antibodies; antibody; antigen; apoptosis; apoptotic; assay; associated; autoimmune; b cells; b t; binding; blood; bone; c mice; cancer cells; capacity; cd4; cd8 +; cd8 cells; cd8 t; cell activation; cell activity; cell culture; cell cycle; cell death; cell development; cell differentiation; cell epitopes; cell function; cell level; cell lines; cell membrane; cell population; cell proliferation; cell receptor; cell responses; cell subsets; cell surface; cell tolerance; cell types; cells cells; changes; chronic; class; clinical; colitis; complex; conclusion; contrast; control; control cells; cross; ctl; cytokine; cytokine production; cytometry; cytotoxic t; data; day; days; dcs; deficient; delta t; dendritic; disease; dna; early; effector cells; effector t; effects; elisa; expansion; experiments; expression; expression levels; factor; family; findings; flow; following; formation; function; gamma; gd cells; gd t; gene; gene expression; group; high; hiv; hla; host; human; ifn; ifng; igg; il-10; il-2; il-4; il-6; immune; immunity; increase; independent; induction; infected; infection; inflammation; inflammatory; inhibition; inkt; interaction; intracellular; levels; lps; macrophages; major; marrow cells; mast cells; mechanisms; membrane; memory t; methods; mhc; mice; model; molecules; monocytes; mouse; mouse t; mrna; murine; negative; neutrophils; new; nkt cells; non; normal; novel; number; objectives; pathway; patients; pcr; peptide; peripheral; plasma cells; play; positive; potential; presence; presentation; primary; production; promoter; protein; protein expression; receptors; regulation; regulatory; release; results; role; secretion; serum; signaling; skin; sle; specific; spleen; stem cells; stimulation; studies; study; surface expression; system; t cells; t em; t h; t helper; t lymphocytes; target cells; tcr; test; th1 cells; time; tissue; tlr; tnf; tolerance; transcription; treatment; tumor cells; type; university; vaccination; vaccine; vg9vd2 t; virus; vitro; vivo; work cache: cord-022888-dnsdg04n.txt plain text: cord-022888-dnsdg04n.txt item: #39 of 143 id: cord-022940-atbjwpo5 author: None title: Poster Sessions date: 2016-09-07 words: 241687 flesch: 44 summary: Among used cancer cell lines, ERICD was highly expressed and ARID3A had lower expression in U-2OS (osteosarcoma), A-172 (glioblastoma) and A549 (lung cancer). Clear cell renal cell cancer (ccRCC) with metastases has pour prognosis: 5-year survival is about 9%. keywords: a549 cells; acid; activation; activities; activity; activity levels; acute; addition; administration; affinity; agents; aim; albumin; allele; alterations; alternative; amino; analysis; analysis results; animals; ankara; anti; antibodies; antibody; anticancer; antioxidant; apoptosis; applications; approach; assay; association; bacteria; beta; binding; biology; blood; body; bone; brain; breast cancer; cancer cells; cancer group; cancer patients; cancer stem; cancer treatment; cancers; cause; cell cycle; cell death; cell growth; cell lines; cell proliferation; cell survival; cell viability; changes; characterization; chemical; cholesterol; chronic; clinical; coli; colorectal; combination; comparison; complex; complexes; compounds; concentrations; conclusion; conditions; content; control cells; control group; control study; controls; correlation; culture; curcumin; current; cytotoxic; damage; data; day; days; decrease; department; detection; determination; development; diabetes; differences; differentiation; discussion; disease; dna; domain; dose; drug; effects; elevated; elisa; energy; enzyme; enzyme activity; ethanol; experimental; expression analysis; expression levels; expressions; extract; factor; faculty; family; fat; findings; flow; fluorescence; fold; food; formation; free; function; gene expression; genes; genetic; genome; genotype; glucose; glutathione; group; growth; gsh; health; hours; human; immune; increase; inflammation; inflammatory; inhibition; inhibitors; injury; institute; insulin; interaction; intracellular; introduction; invasion; investigation; ischemia; kinase; laboratory; lead; levels; light; like; lipid; liver; low; lung; male; manner; markers; mass; materials; matrix; mcf-7; mda; mda levels; mean; mechanisms; medical; medicine; medium; membrane; metabolism; methods; methylation; mice; microscopy; migration; mirnas; mitochondrial; model; modified; molecular; molecules; mrna; muscle; mutant; mutations; n =; nanoparticles; negative; non; normal; novel; number; obese; obesity; oil; order; oxidative; oxygen; p =; p-02.08.5; parameters; pathway; patients; pcr; peptide; phase; plant; plasma; play; point; polymorphisms; population; potential; presence; present; process; processes; production; products; profile; progression; promoter; properties; prostate; prostate cancer; protective; protein; protein expression; protein levels; purpose; radical; range; rate; rats; reaction; receptor; recombinant; region; regulation; related; relationship; research; resistance; response; results; risk; role; samples; science; scientific; screening; sequence; serum; serum levels; signaling; site; size; sod; species; specific; stability; stage; status; stem cells; strain; stress; structure; studies; study; study group; subjects; surface; survival; synthesis; system; target; technique; temperature; test; tested; therapeutic; therapy; time; tissue; tnf; total; transcription; treatment; treatment group; tumor; tumor cells; turkey; type; university; use; values; vitamin; vitro; water; weight; western; wild; women; work; years cache: cord-022940-atbjwpo5.txt plain text: cord-022940-atbjwpo5.txt item: #40 of 143 id: cord-023095-4dannjjm author: None title: Research Abstract Program of the 2011 ACVIM Forum Denver, Colorado, June 15–18, 2011 date: 2011-05-03 words: 134382 flesch: 49 summary: Mminimum HR, mean HR and the HRV variables (7 and 10) differing between dog groups, also consistently decreased with increasing MR, LA/Ao and the proximal isovelocity surface area in CKCS. The apparently normal levels of hexosaminidase A activity in affected dog samples may be a result of b subunit overexpression. keywords: abnormalities; acid; acth; activity; administration; adult; age; aim; analysis; animals; assay; association; available; baseline; blood; blood samples; body; breed dogs; breeds; canine; cardiac; cases; cats; cell; changes; chf; chronic; clinical; cobalamin; compare; concentrations; control dogs; controls; correlation; cortisol; creatinine; data; days; decrease; detection; diagnosis; diet; difference; disease; dna; dogs; dose; drug; duration; effects; elisa; equine; evidence; examination; expression; failure; fecal; feline; findings; foals; following; food; function; gastrointestinal; gene; glucose; group; heart; horses; hours; human; increase; infection; insulin; isolates; levels; mean; median; medical; minutes; model; months; negative; non; number; observed; outcome; p o; parameters; patients; pcr; period; plasma; platelet; post; potential; presence; present; prevalence; protein; pulmonary; purpose; range; rate; reference; resistance; response; results; risk; role; samples; serum; serum concentrations; serum samples; severity; significance; signs; species; specific; spinal; spp; standard; studies; study; survival; test; therapy; time; tissue; total; treatment; type; urinary; urine; uroliths; use; values; veterinary; weeks; weight; years cache: cord-023095-4dannjjm.txt plain text: cord-023095-4dannjjm.txt item: #41 of 143 id: cord-024171-x7y1xpsf author: Bachmann, P. A. title: Rotavirusnachweis in Faezes: Erfahrungen mit dem Enzyme Linked Immunosorbent Assay (ELISA) date: 2010-05-13 words: 1840 flesch: 39 summary: Se precisa proseguir con las experiencias antes de poder recomendar el ELISA para la identificación de virus Rota en el diagnóstico de rutina. Se precisa proseguir con las experiencias antes de poder recomendar el ELISA para la identificacibn de virus Rota en el diagn6stico de rutina. keywords: assay; der; die; elisa; enzyme; iem; immunosorbent; rotavirus; und; virus cache: cord-024171-x7y1xpsf.txt plain text: cord-024171-x7y1xpsf.txt item: #42 of 143 id: cord-025922-84pheilu author: Kostopoulou, Despoina title: Mapping the canine vector-borne disease risk in a Mediterranean area date: 2020-06-03 words: 4444 flesch: 46 summary: The highest seroprevalence of Anaplasma positive dogs was observed on the island of Crete. The aim of this study was to gain information on (i) the health risk for both native and visiting dogs, and (ii) the risk of pathogen distribution to new areas (i.e. via dogs travelling back from holidays or stray dogs being adopted and moved to various other countries in Europe), by determining the exposure of dog populations living on Greek islands in different geographical locations to CVBPs. keywords: dogs; elisa; greece; islands; phagocytophilum; positive; samples; spp; study cache: cord-025922-84pheilu.txt plain text: cord-025922-84pheilu.txt item: #43 of 143 id: cord-026559-xx52u01h author: Tripathi, Siddhartha title: Blood Plasma Microfluidic Device: Aiming for the Detection of COVID-19 Antibodies Using an On-Chip ELISA Platform date: 2020-06-10 words: 2013 flesch: 44 summary: The technology was developed to realize a microdevice to enable blood plasma separation in a lab-on-chip format in an effective way. The technology of blood plasma separation in a microdevice can be employed for testing of antibodies present in the blood plasma of a COVID-19-infected subject, similar to a point-of-care serological test. keywords: antibodies; blood; microdevice; plasma cache: cord-026559-xx52u01h.txt plain text: cord-026559-xx52u01h.txt item: #44 of 143 id: cord-031190-4qpnlgb5 author: Sahu, Kamal K title: Current Perspectives on Diagnostic Assays and Anti-PF4 Antibodies for the Diagnosis of Heparin-Induced Thrombocytopenia date: 2020-08-17 words: 4091 flesch: 31 summary: 19 Disease Burden of HIT HIT is more commonly triggered by treatment with UFH (8%-17% of patients receiving heparin), followed by LMWH and fondaparinux (2%-8%). 52 Functional assays detect platelet-conformation changes when a patient's serum containing HIT antibodies is incubated with donor platelets and heparin. keywords: antibodies; assays; elisa; heparin; hit; patients; pf4; platelet; thrombocytopenia cache: cord-031190-4qpnlgb5.txt plain text: cord-031190-4qpnlgb5.txt item: #45 of 143 id: cord-031907-ilhr3iu5 author: None title: ISEV2020 Abstract Book date: 2020-07-15 words: 201435 flesch: 40 summary: Normal pancreas cells (hTERT-HPNE and HPDE-H6c7) were co-cultured with cancer cell EVs for 24-48 hours. Before EV isolation cells were kept for 24 h either under normoxia or hypoxia (1% oxygen). keywords: ability; activation; activity; ad evs; addition; aim; analysis; analysis methods; anti; approach; assay; associated; bacterial evs; biological; biomarkers; blood; blood cells; blood evs; blot; bone; brain; breast; breast cancer; cancer cells; cancer evs; cancer introduction; cancer patients; cd63; cd81; cd9; cell communication; cell culture; cell evs; cell exosomes; cell function; cell lines; cell proliferation; cell surface; cell types; cells; cells introduction; changes; characterization; chromatography; composition; concentration; conclusion; conditions; content; control; control evs; cultured; current; cytometry; data; delivery; density; detection; development; diagnosis; differential; disease; distribution; dna; drug; effect; electron; endothelial; enrichment; epithelial; ev analysis; ev cargo; ev evs; ev isolation; ev markers; ev numbers; ev preparations; ev production; ev protein; ev release; ev research; ev rna; ev samples; ev subpopulations; ev surface; ev treatment; ev uptake; evs; exclusion; exosomal; exosomes; experiments; expression; expression analysis; extracellular; factors; findings; flow; fluorescent; fluorescent evs; fold; formation; fractions; free; function; funding; gene; group; growth; host cells; human; human evs; imaging; immune; increase; inflammation; inflammatory; introduction; isolated; isolation methods; key; large; levels; lipid; lung; macrophages; mass; mechanisms; media; medium; membrane; membrane vesicles; mesenchymal; metastasis; methods; mice; microscopy; migration; milk evs; mirna; model; molecular; molecules; mouse; msc evs; mscs; nanoparticle; national; neuronal; neurons; new; non; normal; novel; nta; number; particles; pathway; patients; plasma evs; plasma samples; platelet; platform; play; positive; positive evs; post; potential; presence; present; primary; process; production; profile; profiling; progression; proliferation; properties; prostate; prostate cancer; protein; protein cargo; protein expression; protein markers; proteomic; purification; purity; range; recipient cells; research; resistance; response; results; rna; rnas; role; samples; sec; secretion; sequencing; serum; sevs; signalling; single; size; small evs; specific; specific evs; spectrometry; stem cells; stromal cells; studies; study; summary; surface; system; target cells; targets; tau; techniques; tested; therapeutic; therapy; time; tissue; total; total evs; tracking; transfer; transmission; treatment; tumour cells; ultracentrifugation; university; uptake; urinary evs; urine; usa; usa introduction; use; vesicles; vesicles introduction; vitro; vivo; work cache: cord-031907-ilhr3iu5.txt plain text: cord-031907-ilhr3iu5.txt item: #46 of 143 id: cord-032689-2xtiiejf author: Wang, Wen-Hung title: A novel, rapid (within hours) culture-free diagnostic method for detecting live Mycobacterium tuberculosis with high sensitivity date: 2020-09-16 words: 5515 flesch: 46 summary: For all the smear-positive specimens, the positive predictive value of culturefree ultrasensitive ELISA tests was 92.5%. Comparing the results of our method with those of culture tests for 944 specimens revealed a sensitivity of 86.9% (93/107, 95% CI: 79.0–92.7%) and a specificity of 92.0% (770/837, 95% CI: 89.9–93.7%). keywords: bacilli; culture; detection; elisa; method; mpt64; specimens; tests; tuberculosis; xpert cache: cord-032689-2xtiiejf.txt plain text: cord-032689-2xtiiejf.txt item: #47 of 143 id: cord-251943-jzaeaxam author: Zhang, Jian‐San title: A serological survey on neutralizing antibody titer of SARS convalescent sera date: 2005-08-24 words: 2546 flesch: 46 summary: Since standardized reagents for SARS antibody detection have not become available, the data on SARS antibody titer reported from various researchers are not applicable for SARS vaccine evaluation. Eighty‐seven serum samples were confirmed to be positive for SARS antibodies. keywords: antibody; assay; neutralization; sars; sera; serum; titer cache: cord-251943-jzaeaxam.txt plain text: cord-251943-jzaeaxam.txt item: #48 of 143 id: cord-252867-lku0cm62 author: Edwards, S. title: A comparison of three rapid diagnostic methods for the detection of rotavirus infection in calves date: 1987-01-31 words: 2123 flesch: 44 summary: A strong positive control was run on each gel and test samples were recorded as positive if the characteristic ll-segment rotavirus electropherotype could be detected visually. The major limitation of RPHA is the presence of non-specific haemagglutinating factors in a number of bovine faeces samples, although the problem in this study was not as severe as reported in previous work (Bradburne et al., 1979) . keywords: antibody; elisa; rotavirus; rpha; samples cache: cord-252867-lku0cm62.txt plain text: cord-252867-lku0cm62.txt item: #49 of 143 id: cord-254318-w8wrn9lx author: Díez, José-María title: Currently available intravenous immunoglobulin contains antibodies reacting against severe acute respiratory syndrome coronavirus 2 antigens date: 2020-05-13 words: 2694 flesch: 40 summary: Situation update worldwide Strategies for the prevention and management of coronavirus disease 2019 Use of human immunoglobulins as an anti-infective treatment: the experience so far and their possible re-emerging role •• A comprehensive review on the role of intravenous immunoglobulin (IVIG) as anti-infective treatment in community and emerging diseases Global patterns in coronavirus diversity Experience of using convalescent plasma for severe acute respiratory syndrome among healthcare workers in a Taiwan hospital Use of convalescent plasma therapy in SARS patients in Hong Kong Feasibility of using convalescent plasma immunotherapy for MERS-CoV infection, Saudi Arabia An outbreak of human coronavirus OC43 infection and serological crossreactivity with SARS coronavirus. The following kits were used for the qualitative determination of IgG class antibodies against human coronaviruses: abx052609 Human Coronavirus IgG ELISA kit (Abbexa, Cambridge, UK), against an undetermined antigen; MBS9301037, HCoV-HKU-IgG ELISA kit (MyBioSource, Inc., CA, USA), against N protein; DEIA1035; SARS Coronavirus IgG ELISA kit (Creative Diagnostics, NY, USA), against virus lysate; RV-402100-1; human anti-MERS-NP IgG ELISA Kit (Alpha Diagnostic Intl., Inc., TX, USA), against N protein; RV-402400-1, human anti-MERS-receptor-binding domain (RBD) IgG keywords: coronavirus; cov-2; elisa; human; ivig; sars cache: cord-254318-w8wrn9lx.txt plain text: cord-254318-w8wrn9lx.txt item: #50 of 143 id: cord-254384-mwzz1db5 author: Lu, Guilan title: Large-scale seroprevalence analysis of human metapneumovirus and human respiratory syncytial virus infections in Beijing, China date: 2011-02-10 words: 3984 flesch: 50 summary: To assess the seroprevalence of hMPV infection in China, we used hMPV N protein as an antigen to test serum samples for the presence of anti-hMPV IgG antibody in children and adults free of acute respiratory illness in Beijing, China. [19] , it has been widely applied in the immunoassay of hMPV infection and in the investigation of seroprevalence of hMPV infections [17, 18] . keywords: antibody; children; hmpv; hrsv; human; igg; protein cache: cord-254384-mwzz1db5.txt plain text: cord-254384-mwzz1db5.txt item: #51 of 143 id: cord-255390-dvp0luxe author: Jones, R. D title: Capture ELISA and flow cytometry methods for toxicologic assessment following immunization and cyclophosphamide challenges in beagles date: 2000-04-10 words: 4851 flesch: 33 summary: However, the application of these methods to toxicology testing in dog studies conducted under Good Laboratory Practices has been minimal. Imunodeficient dwarfism is a relevant model for elucidating the endocrine role of the thymus in its relationships between the neuroendocrine and immune systems in pre-pubertal dogs (Roth et al., 1988) . keywords: cytometry; dog; elisa; et al; flow; ige; igg; igm; response cache: cord-255390-dvp0luxe.txt plain text: cord-255390-dvp0luxe.txt item: #52 of 143 id: cord-257190-iesysf3l author: Eshaghi, Majid title: Purification of the extra-cellular domain of Nipah virus glycoprotein produced in Escherichia coli and possible application in diagnosis date: 2005-03-30 words: 2909 flesch: 41 summary: Furthermore, the advantages of using a prokaryotic host to produce recombinant G protein would be considerable due to the ease of scale-up, and the low costs involved in growing bacteria. The aim was to determine the variability of negative and positive sera using ELISA based on recombinant G protein. keywords: niv; protein; recombinant; usa; virus cache: cord-257190-iesysf3l.txt plain text: cord-257190-iesysf3l.txt item: #53 of 143 id: cord-257715-pbcr81qm author: Pignatelli, J. title: Molecular characterization of a new PToV strain. Evolutionary implications date: 2009-03-20 words: 8284 flesch: 44 summary: In addition, since the nucleocapsid proteins are usually highly conserved, serodiagnosis tests based on the use of PToV N protein may prove useful for detection of antibodies against other toroviruses. A baculovirus recombinant that contains the nucleotide coding sequence for PToV N protein fused at its 5 -end to a sequence encoding a 6-histidine tag was generated by using the Bac-to-Bac system (Invitrogen, Corp.) . keywords: antibodies; bev; bres; btov; cells; elisa; et al; gene; porcine; protein; ptov; samples; serum; torovirus cache: cord-257715-pbcr81qm.txt plain text: cord-257715-pbcr81qm.txt item: #54 of 143 id: cord-261372-xjbs09gi author: Sozzi, Enrica title: Comparison of enzyme-linked immunosorbent assay and RT-PCR for the detection of porcine epidemic diarrhoea virus date: 2010-02-28 words: 2093 flesch: 42 summary: Comparison of direct electron microscopy and rotavirus enzyme-linked immunosorbent assay for detection of gastroenteritis viruses in children Enzyme-linked immunosorbent assay for the detection of the coronavirus-like agent and its antibodies in pigs with porcine epidemic diarrhea Evaluation of a blocking ELISA using monoclonal antibodies for the detection of porcine epidemic diarrhoea virus and its antibodies Preparation of monoclonal antibodies, strategies and procedure Propagation of the virus of porcine epidemic diarrhoea in cell culture Differential detection of transmissible gastroenteritis virus and porcine epidemic diarrhea virus by RT-PCR Isolation of porcine epidemic diarrhea virus (PEDV) infection in Korea The correlation between the two methods was higher when testing faecal samples (K =0.97, 95% CI: 0.94–1.00) than testing intestinal samples (K =0.62, 95% CI: 0.35–0.89). keywords: diarrhoea; elisa; epidemic; pedv; samples; virus cache: cord-261372-xjbs09gi.txt plain text: cord-261372-xjbs09gi.txt item: #55 of 143 id: cord-262268-gm99cadh author: Wang, Jingqiang title: Assessment of Immunoreactive Synthetic Peptides from the Structural Proteins of Severe Acute Respiratory Syndrome Coronavirus date: 2003-12-01 words: 4033 flesch: 44 summary: Conclusions: Five peptides from SARS structural proteins, especially two from the COOH terminus of the N protein, appear to be highly immunogenic and may be useful for serologic assays. The identification of these antigenic peptides contributes to the understanding of the immunogenicity and persistence of SARS coronavirus. keywords: antibodies; coronavirus; elisa; n385; patients; peptides; protein; sars; sera cache: cord-262268-gm99cadh.txt plain text: cord-262268-gm99cadh.txt item: #56 of 143 id: cord-262640-4vr4cm1s author: Nguyen, N. N. title: Correlation of ELISA based with random access serologic immunoassays for identifying adaptive immune response to SARS-CoV-2 date: 2020-07-08 words: 2746 flesch: 46 summary: 209 ELISA detected higher sero-prevalence in rtPCR negative samples than the RAIA methods. This may be 210 due to i) higher analytical sensitivity or a lower cutoff by ELISA, which triggered more positive results; 211 ii) cross reactivity to other coronavirus; iii) non-specific binding of other antibodies, for example 212 autoimmune antibodies or deposition of detection antibody on the microtiter well which led to increased 213 absorbance causing false positives 214 All rights reserved. keywords: elisa; igg; medrxiv; preprint; rtpcr; samples; sars cache: cord-262640-4vr4cm1s.txt plain text: cord-262640-4vr4cm1s.txt item: #57 of 143 id: cord-262762-mgegswvn author: Callebaut, P. title: Enzyme-linked immunosorbent assay for the detection of the coronavirus-like agent and its antibodies in pigs with porcine epidemic diarrhea date: 1982-09-30 words: 3607 flesch: 45 summary: A total of 62 serum samples, to be examined for antibody by ELISA blocking, were collected from four CDCD piglets and seven conventional experimental fattening pigs prior to inoculation with CV777 and at various intervals between 7 and 81 days thereafter. All the sera except 3, collected 45 days or later after the start of the disease, contained antibodies detectable by ELISA blocking. keywords: assay; cv777; elisa; pigs; samples; specimens cache: cord-262762-mgegswvn.txt plain text: cord-262762-mgegswvn.txt item: #58 of 143 id: cord-264936-3posyr5n author: Mohammadzadeh, Sara title: Enhanced-Transient Expression of Hepatitis C Virus Core Protein in Nicotiana tabacum, a Protein With Potential Clinical Applications date: 2014-11-24 words: 6214 flesch: 37 summary: Two types of plant expression vectors (PVX-based and classic pBI121 binary) for HCVcp were constructed and their levels of protein expression in the presence and absence of P19 co-agroinfiltration were compared. HCVcp denote to HCV core protein, eHCVcp and pHCVcp dnote to E.coli-derived and plant-derived HCVcp, respectively. keywords: codon; core; elisa; expression; figure; gene; hcvcp; hepatitis; leaves; plant; protein; pvx; sequence; tobacco; vector; virus cache: cord-264936-3posyr5n.txt plain text: cord-264936-3posyr5n.txt item: #59 of 143 id: cord-264968-ctx39vhi author: Woo, Patrick CY title: Relative rates of non-pneumonic SARS coronavirus infection and SARS coronavirus pneumonia date: 2004-03-13 words: 3573 flesch: 41 summary: key: cord-264968-ctx39vhi authors: Woo, Patrick CY; Lau, Susanna KP; Tsoi, Hoi-wah; Chan, Kwok-hung; Wong, Beatrice HL; Che, Xiao-yan; Tam, Victoria KP; Tam, Sidney CF; Cheng, Vincent CC; Hung, Ivan FN; Wong, Samson SY; Zheng, Bo-jian; Guan, Yi; Yuen, Kwok-yung title: Relative rates of non-pneumonic SARS coronavirus infection and SARS coronavirus pneumonia date: 2004-03-13 journal: Lancet DOI: 10.1016/s0140-6736(04)15729-2 sha: doc_id: 264968 cord_uid: ctx39vhi BACKGROUND: An ELISA based on recombinant nucleocapsid protein for IgG detection was tested with serum from 149 healthy blood donors who donated 3 years previously and with serum positive for antibodies against SARS-CoV (by indirect immunofluorescence assay) from 106 patients with SARS-CoV pneumonia. keywords: antibodies; blot; cov; elisa; non; protein; sars; spike cache: cord-264968-ctx39vhi.txt plain text: cord-264968-ctx39vhi.txt item: #60 of 143 id: cord-265312-yfjme53q author: Magtoto, Ronaldo title: Evaluation of the Serologic Cross-Reactivity between Transmissible Gastroenteritis Coronavirus and Porcine Respiratory Coronavirus Using Commercial Blocking Enzyme-Linked Immunosorbent Assay Kits date: 2019-03-13 words: 6127 flesch: 38 summary: Moreover, the detection of TGEV antibodies, particularly in reproductive animals, can assist in diagnosis and control of the disease. Specimens primarily used for TGEV virus detection include feces and intestinal contents, and those for PRCV detection include nasal swabs or lung homogenates. keywords: coronavirus; diagnostic; elisa; pigs; porcine; positive; prcv; results; suspect; tgev; virus cache: cord-265312-yfjme53q.txt plain text: cord-265312-yfjme53q.txt item: #61 of 143 id: cord-267736-rya9w6sh author: Kang, Xiaoping title: Development of an ELISA-array for simultaneous detection of five encephalitis viruses date: 2012-02-27 words: 2993 flesch: 42 summary: The efficacy of the spotting concentration of the capture antibodies was evaluated by virus culture detection, the proper spotting concentration was determined by a combination of minimized cross reaction and higher signal intensity. To make the assay more amenable to multiple virus detection, the assay protocol was optimized. keywords: antibodies; antibody; array; assay; detection; elisa; encephalitis; pbs cache: cord-267736-rya9w6sh.txt plain text: cord-267736-rya9w6sh.txt item: #62 of 143 id: cord-273361-i5v5rz4x author: Chen, Tsu-Han title: Development of a Luminex assay for the detection of swine antibodies to non-structural proteins of foot-and-mouth disease virus date: 2013-10-31 words: 5999 flesch: 44 summary: Genetic determinants of altered virulence of Taiwanese foot-and-mouth disease virus Diagnosis of persistent aphthovirus infection and its differentiation from vaccination response in cattle by use of enzyme-linked immunoelectrotransfer blot analysis with bioengineered nonstructural viral antigens Improvement of a serodiagnostic strategy for foot-andmouth disease virus surveillance in cattle under systematic vaccination: a combined system of an indirect ELISA-3ABC with an enzyme-linked immunoelectrotransfer blot assay Rapid serological profiling by enzyme-linked immunosorbent assay and its use as an epidemiological indicator of foot-and-mouth disease viral activity Evaluation of three 3ABC ELISAs for foot-and-mouth disease non-structural antibodies using latent class analysis Development of a chromatographic strip assay for detection of porcine antibodies to 3ABC non-structural protein of foot-and-mouth disease virus serotype O Differentiation of foot-and-mouth disease-infected pigs from vaccinated pigs using antibody-detecting sandwich ELISA Developments in diagnostic techniques for differentiating infection from vaccination in foot-andmouth disease Development and use of a biotinylated 3ABC recombinant protein in a solid-phase competitive ELISA for the detection of antibodies against foot-andmouth disease virus Simultaneous detection of antibodies to foot-and-mouth disease non-structural proteins 3ABC, 3D, 3A and 3B by a multiplexed Luminex assay to differentiate infected from vaccinated cattle Correlation of XMAP and ELISA cytokine profiles; development and validation for immunotoxicological studies in vitro The non-structural polyprotein 3ABC of foot-and-mouth disease virus as a diagnostic antigen in ELISA to differentiate infected from vaccinated cattle Applications of Luminex xMAP technology for rapid, high-throughput multiplexed nucleic acid detection Advanced multiplexed analysis with the FlowMetrix system Anti-3AB antibodies in the Chinese yellow cattle infected by the O/Taiwan/99 foot-and-mouth disease virus Multiplexed microsphere-based flow cytometric assays Multiplexed microspherebased flow cytometric immunoassays Multiplexed molecular assay for rapid exclusion of foot-and-mouth disease Detection of virus infectionassociated antigen and 3D antibodies in cattle vaccinated against foot and mouth disease Simple and rapid lateral flow assay for the detection of foot and mouth disease virus Multiplexed analysis of human cytokines by use of the FlowMetrix system Multiplexed detection of antibodies to nonstructural proteins of footand-mouth disease virus Toward a multiplexed serotyping immunoassay for footand-mouth disease virus Use of a standardized bovine serum panel to evaluate a multiplexed nonstructural protein antibody assay for serological surveillance of foot-and-mouth disease Differentiation of convalescent animals from those vaccinated against foot-and-mouth disease by a peptide ELISA Differentiation of infection from vaccination in foot-and-mouth disease by the detection of antibodies to the non-structural proteins 3D, 3AB and 3ABC in ELISA using antigens expressed in baculovirus Differentiation of foot-and-mouth disease virus infected animals from vaccinated animals using a blocking ELISA based on baculovirus expressed FMDV 3ABC antigen and a 3ABC monoclonal antibody Multiplexed particle-based flow cytometric assays A multiplexed immunoassay for detection of antibodies against avian influenza virus World Organization for Animal Health (OIE), 2010. To compare the relative sensitivities of NSP antibody assays, our laboratory generated a swine serum panel composed of 320 samples. keywords: 3abc; antibodies; assay; disease; elisa; fmdv; luminex; pigs; sera; serum cache: cord-273361-i5v5rz4x.txt plain text: cord-273361-i5v5rz4x.txt item: #63 of 143 id: cord-275793-k0uvqcmp author: Xia, Hongyan title: A microsphere-based immunoassay for rapid and sensitive detection of bovine viral diarrhoea virus antibodies date: 2010-04-18 words: 2656 flesch: 44 summary: A simple, rapid and reliable enzyme-linked immunosorbent assay for the detection of bovine virus diarrhoea virus (BVDV) specific antibodies in cattle serum, plasma and bulk milk Multiplexed microbead immunoassays by flow cytometry for molecular profiling: basic concepts and proteomics applications The control of bovine viral diarrhoea virus in Europe: today and in the future Principles for eradication of bovine viral diarrhoea virus (BVDV) infections in cattle populations Virus recovery and full-length sequence analysis of the atypical bovine pestivirus Th/04 KhonKaen Maximum likelihood and Bayesian analyses of a combined nucleotide sequence dataset for genetic characterization of a novel pestivirus SVA/cont-08 Phylogeny, classification and evolutionary insights into pestiviruses An ELISA detecting antibody to conserved pestivirus epitopes Bovine virus diarrheaclinical syndromes in dairy herds Severe disease in a dairy herd associated with acute infection with bovine virus diarrhoea virus, Leptospira harjo and Coxiella burnetii Does control of bovine viral diarrhoea infection make economic sense? key: cord-275793-k0uvqcmp authors: Xia, Hongyan; Liu, Lihong; Nordengrahn, Ann; Kiss, István; Merza, Malik; Eriksson, Ronnie; Blomberg, Jonas; Belák, Sándor title: A microsphere-based immunoassay for rapid and sensitive detection of bovine viral diarrhoea virus antibodies date: 2010-04-18 journal: J Virol Methods DOI: 10.1016/j.jviromet.2010.04.009 sha: doc_id: 275793 cord_uid: k0uvqcmp keywords: assay; bovine; detection; elisa; samples; virus cache: cord-275793-k0uvqcmp.txt plain text: cord-275793-k0uvqcmp.txt item: #64 of 143 id: cord-276989-441aclcc author: Liu, Jianbo title: Development of a rapid immunochromatographic strip test for the detection of porcine epidemic diarrhea virus specific SIgA in colostrum date: 2020-03-12 words: 4026 flesch: 46 summary: Validation of specificity and sensitivity of the immunochromatographic strip test PEDV SIgA positive colostrum, TGEV SIgA positive colostrum, PoRV SIgA positive colostrum, and PEDV SIgA negative colostrum were used to test the specificity of the strip. When compared with enzyme-linked immunosorbent assay, kappa value suggesting that the strip could be used to detect PEDV specific SIgA in colostrum samples. keywords: colostrum; pedv; porcine; positive; siga; specific; strip; test; virus cache: cord-276989-441aclcc.txt plain text: cord-276989-441aclcc.txt item: #65 of 143 id: cord-277186-sj8ngpk8 author: He, Qigai title: Characterization of monoclonal antibody against SARS coronavirus nucleocapsid antigen and development of an antigen capture ELISA date: 2005-04-19 words: 4206 flesch: 48 summary: Therefore, more effort should be directed towards developing a simple and inexpensive assay for the detection of SARS CoV proteins. The specificity of the blocking was confirmed if the percentage of inhibition was greater than 50. Detection of SARS CoV protein from human infected cells was mimicked using Sf-9 cells expressing recombinant nucleocapsid, protein according to our previous report (He et al., 2005) . keywords: antibody; antigen; cov; elisa; mab; n195; protein; sars; serum cache: cord-277186-sj8ngpk8.txt plain text: cord-277186-sj8ngpk8.txt item: #66 of 143 id: cord-277265-p8pns7r9 author: Malik, Yashpal Singh title: Biotechnological innovations in farm and pet animal disease diagnosis date: 2019-09-20 words: 7289 flesch: 29 summary: Although, yet not been adopted for animal disease diagnosis, but novel platforms such as smartphonebased diagnosis (which expands nucleic acid-based detection assays toward POCD) like RT-LAMP and fluorescent lateral flow immunoassay (already developed for Zika virus and Dengue virus) provide exciting opportunities for veterinary diagnostics in the near future (Rong et al., 2019) . The real-time PCR (qPCR) is a well-established tool with high sensitivity of pathogens detection and recently, qPCR has been transitioned into POCD platform. keywords: acid; amplification; animal; assays; detection; diagnosis; diseases; dna; elisa; et al; isothermal; methods; nucleic; pathogens; pcr; techniques; time; virus cache: cord-277265-p8pns7r9.txt plain text: cord-277265-p8pns7r9.txt item: #67 of 143 id: cord-277735-a9gkath5 author: Leung, Danny Tze Ming title: Antibody Response of Patients with Severe Acute Respiratory Syndrome (SARS) Targets the Viral Nucleocapsid date: 2004-07-15 words: 4032 flesch: 52 summary: Recombinant viral antigens. Similar results were obtained when the purified N2 and N3 antigens were used as the inhibitor in the WB analysis ( figure 3A) . keywords: antibodies; antigens; elisa; figure; patients; samples; sars; serum; virus cache: cord-277735-a9gkath5.txt plain text: cord-277735-a9gkath5.txt item: #68 of 143 id: cord-278324-eqqvwwh6 author: Wang, Huanan title: Development of a sensitive and specific xMAP assay for detection of antibodies against infectious laryngotracheitis and bronchitis viruses date: 2018-09-21 words: 3515 flesch: 42 summary: The simultaneous quantification of ILTV and IBV antibodies were achieved through the interrogation of microspheres by Luminex 200 detection system. . Relevant positive and negative sera have been prepared for the establishment of the singleplex xMAP assay to detect ILTV antibody or IBV antibody in the serum. keywords: antibodies; assay; detection; ibv; iltv; infectious; virus; xmap cache: cord-278324-eqqvwwh6.txt plain text: cord-278324-eqqvwwh6.txt item: #69 of 143 id: cord-279406-wwdqh9qs author: Guzman, Norberto A. title: A Two-Dimensional Affinity Capture and Separation Mini-Platform for the Isolation, Enrichment, and Quantification of Biomarkers and Its Potential Use for Liquid Biopsy date: 2020-07-30 words: 17193 flesch: 28 summary: Recent advances in enhancing the sensitivity of electrophoresis and electrochromatography in capillaries and microchips Laser-induced fluorometry for capillary electrophoresis Recent trends of capillary electrophoresis-mass spectrometry in proteomics research Advances in capillary electrophoresis for the life science Capillary electrophoresis-based approaches for the study of affinity interactions combined with various sensitive and nontraditional detection techniques Multivalent aptamers: Versatile tools for diagnostic and therapeutic applications Advances in affinity ligand-functionalized nanomaterials for biomagnetic separation Review on biomimetic affinity chromatography with short peptide ligands and its application to protein purification Metal-organics framework-based affinity materials in proteomics Modified bacteriophage tail fiber proteins for labeling, immobilization, capture, and detection of bacteria Rational design of affinity ligands for bioseparation A capture and release method based on noncovalent ligand cross-linking and facile filtration for purification of lectins and glycoproteins The use of a concentration step to collect urinary components separated by capillary electrophoresis and further characterization of collected analytes by mass spectrometry Automated Capillary Electrophoresis Apparatus Immunoaffinity capillary electrophoretic analysis of cyclosporin in tears New approaches in clinical chemistry: On-line analyte concentration and microreaction capillary electrophoresis for the determination of drugs, metabolic intermediates, and biopolymers in biological fluids Affinity capillary electrophoresis: Important application areas and some recent developments Immunoaffinity CE in clinical analysis of body fluids and tissues Microfluidic immunoaffinity separations for bioanalysis Bioanalytical methods for food allergy diagnosis, allergen detection and new allergen discovery Automated microfluidic devices integrating solid-phase extraction, fluorescent labeling, and microchip electrophoresis for preterm birth biomarker analysis Capillary electrophoresis-based immunoassay and aptamer assay: A review Clinical and pharmaceutical applications of affinity ligands in capillary electrophoresis: A review Red diode laser induced fluorescence detection with a confocal microscope on a microchip for capillary electrophoresis Capillary-scale monolithic immunoaffinity columns for immunoextraction with in-line laser induced fluorescence detection Magnetic beads based immunoaffinity capillary electrophoresis of total serum IgE with laser-induced fluorescence detection Demonstration of a direct capture immunoaffinity separation for C-reactive protein using a capillary-based microfluidic device Immunoaffinity extraction of testosterone by antibody immobilized monolithic capillary with on-line laser-induced fluorescence detection Ultrasensitive on-column laser-induced fluorescence in capillary electrophoresis using multiparameter confocal detection Analysis of serum transthyretin by on-line immunoaffinity solid-phase extraction capillary electrophoresis mass spectrometry using magnetic beads Measurement of inflammatory chemokines in micro-dissected tissue biopsy samples by chip-based immunoaffinity capillary electrophoresis Immunoaffinity capture couples with capillary electrophoresis-Mass spectrometry to study therapeutic protein stability in vivo Confocal laser-induced fluorescence detector for narrow capillary system with yoctomole limit of detection Separation of urinary constituents by capillary electrophoresis and further characterization of collected analytes by mass spectrometry Capillary electrophoresis for the analytical separation and semi-preparative collection of monoclonal antibodies Affinity capillary electrophoresis: Two semi-preparative approaches to concentrate samples on the capillary column and to recover microgram quantities of material Fabrication of an analyte concentrator-reaction chamber containing immobilized S. aureus V8 protease: On-column proteolytic digestion of nanogram quantities of substrate using capillary electrophoresis Enzymophoresis of nucleic acids by tandem capillary enzyme reactor-capillary zone electrophoresis Determination of prolyl 4-hydroxylase beta-subunit at the zeptomole level using capillary electrophoresis On-line peptide mapping of antibodies by capillary electrophoresis Selective preconcentration for capillary zone electrophoresis using protein G immunoaffinity capillary electrophoresis Consecutive protein digestion and peptide derivatization employing an on-line analyte concentrator to map proteins using capillary electrophoresis On-line protein digestion by immobilized enzyme microreactor capillary electrophoresis-mass spectrometry On-line immobilized microreactor for evaluating inhibitory activity of phenolic acids by capillary electrophoresis and molecular docking Disease Detection System and Method Method and System for Simultaneous Determination of Multiple Measurable Biomarkers during the Development of a Communicable Disease Real-time imaging through optical fiber array-assisted laser-induced fluorescence of capillary electrophoretic enantiomer separations Chip-based immunoaffinity capillary electrophoresis: Application to the measurement of brain-derived neurotrophic factor in skin biopsies Brain-derived neurotrophic factor and its clinical implications Brain-derived neurotropic factor in brain disorders: Focus on neuroinflammation On-line immunoaffinity capillary electrophoresis based on magnetic beads for the determination of alpha-1-acid glycoprotein isoforms profile to facilitate its use as biomarker Glycoform analysis of alpha-1-acid glycoprotein by capillary electrophoresis Differential glycosylation of alpha-1-acid glycoprotein (AGP-I) contributes to its functional diversity Review on the potential health impact of Ã�-casomorphins and related peptides Impact of milk derived Ã�-casomorphins on physiological functions and trends in research: A review Aytekin, I. A1 and A2 bovine milk, the risk of beta-casomorphin-7 and its possible effects on human health: (I) A1 and A2 milk and the risk of beta-casomorphin-7 A1/A2 milk and Ã�-casomorphins: The resurgence of controversy Milk A1 Ã�-casein and health related outcomes in humans: A systematic review biological properties and other potential effects on human health of Ã�-casomorphin 7: Current knowledge and concerns A method for identifying discriminative isoform-specific peptides for clinical proteomics application An isoform of AIF1 involved in breast cancer PTEN proteoforms in biology and disease How many human proteoforms are there? N-terminal proteoforms in human disease Origins and clinical relevance of proteoforms in pediatric malignancies False positive circumsporozoite protein ELISA: A challenge for the estimation of the entomological inoculation rate of malaria and for vector incrimination High false positive rate of an ELISA screen for the detection of anti-factor VIII antibodies in congenital hemophilia A Preventing intense false positive and negative reactions attributed to the principle of ELISA to re-investigate antibody studies in autoimmune diseases Urea-mediated dissociation alleviate the false-positive Treponema pallidum-specific antibodies detected by ELISA Properties and function of polyreactive antibodies and polyreactive antigen-binding B cells Antibody polyreactivity in health and disease: Status variabilis Natural antibodies-Facts known and unknown. Holding promise for precision medicine and P4 medicine Comparison of ELISA and HPLC-MS methods for the determination of exenatide in biological and biotechnology-based formulation matrices A direct comparison of liquid chromatography-mass spectrometry with clinical routine testing immunoassay methods for the detection and quantification of thyroid hormones in blood serum The pathway through LC-MS method development: In-house or ready-to-use kit-based methods? Current state of bioanalytical chromatography in clinical analysis Detection of 8-OHdG as a diagnostic biomarker High-performance liquid chromatography and enzyme-linked immunosorbent assay techniques for detection and quantification of aflatoxin B1 in feed samples: A comparative study LC-MSMS assays of urinary cortisol, a comparison between four in-house assays Comparison of an HPLC-MS/MS method with multiple commercial ELISA kits on the determination of levels of 8-oxo-7,8-dihydro-2 -deoxyguanosine in human urine Protein biomarker quantification by immunoaffinity liquid chromatography-tandem mass spectrometry: Current state and future vision A brief history of medical diagnosis and the birth of the clinical laboratory Biomedicines 2020 An historical perspective on the clinical diagnostic laboratory Existing and emerging technologies for point-of-care testing The accuracy of point-of-care glucose measurements Physicians'views of self-monitoring of blood glucose in patients with Type 2 diabetes not on insulin Point-of-care diagnostics in low resource settings: Present status and future role of microfluidics Current status and future prospects of point-of-care testing around the globe The clinical and health economic value of clinical laboratory diagnostics Sample preparation in microstructures devices Microchips, microarrays, biochips and nanochips: Personal laboratories for the 21st century Clinically relevant advances in on-chip affinity-based electrophoresis and electrochromatography Fang, Q. A low-cost palmtop high-speed capillary electrophoresis bioanalyzer with laser induced fluorescence detection Capillary Electrophoresis Technology Review on the development of truly portable and in-situ capillary electrophoresis systems Applications of capillary electrophoresis for the early diagnosis of cancer Urinary proteomics and precision medicine for chronic kidney disease: Current status and future perspectives Microfluidic chip electrophoresis for biochemical analysis 3D printed microfluidics Immunoaffinity CE for proteomics studies Immunoaffinity capillary electrophoresis as a powerful strategy for the quantification of low-abundance biomarkers, drugs, and metabolites in biological matrices Applications of microfluidics and microchip electrophoresis for potential clinical biomarker analysis Recent advances in CE and microchip-CE in clinical applications: 2014 to mid-2017 Analysis of inflammatory mediators in newborn dried blood spot samples by chip-base immunoaffinity capillary electrophoresis Recent trends in the quantification of biogenic amines in biofluids as biomarkers of various disorders: A review Biocatalytic amplification of UV signal in capillary electrophoresis of microRNA Enhancement of concentration limits of detection in capillary electrophoresis: Examples of on-line sample preconcentration, cleanup, and microreactor technology in protein characterization On-line solid-phase preconcentration for sensitivity enhancement in capillary electrophoresis On-line preconcentration methods for capillary electrophoresis Lowering the concentration limits of detection by on-line solid-phase extraction-capillary electrophoresis-electrospray mass spectrometry Getting the best sensitivity from on-capillary fluorescence detection in capillary electrophoresis-A tutorial A critical retrospective and prospective review of designs and materials in-line solid-phase extraction capillary electrophoresis Ten principles for conservative, care-full diagnosis Sensitivity enhancement and second-dimensional information from solid-phase extraction-capillary electrophoresis of entire high-performance liquid chromatography fractions keywords: acm; affinity; analysis; antibodies; bdnf; biomarkers; cancer; capture; cells; detection; device; diagnosis; disease; electrophoresis; exosomes; figure; iace; immunoaffinity; instrument; potential; protein; sample; separation; system; technology; transport; use; vesicles; viruses cache: cord-279406-wwdqh9qs.txt plain text: cord-279406-wwdqh9qs.txt item: #70 of 143 id: cord-280939-d478p8u6 author: Abe, Kento T. title: A simple protein-based surrogate neutralization assay for SARS-CoV-2 date: 2020-10-02 words: 7601 flesch: 46 summary: Coronavirus Spike Protein and Tropism Changes Structure, Function, and Antigenicity of the SARS-CoV-2 Spike Glycoprotein SARS-CoV-2 Cell Entry Depends on ACE2 and TMPRSS2 and Is Blocked by a Clinically Proven Protease Inhibitor Neutralizing Antibodies against SARS-CoV-2 and Other Human Coronaviruses Broadly neutralizing antiviral antibodies Deployment of convalescent plasma for the prevention and treatment of COVID-19 Two Detailed Plaque Assay Protocols for the Quantification of Infectious SARS-CoV-2 Protocol and Reagents for Pseudotyping Lentiviral Particles with SARS-CoV-2 Spike Protein for Neutralization Assays Pseudotype Neutralization Assays: From Laboratory Bench to Data Analysis A serological assay to detect SARS-CoV-2 seroconversion in humans Evidence for sustained mucosal and systemic antibody responses to SARS-CoV-2 antigens in COVID-19 patients Dynamics of neutralizing antibody titers in the months after SARS-CoV-2 infection Longitudinal evaluation and decline of antibody responses in SARS-CoV-2 infection Neutralizing and binding antibody kinetics of COVID-19 patients during hospital and convalescent phases SARS-CoV-2 infection induces robust, neutralizing antibody responses that are stable for at least 3 months A SARS-CoV-2 surrogate virus neutralization test based on antibody-mediated blockage of ACE2-spike protein-protein interaction Convergent antibody responses to SARS-CoV-2 in convalescent individuals Structural Basis for Potent Neutralization of Betacoronaviruses by Single-Domain Camelid Antibodies Clinical and immunological assessment of asymptomatic SARS-CoV-2 infections Potent neutralizing antibodies from COVID-19 patients define multiple targets of vulnerability A neutralizing human antibody binds to the N-terminal domain of the Spike protein of SARS-CoV-2 A human monoclonal antibody blocking SARS-CoV-2 infection A noncompeting pair of human neutralizing antibodies block COVID-19 virus binding to its receptor ACE2. While ELISA-based assays to detect and quantitate antibodies to SARS-CoV-2 in patient samples have been developed, the detection of neutralizing antibodies typically requires more demanding cell-based viral assays. keywords: ace2; antibodies; antibody; assay; binding; cov-2; figure; neutralization; protein; rbd; samples; sars; serum; snelisa; spike cache: cord-280939-d478p8u6.txt plain text: cord-280939-d478p8u6.txt item: #71 of 143 id: cord-281081-rifr5uub author: Deng, Junhua title: Serological survey of SARS‐CoV‐2 for experimental, domestic, companion and wild animals excludes intermediate hosts of 35 different species of animals date: 2020-05-07 words: 1525 flesch: 47 summary: After confirming the specificity, sensitivity and suitability of SARS-CoV-2 ELISA kit for different species of experimental animals, clinical serum samples from domestic livestock (pig, cow, sheep, horse), poultry (chicken, duck, goose), experimental animal (mice, rat and rhesus monkey), companion animal (dog and cat) and wild animals (camel, fox, mink, alpaca, ferret, bamboo rat, peacock, eagle, tiger rhinoceros, pangolin, leopard cat, jackal, giant panda, masked civet, porcupine, bear, yellow-throated marten, weasel, red pandas and wild boar) were used for antibody detection. One pet dog was reported to be SARS-CoV-2-positive detected by RT-PCR in Hongkong (https://www.news.gov.hk/eng/2020/02/20200 228/20200 228_093205_796.html). keywords: animals; cov-2; elisa; samples; sars cache: cord-281081-rifr5uub.txt plain text: cord-281081-rifr5uub.txt item: #72 of 143 id: cord-281101-gv1sgbk1 author: Shin, Gu-Choul title: Preparation and characterization of a novel monoclonal antibody specific to severe acute respiratory syndrome-coronavirus nucleocapsid protein date: 2006-08-30 words: 5936 flesch: 42 summary: SARS N proteins exist as phosphorylated forms in mature viral particles, whereas, in host cells, this protein exists in both the dephosphorylated form and the phosphorylated form (Kalicharran and Dales, 1995; Surjit et al., 2005) . Three IgG(2b) mAbs were recognized within the N-terminus of N protein, whereas the epitope of two IgG(1) mAbs localized within the C-terminus. keywords: cells; coronavirus; cov; elisa; mabs; n protein; protein; sars cache: cord-281101-gv1sgbk1.txt plain text: cord-281101-gv1sgbk1.txt item: #73 of 143 id: cord-281393-96j70n2z author: Capai, L. title: Seroprevalence of SARS-CoV-2 IgG antibodies, in Corsica (France), April and June 2020. date: 2020-09-30 words: 3686 flesch: 47 summary: As of September 4th, 2020, the number of SARS-CoV-2 confirmed cases exceeds 26 million and more than 800,000 deaths had been reported. Seroprevalence data based on ELISA assay provided information about previous exposure to SARS-CoV-2 but not about protection. keywords: age; cov-2; license; population; preprint; sars; seroprevalence cache: cord-281393-96j70n2z.txt plain text: cord-281393-96j70n2z.txt item: #74 of 143 id: cord-281760-34wuttqw author: Pereira, E.P.V. title: Egg yolk antibodies (IgY) and their applications in human and veterinary health: A review date: 2019-05-22 words: 9696 flesch: 37 summary: A novel IgY-aptamer hybrid system for cost-effective detection of SEB and its evaluation on food and clinical samples Detection of methicillin-resistant staphylococcus aureus using a specific anti-PBP2a chicken IgY antibody Production of anti-SAG-1 IgY antibody against Toxoplasma gondii parasites and evaluation of antibody activity by ELISA method Novel Fitc-labeled Igy antibody: fluorescence imaging Toxoplasma gondii in vitro Chicken IgY-based coproantigen capture ELISA for diagnosis of human opisthorchiasis Evaluation of recombinant Cryptosporidium hominis GP60 protein and anti-GP60 chicken polyclonal IgY for research and diagnostic purposes Highly sensitive detection of cancer antigen human epidermal growth factor receptor 2 using novel chicken egg yolk immunoglobulin Development of adenosine deaminase-specific IgY antibodies: diagnostic and inhibitory application Evaluation of IgY antibody as a polyspecific coombs-reagent Development of an IgY antibody-based immunoassay for the screening of the CYP2E1 inhibitor/enhancer from herbal medicines Development of IgY based sandwich ELISA for the detection of staphylococcal enterotoxin G (SEG), an egc toxin Content of asthmagen natural rubber latex allergens in commercial disposable gloves Development of indirect competitive ELISA using egg yolk-derived immunoglobulin (IgY) for the detection of gentamicin residues Detection of kanamycin and gentamicin residues in animal-derived food using IgY antibody based ic-ELISA and FPIA Quantum dot-based lateral-flow immunoassay for rapid detection of rhein using specific egg yolk antibodies Therefore, specific IgY antibodies are a relevant alternative to use as antimicrobials in human and veterinary health in the face of the emergence of resistant bacteria. keywords: activity; animals; anti; antibodies; antibody; antigen; chicken; detection; egg; elisa; human; igg; igy; immunoglobulin; mice; production; protein; specific; use; venom; virus; yolk cache: cord-281760-34wuttqw.txt plain text: cord-281760-34wuttqw.txt item: #75 of 143 id: cord-284045-scd3f8vk author: Pape, Constantin title: Microscopy-based assay for semi-quantitative detection of SARS-CoV-2 specific antibodies in human sera date: 2020-10-07 words: 5631 flesch: 46 summary: 506 507 Quantitation and Scoring 508 To distinguish infected cells from control cells we use the dsRNA virus marker channel: infected 510 cells show a signal in this channel while the non-infected control cells should ideally be invisible 511 (see Fig. 3 ). Preferential 129 antibody binding to infected compared to non-infected cells indicates the presence of specific 130 SARS-CoV-2 antibodies in the examined serum. keywords: analysis; antibodies; cells; control; cov-2; detection; fig; images; sars; sera; serum cache: cord-284045-scd3f8vk.txt plain text: cord-284045-scd3f8vk.txt item: #76 of 143 id: cord-284841-flhfagp3 author: Nicol, Thomas title: Assessment of SARS-CoV-2 serological tests for the diagnosis of COVID-19 through the evaluation of three immunoassays: two automated immunoassays (Euroimmun and Abbott) and one rapid lateral flow immunoassay (NG Biotech) date: 2020-06-15 words: 2811 flesch: 50 summary: [ELISA] or chemiluminescence enzyme immunoassays [CLIA]) or rapid detection test (lateral flow immunoassays, LFIA). Serological tests can be used for symptomatic individuals for which RT-PCR testing was either not performed at the time of acute illness or for which nasopharyngeal swab result was found to be negative, and also for epidemiological studies (close contacts screening, screening of health care workers …) keywords: assays; cov-2; igg; lfia; sars cache: cord-284841-flhfagp3.txt plain text: cord-284841-flhfagp3.txt item: #77 of 143 id: cord-285700-9q6vwoct author: Grzelak, Ludivine title: SARS-CoV-2 serological analysis of COVID-19 hospitalized patients, pauci-symptomatic individuals and blood donors. date: 2020-04-24 words: 6534 flesch: 49 summary: Statistical analysis were calculated using Prism 8. Sera from pre-epidemic individuals sampled between 2017 and 2019 (first row), hospitalized cases with confirmed COVID-19 (second row), paucisymptomatics individual from the Crépy-en-Vallois epidemic cluster (third row) and healthy blood donors (last row) were surveyed for anti-SARS-Cov-2 antibodies using four serological assays. The kinetics of anti-N response was described to be similar to that of anti-S, although N responses might appear earlier [15] [16] keywords: anti; antibodies; assay; cov-2; elisa; fig; individuals; license; patients; preprint; sars; sera cache: cord-285700-9q6vwoct.txt plain text: cord-285700-9q6vwoct.txt item: #78 of 143 id: cord-287590-jjft3den author: Rodák, L. title: Use of Monoclonal Antibodies in Blocking ELISA Detection of Transmissible Gastroenteritis Virus in Faeces of Piglets date: 2005-05-05 words: 3719 flesch: 44 summary: Indirect ELISA TGEV antibodies in tested sera, in culture media of hybridomas and in purified mAbTGEV preparations were assayed using the indirect ELISA method. The relationship between incidence of TGEV gastroenteritis and the spread of porcine respiratory coronavirus infection in pig farms is discussed. keywords: antibodies; elisa; gastroenteritis; mab; porcine; samples; tgev; virus cache: cord-287590-jjft3den.txt plain text: cord-287590-jjft3den.txt item: #79 of 143 id: cord-288202-r3r2bc7v author: Morel, Noelia title: A Monoclonal Antibody-Based Copro-ELISA Kit for Canine Echinococcosis to Support the PAHO Effort for Hydatid Disease Control in South America date: 2013-01-10 words: 5128 flesch: 40 summary: Although the rate of success has been highly variable, it has become evident that a tight control of dog infections is the key element to arrest the life cycle of the parasite. However, accurate diagnosis of dog infection is complex and challenging, and other than careful necropsy of dogs, there is no perfect gold standard [6] . keywords: antigens; dogs; elisa; granulosus; hydatigena; infection; parasite; samples; test cache: cord-288202-r3r2bc7v.txt plain text: cord-288202-r3r2bc7v.txt item: #80 of 143 id: cord-289413-mbrw85og author: Flego, Michela title: Intracellular human antibody fragments recognizing the VP35 protein of Zaire Ebola filovirus inhibit the protein activity date: 2019-09-05 words: 5540 flesch: 41 summary: Ebola haemorrhagic fever Ebola virus disease The discovery of a new Ebolavirus, Bombali virus, adds further support for bats as hosts of Ebolaviruses Ebola virus: new insights into disease aetiopathology and possible therapeutic interventions How Ebola and Marburg viruses battle the immune system Strategies of highly pathogenic RNA viruses to block dsRNA detection by RIG-I-like receptors: hide, mask, hit The Ebola virus VP35 protein functions as a type I IFN antagonist Ebola virus protein VP35 impairs the function of interferon regulatory factor-activating kinases IKKepsilon and TBK-1 Ebola virus VP35 antagonizes PKR activity through its C-terminal interferon inhibitory domain Production technologies for monoclonal antibodies and their fragments Expression and targetingof intracellular antibodies in mammalian cells Generation and functional characterization of intracellular antibodies interacting with the kinase domain of human EGF receptor Intracellular antibody capture technology: application to selection of intracellular antibodies recognising the BCR-ABL oncogenic protein Effects of intrabodies specific for rotavirus NSP5 during the virus replicative cycle Intracellular anti-E7 human antibodies in single-chain format inhibit proliferation of HPV16-positive cervical carcinoma cells In vivo antitumor effect of an intracellular single-chain antibody fragment against the E7 oncoprotein of human papillomavirus 16 A novel intracellular antibody against the E6 oncoprotein impairs growth of human papillomavirus 16-positive tumor cells in mouse models Characterization and binding of intracellular antibody fragments to the hepatitis C virus core protein Generation and characterization of single-chain anti-body fragments specific against transmembrane envelope glycoprotein gp46 of maedivisna virus Isolation of a human single chain antibody fragment against oligomeric α-synuclein that inhibits aggregation and prevents α-synuclein-induced toxicity Direct in vivo intracellular selection of conformation-sensitive antibody domains targeting Alzheimer amyloid-β oligomers Human singledomain neutralizing intrabodies directed against Etk kinase: a novel approach to impair cellular transformation A nanobody targeting the F-actin capping protein CapG restrains breast cancer metastasis Purification and functional characterization of the full length recombinant Ebola virus VP35 protein expressed in E. coli dsRNA binding characterization of full length recombinant wild type and mutants Zaire ebolavirus VP35 A luciferase reporter gene assay to measure Ebola virus viral protein 35-associated inhibition of double-stranded RNA-stimulated, retinoic acid-inducible gene 1-mediated induction of interferon β Identification of Myricetin as an Ebola virus VP35−doublestranded RNA interaction inhibitor through a novel fluorescence-based assay Design and use of a phage display library. Ebola Virus Diseases New Ebola outbreak declared in Democratic Republic of the Congo Rapid diagnosis of Ebola hemorrhagic fever by reverse transcription-PCR in an outbreak setting and assessment of patient viral load as a predictor of outcome Identification of essential outstanding questions for an adequate European laboratory response to ebolavirus ZaireWest Africa Detection of Ebola viral antigen by enzyme-linked immunosorbent assay using a novel monoclonal antibody to nucleoprotein Development, characterization and use of monoclonal VP40-antibodies for the detection of Ebola virus Production of monoclonal antibodies and development of an antigen capture ELISA directed against the envelope glycoprotein GP of Ebola virus Strategies in Ebola virus disease (EVD) diagnostics at the point of care Antiviral agents against Ebola virus infection: repositioning old drugs and finding novel small molecules Insights into Ebola virus VP35 and VP24 interferon inhibitory functions and their initial exploitation as drug targets, infectious disorders -drug targets A randomized, controlled trial of ZMapp for Ebola virus infection VP35 knockdown inhibits Ebola virus amplification and protects against lethal infection in mice Postexposure protection of non-human primates against a lethal Ebola virus challenge with RNA interference: a proof-of-concept study Specific in vivo knockdown of protein function by intrabodies Human transbodies that interfere with the functions of Ebola virus VP35 protein in genome replication and transcription and innate immune antagonism Generation of human single-chain antibody to the CD99 cell surface determinant specifically recognizing Ewing's sarcoma tumor cells Publisher's Note Springer Nature remains neutral with regard to jurisdictional claims in published maps and institutional affiliations keywords: antibodies; antibody; assay; binding; cells; ebola; ebov; elisa; ifn; phage; protein; scfv; virus; vp35 cache: cord-289413-mbrw85og.txt plain text: cord-289413-mbrw85og.txt item: #81 of 143 id: cord-290705-7xkt6u73 author: Petrini, Stefano title: Evaluation of Passive Immunity Induced by Immunisation Using Two Inactivated gE-deleted Marker Vaccines against Infectious Bovine Rhinotracheitis (IBR) in Calves date: 2020-01-04 words: 4293 flesch: 46 summary: Other European Union states have implemented compulsory eradication programmes combining test-and-removal with vaccination using marker vaccines, conversely to vaccination strategies used in the USA, where non-marker vaccines are used [3] . Marker vaccines are derived from the deletion of one or more genes responsible for the synthesis of glycoproteins or enzymes keywords: animals; bohv-1; bovine; calves; cattle; marker; samples; vaccines cache: cord-290705-7xkt6u73.txt plain text: cord-290705-7xkt6u73.txt item: #82 of 143 id: cord-291104-6chpmgry author: Leung, Danny T. M. title: Osteopontin Fragments with Intact Thrombin-Sensitive Site Circulate in Cervical Cancer Patients date: 2016-08-05 words: 6276 flesch: 49 summary: It is instructive that at the start of our study, we had actually experimented with pairs of mAbs (e.g. biotinylated-mAb 659 and -mAb 446) in capture ELI-SAs to detect plasma OPN from patients, but none had succeeded. Differences in the antibody pairs used can affect the type of OPN fragment detected and hence the vast discordances among test kits for the same set of plasma samples keywords: cancer; elisa; fig; fraction; kda; mab; opn; osteopontin; patients; plasma; protein cache: cord-291104-6chpmgry.txt plain text: cord-291104-6chpmgry.txt item: #83 of 143 id: cord-293393-kbndie8e author: Braesch-Andersen, Sten title: ApoD Mediates Binding of HDL to LDL and to Growing T24 Carcinoma date: 2014-12-16 words: 6296 flesch: 52 summary: Anti-apoD antibodies capture ApoB in a detergent-free dual specific ELISA. Three flasks each of confluent cells (2.5 million in 9 ml) and non-confluent cells (1.5 million in 7 ml) were sampled 4 times. keywords: anti; apob; apod; apolipoprotein; binding; cells; confluent; elisa; hdl; ldl; particles cache: cord-293393-kbndie8e.txt plain text: cord-293393-kbndie8e.txt item: #84 of 143 id: cord-293770-n4ooziv4 author: Soykut, Esra Acar title: Selection of staphylococcal enterotoxin B (SEB)-binding peptide using phage display technology date: 2008-05-23 words: 3548 flesch: 52 summary: Phage clones (phage 24, phage 9, and phage 6), selected by phage-ELISA technique, were injected to the sensor surface on which SEB was immobilized and the change in the RU induced by the binding of phage clones is shown in Fig. In order to investigate the affinities of selected phage clones to SEB, phage clones were allowed to bind to the SEB immobilized on the sensor surface. keywords: affinity; binding; clones; peptide; phage; seb; sensor; solution; surface cache: cord-293770-n4ooziv4.txt plain text: cord-293770-n4ooziv4.txt item: #85 of 143 id: cord-294478-3ickafd3 author: Kapil, Sanjay title: Diagnostic Investigation of Emerging Viruses of Companion Animals date: 2008-05-22 words: 7330 flesch: 35 summary: Now, these molecular techniques, which are becoming mainstream applications in routine viral diagnoses, are proving their merit in facilitating the diagnosis of emerging animal viruses. Veterinarians are bound to encounter emerging viruses in their practice. keywords: animals; antibodies; antibody; clinical; diagnosis; diseases; dogs; health; laboratory; new; test; testing; veterinary; viral; virus; viruses cache: cord-294478-3ickafd3.txt plain text: cord-294478-3ickafd3.txt item: #86 of 143 id: cord-297684-9q3oopaz author: Dobaño, Carlota title: Highly sensitive and specific multiplex antibody assays to quantify immunoglobulins M, A and G against SARS-CoV-2 antigens date: 2020-06-12 words: 5205 flesch: 30 summary: The multiplex nature of the assay will allow to test this hypothesis in the future with the addition of antigens to related coronaviruses 229E, HKU1, NL63 and OC43 in the same assay panel, by comparing the patterns of antibody reactivity, in order to address the significance of this in immunity to Here, antibody responses to M were very marginal and did not contribute to higher assay sensitivity and this could partly be because the purity of the protein was not high. bioRxiv Antigenic crossreactivity between severe acute respiratory syndrome-associated coronavirus and human coronaviruses 229E and OC43 SARS-CoV-2 specific antibody responses in COVID-19 patients Beyond the Spike: identification of viral targets of the antibody response to SARS-CoV-2 in COVID-19 patients. keywords: antibodies; antibody; antigens; assays; cov-2; covid-19; days; igg; samples; sars; sensitivity; symptoms cache: cord-297684-9q3oopaz.txt plain text: cord-297684-9q3oopaz.txt item: #87 of 143 id: cord-298766-xqkre25z author: Muller, Janine D. title: Improvement of a recombinant antibody-based serological assay for foot-and-mouth disease virus date: 2010-01-31 words: 4994 flesch: 48 summary: The CRAb-AP fusion proteins generated in this study Table 2 Apparent kinetic rate constants and equilibrium binding constants for the interaction of recombinant 3ABC with immobilized FM26 and FM27 scFv proteins (± standard deviation; n = 3). Although non-structural proteins can in theory contaminate the vaccine preparation, it is expected that FMDV vaccines produced by most current commercial manufacturers will not induce significant antibody responses to non-structural proteins. keywords: antibody; crab; fm26; fm27; fmdv; protein; tag cache: cord-298766-xqkre25z.txt plain text: cord-298766-xqkre25z.txt item: #88 of 143 id: cord-299148-uge5uodk author: Wang, Qiang title: A Method To Prevent SARS-CoV-2 IgM False Positives in Gold Immunochromatography and Enzyme-Linked Immunosorbent Assays date: 2020-05-26 words: 2879 flesch: 38 summary: The presence of RF-IgM at mid-to-high levels could lead to false-positive reactivity of SARS-CoV-2 IgM detected using GICA and ELISA, and urea dissociation tests would be helpful in reducing SARS-CoV-2 IgM false-positive results. Comparison of SARS-CoV-2 IgM results and detection performance before and after urea dissociation test of GICA. keywords: cov-2; dissociation; igm; positive; results; sars; urea cache: cord-299148-uge5uodk.txt plain text: cord-299148-uge5uodk.txt item: #89 of 143 id: cord-299189-59d4aojh author: Zou, Hao title: Transmissible gastroenteritis virus: Identification of M protein-binding peptide ligands with antiviral and diagnostic potential date: 2013-07-02 words: 4571 flesch: 46 summary: In the current study, three TGEV M-binding phage and the concomitant peptides were identified from a phage display library. key: cord-299189-59d4aojh authors: Zou, Hao; Zarlenga, Dante S.; Sestak, Karol; Suo, Siqingaowa; Ren, Xiaofeng title: Transmissible gastroenteritis virus: Identification of M protein-binding peptide ligands with antiviral and diagnostic potential date: 2013-07-02 journal: keywords: cells; peptgev; peptide; phage; protein; tgev; virus cache: cord-299189-59d4aojh.txt plain text: cord-299189-59d4aojh.txt item: #90 of 143 id: cord-300701-vkzya7uq author: Ijaz, M. K. title: Effect of different routes of immunization with bovine rotavirus on lactogenic antibody response in mice date: 1987-12-31 words: 4326 flesch: 46 summary: In rats and mice, milk antibody is probably locally produced since a marked number of Ig-containing cells are present in the mammary gland from late pregnancy through parturition and lactation to involution (Lee et al., 1979) . However, anti-rotavirus antibody titers, as determined by ELISA, were consistently higher than virus neutralization titers, with the exception of the group immunized 0 keywords: antibodies; antibody; brv; immunization; milk; rotavirus cache: cord-300701-vkzya7uq.txt plain text: cord-300701-vkzya7uq.txt item: #91 of 143 id: cord-300908-i80tuhqk author: Yu, Fuxun title: Application of recombinant severe fever with thrombocytopenia syndrome virus nucleocapsid protein for the detection of SFTSV-specific human IgG and IgM antibodies by indirect ELISA date: 2015-08-04 words: 4204 flesch: 47 summary: The expression construct encompassing amino acid (aa) 1-246, the full length of SFTSV N protein with a vector derived His-tag (histidine hexmer) at the N-terminus, was obtained. Recombinant N protein of Rift Valley Fever (RVF) virus, another member of the Phlebovirus genus, was reported to be used in a detection system for the laboratory diagnosis of RFV infection in humans and animals keywords: elisa; fever; igg; igm; indirect; protein; rsftsv; samples; serum; virus cache: cord-300908-i80tuhqk.txt plain text: cord-300908-i80tuhqk.txt item: #92 of 143 id: cord-301175-6alsigxk author: Okda, Faten title: Development of an indirect ELISA, blocking ELISA, fluorescent microsphere immunoassay and fluorescent focus neutralization assay for serologic evaluation of exposure to North American strains of Porcine Epidemic Diarrhea Virus date: 2015-08-01 words: 8291 flesch: 42 summary: Well-validated iELISA, bELISA and FMIA assays for the detection of PEDV antibodies were developed and showed good correlation with IFA and each other. Currently, serum virus neutralization (SVN) tests are the most widely employed serological assays used to detect PEDV antibodies. keywords: antibodies; antibody; antigen; assays; belisa; detection; diarrhea; epidemic; fmia; pedv; porcine; protein; samples; serum; virus cache: cord-301175-6alsigxk.txt plain text: cord-301175-6alsigxk.txt item: #93 of 143 id: cord-301313-9595vm0k author: OKBA, NISREEN M.A. title: SARS-CoV-2 specific antibody responses in COVID-19 patients date: 2020-03-20 words: 4281 flesch: 48 summary: Serum samples from SARS patients (7) were kindly provided by professor Malik Peiris, Hong Kong University. The virus was identified to be a betacoronavirus related to severe acute respiratory syndrome coronavirus (SARS-CoV) and thus, was named SARS-CoV-2 (2) . keywords: antibodies; cov; cov-2; medrxiv; patients; preprint; sars; sera cache: cord-301313-9595vm0k.txt plain text: cord-301313-9595vm0k.txt item: #94 of 143 id: cord-301355-9lswjro2 author: Fan, Jing-Hui title: Development of an enzyme-linked immunosorbent assay for the monitoring and surveillance of antibodies to porcine epidemic diarrhea virus based on a recombinant membrane protein date: 2015-12-01 words: 3975 flesch: 45 summary: The M protein of PEDV protrudes from the viral envelope, and is considered a superior diagnostic antigen compared with other PEDV proteins (Shenyang et al., 2007) . The nucleotide sequence of the PEDV M gene exhibits low homology (around 50%) with the M gene of other coronaviruses; however, its sequence is highly conserved among different PEDV strains Arndt et al., 2010) . keywords: antibodies; diarrhea; elisa; epidemic; pedv; porcine; protein; samples; serum; virus cache: cord-301355-9lswjro2.txt plain text: cord-301355-9lswjro2.txt item: #95 of 143 id: cord-301655-6nxhvvm4 author: Lei, Xi-Mei title: Specific recombinant proteins of porcine epidemic diarrhea virus are immunogenic, revealing their potential use as diagnostic markers date: 2019-08-10 words: 6457 flesch: 40 summary: The purified recombinant PEDV S1, ORF3C, E, ADRP, Nsp1, Nsp2, and Ac peptides were resolved on a 5-10% Bis-Tris polyacrylamide gel (Invitrogen) by electrophoresis and subsequently transferred onto a polyvinylidene difluoride (PVDF) membrane. Collectively, the data indicated that the PEDV S1 protein was more specific and accurate as a detection antigen in ELISA tests. keywords: anti; antibodies; elisa; fig; orf3c; pedv; porcine; proteins; serum; virus cache: cord-301655-6nxhvvm4.txt plain text: cord-301655-6nxhvvm4.txt item: #96 of 143 id: cord-301974-4wn40ivq author: Berry, Jody D title: Development and characterisation of neutralising monoclonal antibody to the SARS-coronavirus date: 2004-09-01 words: 5883 flesch: 46 summary: Assays that detect the presence of virally encoded proteins or nucleic acids may be preferable for diagnosis of SARS infections as the development of serum antibodies in infected individuals is quite protracted (Li et al., 2003a) . This is important as early detection of SARS infections is key to risk management of this disease. keywords: antigen; binding; cell; cov; elisa; immunoblot; mabs; neutralising; protein; sars; specific; spike; virus cache: cord-301974-4wn40ivq.txt plain text: cord-301974-4wn40ivq.txt item: #97 of 143 id: cord-305516-s1lvhknm author: Watanabe, Shumpei title: Epizootology and experimental infection of Yokose virus in bats date: 2008-09-11 words: 4139 flesch: 52 summary: They concluded that YOKV is genetically closer to yellow fever virus or Sepik virus than JEV, and it is most closely related to Entebbe bat virus. Moreover, previous reports indicated that Entebbe bat virus can replicate in mosquito cells in vitro keywords: antibodies; antigen; bats; elisa; samples; sera; serum; virus; yokv cache: cord-305516-s1lvhknm.txt plain text: cord-305516-s1lvhknm.txt item: #98 of 143 id: cord-306390-pzzev8hd author: Reisinger, Emil C. title: Mütter-Screening in einem COVID-19-Niedrig-Pandemiegebiet: Bestimmung SARS-CoV-2-spezifischer Antikörper bei 401 Rostocker Müttern mittels ELISA und Immunfluoreszenz-Bestätigungstest date: 2020-06-22 words: 1546 flesch: 48 summary: So hat ein mit SARS-CoV-2 infizierter 9-jähriger Junge die Infektion trotz zahlreicher sozialer Kontakte nicht weitergegeben In dieser Pilotstudie wurden 401 Mütter von Kindern im Alter von 1-10 Jahren als Sentinel untersucht, um die Prävalenz der Infektion mit SARS-CoV-2 auch bei Kindern abzuschätzen. keywords: bei; cov-2; covid-19; der; die; elisa; infektion; kindern; mit; sars; und; von cache: cord-306390-pzzev8hd.txt plain text: cord-306390-pzzev8hd.txt item: #99 of 143 id: cord-307110-eiobmxp2 author: Zhao, Shan title: Serological Screening for Coronavirus Infections in Cats date: 2019-08-13 words: 6749 flesch: 52 summary: FCoV S1 domains of both type 1 and 2, namely S1 0-CD , were expressed as murine Fc fusion proteins in HEK-293T cells as described above. S1 S1 0 keywords: cats; coronavirus; cross; fcov; fcov type; feline; pedv; positive; reactivity; sera; specific; type cache: cord-307110-eiobmxp2.txt plain text: cord-307110-eiobmxp2.txt item: #100 of 143 id: cord-309415-77b5erfj author: Nguyen, T. D. title: Étude comparée de trois souches du coronavirus de la gastroentérite transmissible: Conditions de la réplicationvirale et de la synthèse des antigènes structuraux date: 1987-09-30 words: 2534 flesch: 49 summary: L'addition de la tunicamycine dans le milieu a pour effet de diminuer le rendement en virus infectieux ( fig. 4 ). [20] apartir du virus de I'hepatite murine montrent que, en presence de la tunicamycine, des particules virales infectieuses continuent aetre formees, bien que moins nombreuses « 1 0/0). keywords: cellules; dans; des; les; par; que; souche; synthese; tunicamycine; virus cache: cord-309415-77b5erfj.txt plain text: cord-309415-77b5erfj.txt item: #101 of 143 id: cord-310536-u30cufg7 author: Finger, Paula Fonseca title: Combined use of ELISA and Western blot with recombinant N protein is a powerful tool for the immunodiagnosis of avian infectious bronchitis date: 2018-12-12 words: 4667 flesch: 47 summary: key: cord-310536-u30cufg7 authors: Finger, Paula Fonseca; Pepe, Michele Soares; Dummer, Luana Alves; Magalhães, Carolina Georg; de Castro, Clarissa Caetano; de Oliveira Hübner, Silvia; Leite, Fábio Pereira Leivas; Ritterbusch, Giseli Aparecida; Esteves, Paulo Augusto; Conceição, Fabricio Rochedo title: Combined use of ELISA and Western blot with recombinant N protein is a powerful tool for the immunodiagnosis of avian infectious bronchitis date: 2018-12-12 journal: Virol J DOI: 10.1186/s12985-018-1096-2 sha: doc_id: 310536 cord_uid: u30cufg7 BACKGROUND: The avian infectious bronchitis virus (IBV) remains a significant source of loss in the poultry industry and early diagnosis is required to prevent the disease from spreading. In order to evaluate the repeatability of the ELISA-rN, three separate batches of recombinant N protein were produced and purified following the methodology described above with distinct purification times, to demonstrate the reproducibility of the recombinant protein expression procedure. keywords: bronchitis; commercial; elisa; ibv; negative; positive; protein; results; test; virus cache: cord-310536-u30cufg7.txt plain text: cord-310536-u30cufg7.txt item: #102 of 143 id: cord-311349-145kwny3 author: Mariani, Stefano title: Surface plasmon resonance applications in clinical analysis date: 2014-02-25 words: 13457 flesch: 33 summary: Advances in surface plasmon resonance biosensor technology towards high-throughput, food-safety analysis Recent developments and applications of surface plasmon resonance biosensors for the detection of mycotoxins in foodstuffs Surface plasmon resonance for detection of genetically modified organisms in the food supply Direct detection of E. Coli O157:H7 in selected food systems by a surface plasmon resonance biosensor Surface plasmon resonance in doping analysis Realtime and label-free bio-sensing of molecular interactions by surface plasmon resonance: a laboratory medicine perspective Cancer biomarker detection by surface plasmon resonance biosensors Proteomic applications of surface plasmon resonance biosensors: analysis of protein arrays Surface plasmon resonance mass spectrometry in proteomics Rapid and label-free bacteria detection by surface plasmon resonance (SPR) biosensors Recent advancements in surface plasmon resonance immunosensors for detection of small molecules of biomedical, food and environmental interest Emerging optofluidic technologies for point-of-care genetic analysis systems: a review Surface plasmon resonance sensors: review Advances in surface plasmon resonance biosensor analysis Present and future of surface plasmon resonance biosensors Recent advances in surface plasmon resonance based techniques for bioanalysis Surface plasmon resonance sensors for detection of chemical and biological species Surface plasmon resonance imaging Surface plasmon resonance imaging for affinity-based biosensors Surface plasmon resonance imaging measurements of ultrathin organic films Surface plasmon resonance imaging as a tool to monitor biomolecular interactions in an array based format On a remarkable case of uneven distribution of light in a diffraction grating spectrum Radiative decay of non-radiative surface plasmons excited by light Excitation of nonradiative surface plasma waves in silver by the method of frustrated total reflection Surface plasmon resonance sensing of nucleic acids: a review Immunosensors-principles and applications to clinical chemistry Surface plasmon resonancebased immunoassays Surface plasmon resonance imaging for nucleic acid detection Artificial DNA and surface plasmon resonance New trends in affinity sensing: aptamers for ligand binding Aptamer-based molecular recognition for biosensor development From oligonucleotide shapes to genomic SELEX: novel biological regulatory loops Methods developed for SELEX Advances in the manufacture of MIP nanoparticles Molecularly imprinted polymers and their use in biomimetic sensors The art of immobilization for SPR sensors. SPR based biosensor belongs to refractometric devices, since the propagation of the SPW is sensitive to changes in the refractive index of the dielectric. keywords: analysis; anti; antibodies; assay; biosensor; buffer; cancer; chip; coupling; detection; dna; et al; human; imaging; method; patients; plasmon; plasmon resonance; protein; resonance; samples; sensing; sensitivity; sera; serum; spr; surface; surface plasmon cache: cord-311349-145kwny3.txt plain text: cord-311349-145kwny3.txt item: #103 of 143 id: cord-311811-nrodyagi author: Schutzer, Steven E. title: The use of host factors in microbial forensics date: 2019-12-06 words: 7653 flesch: 43 summary: Perhaps, the pattern of antibody response which has the most forensic value, by providing a timeframe, is the appearance of IgM first, followed by a B-cell switch to the longer-lasting IgG. During the early phase of exposure, IgM predominates, as time goes on, IgG may wax and wane and IgM is no longer found ( Fig. 14.2) . In an area where recombinant vaccines are being developed or used antibody response would be different between someone using one type of recombinant vaccine as compared with someone using another type of vaccine. keywords: anthrax; antibody; antigens; cases; disease; et al; exposure; igg; igm; infection; person; response; test cache: cord-311811-nrodyagi.txt plain text: cord-311811-nrodyagi.txt item: #104 of 143 id: cord-312456-6lxc2rj2 author: Soltan, Mohamed A. title: Comparison of electron microscopy, ELISA, real time RT-PCR and insulated isothermal RT-PCR for the detection of Rotavirus group A (RVA) in feces of different animal species date: 2016-05-11 words: 4217 flesch: 45 summary: The lyophilized Premix was rehydrated before reaction in 50 l Premix Buffer B and 5 l of sample RNA were added to the mixture. The aim of this investigation was to evaluate a commercially available RT-iiPCR assay for RVA detection in feces from different animal species. keywords: assay; detection; iipcr; pcr; rotavirus; rtrt; rva; samples cache: cord-312456-6lxc2rj2.txt plain text: cord-312456-6lxc2rj2.txt item: #105 of 143 id: cord-313193-q5zeoqlb author: Carrat, F. title: Seroprevalence of SARS-CoV-2 among adults in three regions of France following the lockdown and associated risk factors: a multicohort study. date: 2020-09-18 words: 4082 flesch: 45 summary: It is based on a consortium of prospective cohort studies including three general population-based adult cohorts and two child-cohorts (not presented in this study). https://doi.org/10.1101/2020.09.16.20195693 doi: medRxiv preprint results or ELISA-S <0.7 were true negatives. keywords: copyright holder; funder; license; medrxiv; peer; peer review; preprint; review; september cache: cord-313193-q5zeoqlb.txt plain text: cord-313193-q5zeoqlb.txt item: #106 of 143 id: cord-313517-5ipj2z86 author: Fung, Joshua title: Antigen Capture Enzyme-Linked Immunosorbent Assay for Detecting Middle East Respiratory Syndrome Coronavirus in Humans date: 2019-09-14 words: 2711 flesch: 45 summary: World Health Organization, 20 Avenue Appia Laboratory Testing for Middle East Respiratory Syndrome Coronavirus A sensitive and specific antigen detection assay for Middle East respiratory syndrome coronavirus Detection of a novel human coronavirus by real-time reverse-transcription polymerase chain reaction Assays for laboratory confirmation of novel human coronavirus (hCoV-EMC) infections Presence of Middle East respiratory syndrome coronavirus antibodies in Saudi Arabia: a nationwide, crosssectional, serological study Seroepidemiology for MERS coronavirus using microneutralisation and pseudoparticle virus neutralisation assays reveal a high prevalence of antibody in dromedary camels in Egypt Are other fluorescent tags used instead of ethidium bromide safer Clinical features and virological analysis of a case of Middle East respiratory syndrome coronavirus infection Clinical and laboratory findings of the first imported case of Middle East respiratory syndrome coronavirus to the United States Middle East respiratory syndrome coronavirus infection in dromedary camels in Saudi Arabia A highly specific rapid antigen detection assay for on-site diagnosis of MERS Rapid detection of MERS coronavirus-like viruses in bats: pote1n-tial for tracking MERS coronavirus transmission and animal origin Genetic characterization of Betacoronavirus lineage C viruses in bats reveals marked sequence divergence in the spike protein of pipistrellus bat coronavirus HKU5 in Japanese pipistrelle: implications for the origin of the novel Middle East respiratory syndrome coronavirus Differential diagnosis of pandemic (H1N1) 2009 infection by detection of haemagglutinin with an enzyme-linked immunoassay SARS coronavirus detection methods Detection of severe acute respiratory syndrome (SARS) coronavirus nucleocapsid protein in sars patients by enzyme-linked immunosorbent assay Differential cell line susceptibility to the emerging novel human betacoronavirus 2c EMC/2012: implications for disease pathogenesis and clinical manifestation Cross-reactive antibodies in convalescent SARS patients' sera against the emerging novel human coronavirus EMC (2012) by both immunofluorescent and neutralizing antibody tests 1. key: cord-313517-5ipj2z86 authors: Fung, Joshua; Lau, Susanna K. P.; Woo, Patrick C. Y. title: Antigen Capture Enzyme-Linked Immunosorbent Assay for Detecting Middle East Respiratory Syndrome Coronavirus in Humans date: 2019-09-14 journal: MERS Coronavirus DOI: 10.1007/978-1-0716-0211-9_7 sha: doc_id: 313517 cord_uid: 5ipj2z86 The Middle East respiratory syndrome (MERS) is the second novel zoonotic disease infecting humans caused by coronavirus (CoV) in this century. keywords: antigen; assay; capture; coronavirus; cov; elisa; mers; plate cache: cord-313517-5ipj2z86.txt plain text: cord-313517-5ipj2z86.txt item: #107 of 143 id: cord-316723-srenbxa7 author: Zhao, Jincun title: Development and evaluation of an enzyme-linked immunosorbent assay for detection of antibodies against the spike protein of SARS-coronavirus date: 2004-11-23 words: 3111 flesch: 57 summary: Amino acids 270 to 510 of the severe acute respiratory syndrome coronavirus spike protein are required for interaction with receptor Antibody detection of SARS-CoV spike and nucleocapsid protein The secret life of ACE2 as a receptor for the SARS virus Development of a Western blot assay for detection of antibodies against coronavirus causing severe acute respiratory syndrome Antigenicity and receptor-binding ability of recombinant SARS coronavirus spike protein Mass spectrometric characterization of proteins from the SARS virus: a preliminary report Angiotensin-converting enzyme 2 is a functional receptor for the SARS coronavirus Immunological characterization of the spike protein of SARS-coronavirus The genome sequence of the SARS-associated coronavirus Coronavirus as a possible cause of severe acute respiratory syndrome Characterization of a novel coronavirus associated with severe acute respiratory syndrome Molecular modeling of S1 and S2 subunits of SARS coronavirus spike glycoprotein Potent neutralization of severe acute respiratory syndrome (SARS) coronavirus by a human mAb to S1 protein that blocks receptor association Profiles of antibody responses against severe acute respiratory syndrome coronavirus recombinant proteins and their potential use as diagnostic markers Structural characterization of the SARS-coronavirus spike S fusion protein core Expression cloning of functional receptor used by SARS coronavirus A 193-amino acid fragment of the SARS coronavirus S protein efficiently binds angiotensinconverting enzyme 2 Relative rates of non-pneumonic SARS coronavirus infection and SARS coronavirus pneumonia Early detection of antibodies against various structural proteins of the SARS-associated coronavirus in SARS patients The SARS-CoV S glycoprotein: expression and functional characterization SARS-associated coronavirus quasispecies in individual patients Proteomic analysis on structural proteins of severe acute respiratory syndrome coronavirus An exposed domain in the severe acute respiratory syndrome coronavirus spike protein induces neutralizing antibodies The first two authors contributed equally to this work. DNA coding for S450-650 of SARS CoV S protein was PCR amplified using high fidelity Taq DNA polymerase (TaKaRa Biotech Co. Ltd., Japan). keywords: abs; anti; cov; elisa; protein; s450; sars cache: cord-316723-srenbxa7.txt plain text: cord-316723-srenbxa7.txt item: #108 of 143 id: cord-317026-9zgc6xrb author: Zhao, Shan title: Development and Validation of a S1 Protein-Based ELISA for the Specific Detection of Antibodies against Equine Coronavirus date: 2019-11-30 words: 6244 flesch: 50 summary: To confirm the presence of ECoV specific IgG in Icelandic horses, 24 horse sera with positive ECoV S1 ELISA results (in panel H, S/P value > 0.5) were tested in ECoV neutralization assays. To confirm the presence of ECoV specific IgG in Icelandic horses, 24 horse sera with positive ECoV S1 ELISA results (in panel H, S/P value > 0.5) were tested in ECoV neutralization assays. keywords: coronavirus; ecov; elisa; equine; horses; samples; sera; serum; values; vnt cache: cord-317026-9zgc6xrb.txt plain text: cord-317026-9zgc6xrb.txt item: #109 of 143 id: cord-317057-c2bwky6e author: Pickering, S. title: Comparative assessment of multiple COVID-19 serological technologies supports continued evaluation of point-of-care lateral flow assays in hospital and community healthcare settings date: 2020-06-04 words: 5312 flesch: 48 summary: Therefore, before deployment in situations where the pre-test prevalence is likely to be low, such as seroprevalence studies, out-patient assessment or pre-admission screening for operations, these assays will require further evaluation with known SARS-CoV-2 asymptomatic and ambulatory cases, alongside an extended set of pre-pandemic samples. In summary, our study compares the performance of 10 commercially available platforms and several combinations of in-house methods for the detection of anti-SARS-CoV-2 antibodies in serum samples. keywords: author; funder; holder; june; license; medrxiv; perpetuity; preprint; samples; version cache: cord-317057-c2bwky6e.txt plain text: cord-317057-c2bwky6e.txt item: #110 of 143 id: cord-317123-0tdfvlqd author: Tan, Xiaotian title: Rapid and quantitative detection of COVID-19 markers in micro-liter sized samples date: 2020-04-21 words: 4164 flesch: 46 summary: First, S1 protein is immobilized on the capillary inner surface through a poly-histidine mediation approach (see Figures S1 and S2(A) for details). To evaluate the differences in antibody's affinity towards SARS-CoV-2 S1 and SARS-CoV S1, we performed a side-by-side study with these two types of S1 proteins for all three clones of antibodies. keywords: antibodies; antibody; cov-2; detection; igg; protein; sars cache: cord-317123-0tdfvlqd.txt plain text: cord-317123-0tdfvlqd.txt item: #111 of 143 id: cord-317223-juw4xt8q author: Pedersen, Niels C. title: The causes of false-positives encountered during the screening of old-world primates for antibodies to human and simian retroviruses by ELISA date: 1986-11-30 words: 3926 flesch: 48 summary: False positive ELISA antibody tests, while sporadically encountered among most of the 50 species of oldworld primates, were especially prevalent in Mandrillus sphinx (mandrills), Macaca fasicularis (crab-eating macaques) , Macaca sifensus (lion-tailed macaques), Cercopithecus aethiops (African green monkeys), Cercopithecus neglectus (De-Brazza's guenons), Cercopithecus cephus (moustached guenons) and Miopithecus talapoin (talapoins) . Similar to Western blots prepared from whole virus, there was a pronounced tendency for positive sera to produce a greater diffuse background staining than negative sera (data not shown). keywords: african; antibodies; antibody; elisa; htlv; iii; sera; species; virus cache: cord-317223-juw4xt8q.txt plain text: cord-317223-juw4xt8q.txt item: #112 of 143 id: cord-318266-i8x80knq author: Böse, Reinhard title: Diagnosis of Babesia caballi infections in horses by enzyme-linked immunosorbent assay (ELISA) and western blot date: 1994-05-31 words: 3631 flesch: 56 summary: From this, B. caballi antigens were extracted with the detergent 3-[(3-Cholamidopropyl)-dimethylammonio]-1-propane-sulfonate (CHAPS) and used as ELISA antigens. Positive ELISA results can be confirmed by Western blot, if a species-specific diagnosis is required. keywords: antigen; blot; cft; elisa; ifat; results; sera cache: cord-318266-i8x80knq.txt plain text: cord-318266-i8x80knq.txt item: #113 of 143 id: cord-318444-sgm24q1i author: Walter, Justin D. title: Sybodies targeting the SARS-CoV-2 receptor-binding domain date: 2020-05-16 words: 5915 flesch: 38 summary: Concave ADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCX-VXVGXXYXGQGTQVTVS Phylogene c tree of RBD sybodies. Additionally, we identified a pair of anti-RBD sybodies that can simultaneously bind to the RBD. keywords: binders; binding; cov-2; elisa; fig; fusion; protein; rbd; sars; selection; spike; sybodies; sybody; tbs; vyfp cache: cord-318444-sgm24q1i.txt plain text: cord-318444-sgm24q1i.txt item: #114 of 143 id: cord-320559-up1q3k6q author: Dortmans, J.C.F.M. title: Porcine epidemic diarrhea virus (PEDV) introduction into a naive Dutch pig population in 2014 date: 2018-05-24 words: 4221 flesch: 51 summary: We declare no conflict of interest. Surveillance and control of PED coronavirus in pigs in Italy Porcine epidemic diarrhea virus shedding and antibody response in swine farms: a longitudinal study Isolation and characterization of porcine epidemic diarrhea viruses associated with the 2013 disease outbreak among swine in the United States Viral disease affects U.S. Pigs: porcine epidemic diarrhea found in at least 11 states Updated epidemiological data on PED Good practices for biosecurity in the pig sector -issues and options in developing and transition countries Coronaviruses: an overview of their replication and pathogenesis Detection of antibodies against porcine epidemic diarrhea virus in serum and colostrum by indirect ELISA Reactivity of porcine epidemic diarrhea virus structural proteins to antibodies against porcine enteric coronaviruses: diagnostic implications Previous infection of sows with a mild strain of porcine epidemic diarrhea virus confers protection against infection with a severe Complete genome sequence of a porcine epidemic diarrhea S gene indel strain isolated in France Comparison of porcine epidemic diarrhea viruses from Germany and the United States Origin, evolution, and genotyping of emergent porcine epidemic diarrhea virus strains in the United States Multiplex realtime RT-PCR for the simultaneous detection and quantification of transmissible gastroenteritis virus and porcine epidemic diarrhea virus Completion of the porcine epidemic diarrhoea coronavirus (PEDV) genome sequence Porcine epidemic diarrhea virus: an emerging and re-emerging epizootic swine virus Wild boars harboring porcine epidemic diarrhea virus (PEDV) may play an important role as a PEDV reservoir Manipulation of the porcine epidemic diarrhea virus genome using targeted RNA recombination Cellular entry of the porcine epidemic diarrhea virus Experimental infection of a US spike-insertion deletion porcine epidemic diarrhea virus in conventional nursing piglets and cross-protection to the original US PEDV infection Antigenic relationships among porcine epidemic diarrhea virus and transmissible gastroenteritis virus strains Role of transportation in spread of porcine epidemic diarrhea virus infection Epidemic of diarrhoea caused by porcine epidemic diarrhoea virus in Italy Outbreak of porcine epidemic diarrhea virus in Portugal Cell culture isolation and sequence analysis of genetically diverse US porcine epidemic diarrhea virus strains including a novel strain with a large deletion in the spike gene Comparison of serum neutralization and enzyme-linked immunosorbent assay on sera from porcine epidemic diarrhea virus vaccinated pigs A new coronavirus-like particle associated with diarrhea in swine Porcine epidemic diarrhoea virus: a comprehensive review of molecular epidemiology, diagnosis, and vaccines Emergence of porcine epidemic diarrhea virus in southern Germany First detection, clinical presentation and phylogenetic characterization of porcine epidemic diarrhea virus in Austria Emergence of porcine epidemic diarrhea virus in the United States: clinical signs, lesions, and viral genomic sequences MEGA6: molecular evolutionary genetics analysis version 6.0 WIN EPISCOPE 2.0: improved epidemiological software for veterinary medicine Distinct characteristics and complex evolution of PEDV strains New variant of porcine epidemic diarrhea virus Pig farming keywords: diarrhea; epidemic; farms; netherlands; pedv; porcine; samples; virus cache: cord-320559-up1q3k6q.txt plain text: cord-320559-up1q3k6q.txt item: #115 of 143 id: cord-321691-46la29tm author: Hsueh, Po-Ren title: SARS Antibody Test for Serosurveillance date: 2004-09-17 words: 2800 flesch: 38 summary: Ho Ping and Yang Ming Hospitals had admitted SARS patients before the recognition of SARS and before healthcare workers had implemented control measures. Use of laboratory methods for SARS diagnosis Evaluation of reverse transcriptase-PCR assays for rapid diagnosis of severe acute respiratory syndrome associated with a novel coronavirus surveillance case definition for severe acute respiratory syndrome (SARS) and update on SARS cases-United States and worldwide The severe acute respiratory syndrome Profile of specific antibodies to the SARS-associated coronavirus SARS Laboratory Workshop. keywords: cov; elisa; patients; peptide; samples; sars; serum cache: cord-321691-46la29tm.txt plain text: cord-321691-46la29tm.txt item: #116 of 143 id: cord-322529-3xn5v54s author: Rodák, L. title: Verification of Sensitivity and Specificity of Group A Rotavirus Detection in Piglets Faeces with Monoclonal Blocking ELISA Methods date: 2004-06-30 words: 3219 flesch: 41 summary: However, of 26 samples positive by EM, rotavirus A was detected by CB‐ELISA in 19 (73.1%) samples; indicating the share of group A rotavirus in all cases of gastroenteritis caused by rotavirus. Of 194 field faecal samples rotavirus was detected in 43 samples by CB-ELISA whereas in 26 samples by EM. keywords: detection; elisa; kit; rotavirus; samples; wells cache: cord-322529-3xn5v54s.txt plain text: cord-322529-3xn5v54s.txt item: #117 of 143 id: cord-326232-668f53qc author: Toftaker, Ingrid title: Evaluation of a multiplex immunoassay for bovine respiratory syncytial virus and bovine coronavirus antibodies in bulk tank milk against two indirect ELISAs using latent class analysis date: 2018-06-01 words: 5628 flesch: 48 summary: Bovine coronavirus as the causative agent of winter dysentery: serological evidence Key Numbers from the Norwegian Dairy Herd Recording System Bovine coronavirus associated syndromes Estimation of diagnostic-test sensitivity and specificity through Bayesian modeling Herd-level interpretation of test results for epidemiologic studies of animal diseases Using latent class analysis to estimate the test characteristics of the γinterferon test, the single intradermal comparative tuberculin test and a multiplex immunoassay under Irish conditions Evaluation and application of an indirect ELISA for the detection of antibodies to bovine respiratory syncytial virus in milk, bulk milk, and serum Estimation of sensitivity and specificity of diagnostic tests and disease prevalence when the true disease state is unknown Conditional dependence between tests affects the diagnosis and surveillance of animal diseases Respiratory infections in Norwegian dairy calves Estimating the error rates of diagnostic tests Occurrence and phylogenetic analysis of bovine respiratory syncytial virus in outbreaks of respiratory disease in Norway Association between the level of antibodies in bulk tank milk and bovine respiratory syncytial virus exposure in the herd STARD-BLCM: The latent class model assumes that for the ith subpopulation the counts (O i ) of the different combinations of test results, e.g. POS/POS, POS/ NEG, etc. for the two tests follow a multinomial distribution keywords: bcv; brsv; cut; elisa; multiplex; test cache: cord-326232-668f53qc.txt plain text: cord-326232-668f53qc.txt item: #118 of 143 id: cord-327890-ocisq7e4 author: Pallett, Scott J C title: Point-of-care serological assays for delayed SARS-CoV-2 case identification among health-care workers in the UK: a prospective multicentre cohort study date: 2020-07-24 words: 5951 flesch: 36 summary: Lateral flow serological assay testing was done with the Onsite CTK Biotech COVID-19 split IgG/IgM Rapid Test (CTK Biotech, Poway, CA, USA) and the Encode SARS-CoV-2 split IgM/IgG SJCP, AP, SAMF-S, MR, CS, RJ, and GWD collected samples and carried out lateral flow serological assay testing at satellite sites. keywords: assays; care; care workers; elisa; flow; health; infection; sars; study; testing; workers cache: cord-327890-ocisq7e4.txt plain text: cord-327890-ocisq7e4.txt item: #119 of 143 id: cord-331277-fjsuo3yy author: Hoste, Alexis C.R. title: Two serological approaches for detection of antibodies to SARS-CoV-2 in different scenarios: A screening tool and a point-of-care test date: 2020-08-11 words: 2410 flesch: 40 summary: Prior to the analyses, the samples were classified into positive or negative by PCR or by other commercial serological assays. In order to determine the prevalence of antibodies in the population and to complement the nucleic acid detection assays, especially at later days after the onset of the symptoms, serological assays are required (8) . keywords: assays; cov-2; protein; sars cache: cord-331277-fjsuo3yy.txt plain text: cord-331277-fjsuo3yy.txt item: #120 of 143 id: cord-333026-9f6ecg30 author: Kompanikova, J. title: Microbiologic Methods in the Diagnostics of Upper Respiratory Tract Pathogens date: 2017-03-03 words: 1784 flesch: 42 summary: Upper respiratory tract infection Principles of appropriate antibiotic use for acute pharyngitis in adults: background Infections of the respiratory system Lippincott's illustrated reviews: microbiology Viruses and bacteria in the etiology of the common cold Upper respiratory tract infection workup Medical microbiology, 5th edn How contagious are common respiratory tract infections? Microbiology: a human perspective Treatment of rhinosinusitis in the outpatient setting Characteristics of Streptococcus pneumoniae, Haemophilus influenzae, Moraxella catarrhalis and Staphylococcus aureus isolated from the nasopharynx of healthy children attending day-care centres in the Czech Republic Acknowledgments This study was supported by Department of Microbiology and Immunology. Upper respiratory tract infections (URIs) involve the moist surface of the eyes and eyelids, the nasolacrimal ducts, the middle ear, paranasal sinuses, mastoid air cells, and the main respiratory passage of the nose and throat as far as the epiglottis and vocal cords. keywords: filmarray; infections; panel; patient cache: cord-333026-9f6ecg30.txt plain text: cord-333026-9f6ecg30.txt item: #121 of 143 id: cord-334165-7gfk554m author: Stadlbauer, Daniel title: SARS‐CoV‐2 Seroconversion in Humans: A Detailed Protocol for a Serological Assay, Antigen Production, and Test Setup date: 2020-04-17 words: 5305 flesch: 66 summary: Coating ELISA plates (day 1). After the blocking incubation in step 3a, substep iii, remove ELISA plates from the RT incubator and throw off the blocking solution. keywords: elisa; pbs; plate; protein; spike; wells cache: cord-334165-7gfk554m.txt plain text: cord-334165-7gfk554m.txt item: #122 of 143 id: cord-334277-g3go3u02 author: Kovac, Marc title: EDTA-Anticoagulated Whole Blood for SARS-CoV-2 Antibody Testing by Electrochemiluminescence Immunoassay (ECLIA) and Enzyme-Linked Immunosorbent Assay (ELISA) date: 2020-08-14 words: 4729 flesch: 48 summary: The fact that whole blood was successfully utilized in the investigated test formats suggests that capillary blood samples, if properly taken, might also be suitable for SARS-CoV-2 antibody testing-not only with lateral flow test formats, but also immunoassays of higher quality. In receiver-operating characteristic curve analysis, all three assays displayed comparable diagnostic accuracy (area under the curve (AUC)) using corrected whole blood and serum (AUCs: 0.97 for ECLIA and IgG ELISA; 0.84 for IgA ELISA). keywords: blood; elisa; hematocrit; igg; results; samples; sars; serum cache: cord-334277-g3go3u02.txt plain text: cord-334277-g3go3u02.txt item: #123 of 143 id: cord-334896-3g75spkc author: MINAMI, Shohei title: Establishment of serological test to detect antibody against ferret coronavirus date: 2016-03-03 words: 2498 flesch: 53 summary: In this study, an enzyme-linked immunosorbent assay (ELISA) using recombinant N proteins was established and applied to investigate the seroprevalence of FRcoV infection in Japan. In this study, we attempted to clarify the seroprevalence of FRcoV in Japan and developed an ELISA using two Yamaguchi-1 strain recombinant N proteins, GST-N (1-179) and GST-N (180-374). keywords: elisa; ferret; frcov; gst; japan; proteins; strain cache: cord-334896-3g75spkc.txt plain text: cord-334896-3g75spkc.txt item: #124 of 143 id: cord-334968-gonx5taq author: Pignatelli, Jaime title: Lineage specific antigenic differences in porcine torovirus hemagglutinin-esterase (PToV-HE) protein date: 2013-12-23 words: 6807 flesch: 47 summary: In a previous study, PToV virus strains with HE proteins from the two lineages were found coexisting in a pig herd, and they were even obtained from the same animal at two consecutive sampling time points. The 3D structure and sialic acid preference of PToV-(strain Markelo) and BToV-(strain Breda) HE proteins have been solved [12] . keywords: animals; cell; elisa; figure; he52.11; he52.7; lineages; myc; piglets; proteins; ptov; rvv; serum cache: cord-334968-gonx5taq.txt plain text: cord-334968-gonx5taq.txt item: #125 of 143 id: cord-335121-ro3x3qa3 author: Ingram, George A. title: A comparative assessment of four serological methods used in the detection and measurement of anti-parasite antibodies in the serum of the amphibian, bufo viridis date: 1988-04-30 words: 3124 flesch: 46 summary: key: cord-335121-ro3x3qa3 authors: Ingram, George A.; Al-Yaman, Fadwa title: A comparative assessment of four serological methods used in the detection and measurement of anti-parasite antibodies in the serum of the amphibian, bufo viridis date: 1988-04-30 journal: International Journal for Parasitology DOI: 10.1016/0020-7519(88)90147-6 sha: doc_id: 335121 cord_uid: ro3x3qa3 Abstract Antibodies against Crithidia fasciculata choanomastigotes were detected in green toad (Bufo viridis) sera by direct agglutination, indirect haemagglutination (IHA), complement-fixation test (CFT) and enzyme-linked immunosorbent assay (ELISA), Correlation coefficients (r) were calculated for comparisons between each of the techniques and regression formulae derived in order to convert antibody levels as determined by one immunological method to that of another. This implies that the above two techniques have similar sensitivities in the screening of normal BVS for anti-parasite antibodies. keywords: antibodies; antibody; antigen; control; elisa; parasite; sera; titres cache: cord-335121-ro3x3qa3.txt plain text: cord-335121-ro3x3qa3.txt item: #126 of 143 id: cord-335591-r0x8yaqj author: Ohnishi, Kazuo title: Establishment and Characterization of Monoclonal Antibodies Against SARS Coronavirus date: 2007-11-28 words: 3145 flesch: 61 summary: The causative agent was identified as SARS coronavirus (SARS- CoV) (1,2) . This incubation is done by placing the PVDF membrane in the hybridization bag with 5 ml of antibody solution. keywords: antigen; cells; cov; elisa; pbs; sars; solution cache: cord-335591-r0x8yaqj.txt plain text: cord-335591-r0x8yaqj.txt item: #127 of 143 id: cord-336899-zngp67tb author: Kadkhoda, Kamran title: COVID‐19: are neutralizing antibodies neutralizing enough? date: 2020-06-03 words: 1213 flesch: 41 summary: The donors had neutralizing antibody titers of more than 640 at the time of donation while severely ill patients had relatively similar titers before transfusion as high as 640 (range, 160-640; GMT, 367). The US Food and Drug Administration currently recommends using donated plasma with neutralizing antibody titers of 160 or at a minimum a titer of 80 in severely ill patients. keywords: antibody; covid-19; patients; titers cache: cord-336899-zngp67tb.txt plain text: cord-336899-zngp67tb.txt item: #128 of 143 id: cord-340960-abanr641 author: Brigger, D. title: Accuracy of serological testing for SARS‐CoV‐2 antibodies: first results of a large mixed‐method evaluation study date: 2020-09-30 words: 4488 flesch: 42 summary: The manuscript was prepared according to the Standards for Reporting Diagnostic accuracy studies (STARD) guideline 32 . Few patients with anti-viral antibodies have been identified in the first 5 days following symptom onset but the positive rate rapidly increases thereafter 16, 17 . keywords: article; copyright; cov-2; covid-19; elisa; igg; patients; protein; rbd; rights; sars cache: cord-340960-abanr641.txt plain text: cord-340960-abanr641.txt item: #129 of 143 id: cord-342024-kaku49xd author: Espejo, Andrea P title: Review of Current Advances in Serologic Testing for COVID-19 date: 2020-06-25 words: 6485 flesch: 44 summary: However, several studies showed that the sensitivity of RT-PCR testing decreased over time post onset of symptoms and that this change was observed to be concurrent with the increasing sensitivity of antibody detection methods. There was preliminary evidence that the use of particular target antigens may provide value to increase the sensitivity of antibody detection methods. keywords: antibody; cov-2; detection; elisa; igg; igm; patients; samples; sars; sensitivity cache: cord-342024-kaku49xd.txt plain text: cord-342024-kaku49xd.txt item: #130 of 143 id: cord-343185-lbmbp9ca author: Hansen, C. B. title: SARS-CoV-2 antibody responses determine disease severity in COVID-19 infected individuals date: 2020-07-29 words: 5360 flesch: 42 summary: In a recent phase 1 trial, antibody responses against a vaccine candidate (S-2P antigen) and the RBD were assessed, finding similar Ig responses in pattern and magnitude between both antigens (17) . In conclusion, we have established robust, flexible and specific ELISA-based platforms for detection SARS-CoV-2 antibodies and presented novel insight into the link between antibody responses and COVID-19 disease severity. . keywords: antibody; cov-2; disease; july; license; medrxiv; medrxiv preprint; perpetuity; preprint; protein; sars; version cache: cord-343185-lbmbp9ca.txt plain text: cord-343185-lbmbp9ca.txt item: #131 of 143 id: cord-344309-6c2wttxg author: Lin, Huixing title: Development and application of an indirect ELISA for the detection of antibodies to porcine epidemic diarrhea virus based on a recombinant spike protein date: 2018-08-20 words: 4415 flesch: 51 summary: This established S1 indirect ELISA is capable of detecting serum antibodies against PEDV, and due to its high sensitivity and specificity, it could be applied for serological evaluation and indirect diagnosis of PEDV infection. Serum cross-reactivity of S1 indirect ELISA to other pathogens To validate the cross-reactivity, this S1 indirect ELISA was utilized to test porcine serum positive for other swine pathogens, namely, porcine transmissible gastroenteritis virus (TGEV), swine rotavirus (PoRV), porcine kobuvirus (PKV), porcine bocavirus (PBoV), porcine norovirus (PNoV), porcine circovirus type 2 (PCV2), porcine reproductive and respiratory syndrome virus (PRRSV), and enterotoxigenic E. coli (ETEC), keywords: diarrhea; elisa; indirect; pedv; porcine; protein; samples; serum; virus cache: cord-344309-6c2wttxg.txt plain text: cord-344309-6c2wttxg.txt item: #132 of 143 id: cord-344581-h7ikjgic author: Ong, David S.Y. title: Comparison of diagnostic accuracies of rapid serological tests and ELISA to molecular diagnostics in patients with suspected COVID-19 presenting to the hospital date: 2020-06-02 words: 2076 flesch: 47 summary: Clinical Characteristics of Coronavirus Disease 2019 in China Rapidly increasing cumulative incidence of coronavirus disease (COVID-19) in the European Union/European Economic Area and the United Kingdom Current information about the novel coronavirus (COVID-19) Bilthoven: RIVM Better tests, better care: improved diagnostics for infectious diseases SARS-CoV-2 Viral Load in Upper Respiratory Specimens of Infected Patients Detection of 2019 novel coronavirus (2019-nCoV) by real-time RT-PCR Performance of VivaDiag COVID-19 IgM/IgG Rapid Test is inadequate for diagnosis of COVID-19 in acute patients referring to emergency room department Evaluation of a COVID-19 IgM and IgG rapid test; an efficient tool for assessment of past exposure to SARS-CoV-2 Development and clinical application of a rapid IgM-IgG combined antibody test for SARS-CoV-2 infection diagnosis Antibody responses to SARS-CoV-2 in patients of novel coronavirus disease Antibody Detection and Dynamic Characteristics in Patients with COVID-19 Boson Biotech Rapid 2019-nCoV IgG/IgM Combo Test Card 10 / 20 (50% Cellex qSARS-CoV-2 IgG/IgM Cassette Dynamiker Biotechnology 2019-nCOV IgG/IgM Orient Gene Biotech COVID-19 IgG/IgM Rapid Test Cassette 11 / 20 (55% Prometheus Bio 2019-nCOV IgG/IgM In the subgroup of patients with time from symptom onset to sample collection >= 14 days, sensitivity and specificity of the LFA were 9/14 (64%; 95%CI 39-89) and 30/32 (94%; 95%CI 85-100), respectively, whereas sensitivity and specificity of the ELISA Of note, sensitivity was 17/24 (71%) in patients with >=7 days from symptom onset to sample collection and CRP >=100 mg/L We would like to thank our laboratory technicians and team managers for their assistance in performing the serological tests. This study aimed to assess the diagnostic performance of LFAs, and compare these to an enzyme-linked immunosorbent assay (ELISA) and NATs in suspected COVID-19 patients. keywords: covid-19; lfas; patients; rapid; sensitivity cache: cord-344581-h7ikjgic.txt plain text: cord-344581-h7ikjgic.txt item: #133 of 143 id: cord-344871-486sk4wc author: Wu, Jianping title: Biochemical and structural characterization of the interface mediating interaction between the influenza A virus non-structural protein-1 and a monoclonal antibody date: 2016-09-16 words: 7121 flesch: 53 summary: A virus A monoclonal antibody binds to threonine 49 in the non-structural 1 protein of influenza A virus and interferes with its ability to modulate viral replication Roles of the phosphorylation of specific serines and threonines in the NS1 protein of human influenza A viruses Monoclonal antibodies targeting the HR2 domain and the region immediately upstream of the HR2 of the S protein neutralize in vitro infection of severe acute respiratory syndrome coronavirus HADDOCK: a protein-protein docking approach based on biochemical or biophysical information Conserved surface features form the double-stranded RNA binding site of non-structural protein 1 (NS1) from influenza A and B viruses Structural basis for dsRNA recognition by NS1 protein of influenza A virus Assay Optimization and Screening of RNA-Protein Interactions by AlphaScreen The multifunctional NS1 protein of influenza A virus strains that circulate in humans differ in the ability of their NS1 proteins to block the activation of IRF3 and interferon-beta transcription Virulence of H5N1 avian influenza virus enhanced by a 15-nucleotide deletion in the viral nonstructural gene RNA binding by the novel helical domain of the influenza virus NS1 protein requires its dimer structure and a small number of specific basic amino acids Binding of influenza A virus NS1 protein to dsRNA in vitro The influenza virus NS1 protein is a poly(A)-binding protein that inhibits nuclear export of mRNAs containing poly(A) keywords: 2h6; cells; fab; h5n1; influenza; interaction; mab; mab 2h6; ns1; ns1(rbd; protein; residues; virus cache: cord-344871-486sk4wc.txt plain text: cord-344871-486sk4wc.txt item: #134 of 143 id: cord-346320-ysgz6adr author: Arabi, Yaseen M. title: Feasibility of Using Convalescent Plasma Immunotherapy for MERS-CoV Infection, Saudi Arabia date: 2016-09-17 words: 4249 flesch: 42 summary: We screened potential convalescent plasma donors from 3 cohorts: 1) patients with acute respiratory illness who were suspected of having MERS-CoV or who were confirmed MERS-CoV-positive by real-time reverse transcription PCR (rRT-PCR) of upper or lower respiratory secretions; 2) healthcare workers exposed to a laboratoryconfirmed MERS-CoV patient, as identified by ongoing active surveillance of the hospital Infection Prevention and Control Department; and 3) household contacts of patients with laboratory-confirmed MERS-CoV infection. Alternative strategies to identify convalescent plasma donors with adequate antibody titers should be explored, including the sampling of serum from patients with more severe disease and sampling at earlier points during illness. keywords: antibodies; antibody; convalescent; cov; elisa; infection; mers; patients; plasma; respiratory cache: cord-346320-ysgz6adr.txt plain text: cord-346320-ysgz6adr.txt item: #135 of 143 id: cord-346574-u28y1ttw author: Chen, Keyan title: Development and evaluation of an immunochromatographic strip for rapid detection of porcine hemagglutinating encephalomyelitis virus date: 2012-08-24 words: 5526 flesch: 45 summary: Additionally, there was a strong agreement between the sandwich enzyme-linked immunosorbent assay (ELISA) and immunochromatographic strips (Kappa = 0.976). The disease is caused by PHE coronavirus (PHE-CoV), which comprises a single strain and is the only known neurotropic CoV affecting pigs keywords: cov; detection; elisa; gold; mab; pcr; phe; samples; strip; test; virus cache: cord-346574-u28y1ttw.txt plain text: cord-346574-u28y1ttw.txt item: #136 of 143 id: cord-347374-mryazbnq author: Okba, Nisreen M.A. title: Severe Acute Respiratory Syndrome Coronavirus 2−Specific Antibody Responses in Coronavirus Disease Patients date: 2020-07-17 words: 3582 flesch: 42 summary: For each dilution step (in duplicate), we diluted patient serum samples in 200 µL of OptiPro serum-free medium (https://www. thermofisher.com) and mixed 1:1 with 200 µL of virus solution containing 100 PFUs. Using serum samples from patients with PCR-confirmed SARS-CoV-2 infections, other coronaviruses, or other respiratory pathogenic infections, we validated and tested various antigens in different in-house and commercial ELISAs. keywords: antibodies; cov; cov-2; patients; samples; sars; serum cache: cord-347374-mryazbnq.txt plain text: cord-347374-mryazbnq.txt item: #137 of 143 id: cord-348161-757c51xw author: Petrosova, A. title: Development of a highly sensitive, field operable biosensor for serological studies of Ebola virus in central Africa date: 2007-03-26 words: 5431 flesch: 41 summary: When modified into an easyto-use procedure, this technology might be used in the future in a field operable clinical tool for Ebola virus antibody screening. key: cord-348161-757c51xw authors: Petrosova, A.; Konry, T.; Cosnier, S.; Trakht, I.; Lutwama, J.; Rwaguma, E.; Chepurnov, A.; Mühlberger, E.; Lobel, L.; Marks, R.S. title: Development of a highly sensitive, field operable biosensor for serological studies of Ebola virus in central Africa date: 2007-03-26 journal: Sens Actuators B Chem DOI: 10.1016/j.snb.2006.07.005 sha: doc_id: 348161 cord_uid: 757c51xw We describe herein a newly developed optical immunosensor for detection of antibodies directed against antigens of the Ebola virus strains Zaire and Sudan. keywords: antibodies; antibody; detection; ebola; ebola virus; elisa; fiber; human; igg; immunosensor; sera; solution; sudan; virus; zaire cache: cord-348161-757c51xw.txt plain text: cord-348161-757c51xw.txt item: #138 of 143 id: cord-348660-qnbgywgy author: Yilmaz, Huseyin title: Production of Recombinant N Protein of Infectious Bronchitis Virus Using the Baculovirus Expression System and Its Assessment as a Diagnostic Antigen date: 2018-07-09 words: 3928 flesch: 38 summary: Recombinant IBV N protein was expressed using passage 2 or higher passage recombinant baculovirus stocks (> 10 7 pfu/ml). Approximately, 100 μl of sample containing approximately 5 μg of recombinant IBV N protein was diluted in 50-μl Laemmli sample dilution buffer (Santa Cruz Biotechnology, Dallas, TX) and resolved in 12% Bis-Tris polyacrylamide gel as described above. keywords: chickens; elisa; ibv; positive; protein; recombinant; sera; virus cache: cord-348660-qnbgywgy.txt plain text: cord-348660-qnbgywgy.txt item: #139 of 143 id: cord-349744-8cg5yj20 author: Lassaunière, Ria title: Evaluation of nine commercial SARS-CoV-2 immunoassays date: 2020-04-10 words: 2658 flesch: 49 summary: To determine the agreement between the different ELISAs and POC tests evaluate, the proportion of case sera that shared the same result between two assays were calculated. https://doi.org/10.1101/2020.04.09.20056325 doi: medRxiv preprint In the present study, three SARS-CoV-2-specific commercial ELISA assays and six POC rapid tests were evaluated using sera from hospitalized adult patients with PCR-confirmed diagnoses for SARS-CoV-2 and a collection of control serum samples taken before the emergence of the virus in China in December 2019. keywords: cov-2; elisa; license; preprint; sars; tests cache: cord-349744-8cg5yj20.txt plain text: cord-349744-8cg5yj20.txt item: #140 of 143 id: cord-351498-bmq6zcb0 author: Martínez-Sernández, Victoria title: Comparison of recombinant cathepsins L1, L2, and L5 as ELISA targets for serodiagnosis of bovine and ovine fascioliasis date: 2018-03-21 words: 8322 flesch: 34 summary: Evaluation of a diagnostic monoclonal antibody-based capture enzyme-linked immunosorbent assay for detection of a 26-to 28-kd Fasciola hepatica coproantigen in cattle Diagnosing human anisakiasis: recombinant Ani s 1 and Ani s 7 allergens versus the UniCAP 100 fluorescence enzyme immunoassay The sensitivity and specificity of two methods for detecting Fasciola infections in cattle The life cycle of Fasciola hepatica Anisakis simplex: from obscure infectious worm to inducer of immune hypersensitivity Determining the prevalence and seasonality of Fasciola hepatica in pasture-based dairy herds in Ireland using a bulk tank milk ELISA Characterisation of a novel Kunitztype molecule from the trematode Fasciola hepatica Immunodiagnosis of human fascioliasis by an enzyme-linked immunosorbent assay (ELISA) and a micro-ELISA Immunodiagnosis of fasciolosis using recombinant procathepsin L cystein proteinase Associations between anti-Fasciola hepatica antibody levels in bulk-tank milk samples and production parameters in dairy herds Qualitative and quantitative evaluation of coprological and serological techniques for the diagnosis of fasciolosis in cattle Measurement of antibodies to gastrointestinal nematodes and liver fluke in meat juice of beef cattle and associations with carcass parameters Recent advances in the diagnosis, impact on production and prediction of Fasciola hepatica in cattle Use of a pre-selected epitope of cathepsin-L1 in a highly specific peptide-based immunoassay for the diagnosis of Fasciola hepatica infections in cattle Early immunodiagnosis of fasciolosis in ruminants using recombinant Fasciola hepatica cathepsin L-like protease Bridging gaps in the molecular phylogeny of the Lymnaeidae (Gastropoda: Pulmonata), vectors of Fascioliasis Ani s 1 and Ani s 7 recombinant allergens are able to differentiate distinct Anisakis simplex-associated allergic clinical disorders The Fasciola hepatica genome: gene duplication and polymorphism reveals adaptation to the host environment and the capacity for rapid evolution Comparing the areas under two or more correlated receiver operating characteristic curves: a nonparametric approach Across intramammalian stages of the liver fluke Fasciola hepatica: a proteomic study Isolation of a cDNA encoding Fasciola hepatica cathepsin L2 and functional expression in Saccharomyces cerevisiae Fasciola hepatica -monitoring the milky way? The use of tank milk for liver fluke monitoring in dairy herds as base for treatment strategies International handbook of foodborne pathogens Sandwich enzyme-linked immunosorbent assay for detection of excretory secretory antigens in humans with fascioliasis Evaluation of Fas2-ELISA for the serological detection of Fasciola hepatica infection in humans Application of a coproantigen ELISA as an indicator of efficacy against multiple life stages Fasciola hepatica infections in sheep The diagnosis of human fascioliasis by enzyme-linked immunosorbent assay (ELISA) using recombinant cathepsin L protease Comparative assessment of ELISAs using recombinant saposin-like protein 2 and recombinant cathepsin L-1 from Fasciola hepatica for the serodiagnosis of human fasciolosis Successful DNA immunisation of rats against fasciolosis Evaluation of a recombinant cathepsin L1 ELISA and comparison with the Pourquier and ES ELISA for the detection of antibodies against Fasciola hepatica Advances in refolding of proteins produced in E. coli An extended study of seroprevalence of anti-Anisakis simplex IgE antibodies in Norwegian blood donors Development and evaluation of a new lateral flow immunoassay for serodiagnosis of human fasciolosis MF6p/FhHDM-1 major antigen secreted by the trematode parasite Fasciola hepatica is a heme-binding protein Rapid enhanced MM3-COPRO ELISA for detection of Fasciola coproantigens Fasciola, lymnaeids and human fascioliasis, with a global overview on disease transmission, epidemiology, evolutionary genetics, molecular epidemiology and control Direct and indirect affection of the central nervous system by Fasciola infection Diagnosis of human fascioliasis by stool and blood techniques: update for the present global scenario Optimized serodiagnosis of sheep fascioliasis by Fast-D protein liquid chromatography fractionation of Fasciola hepatica excretory-secretory antigens An ultrasensitive capture ELISA for detection of Fasciola hepatica coproantigens in sheep and cattle using a new monoclonal antibody (MM3) keywords: antibodies; antigens; cattle; elisa; et al; fasciola; hepatica; mm3; recombinant; rfhpcl1; samples; sera; sheep cache: cord-351498-bmq6zcb0.txt plain text: cord-351498-bmq6zcb0.txt item: #141 of 143 id: cord-351952-lhhjax3s author: Pickering, Suzanne title: Comparative assessment of multiple COVID-19 serological technologies supports continued evaluation of point-of-care lateral flow assays in hospital and community healthcare settings date: 2020-09-24 words: 5327 flesch: 41 summary: Therefore, before deployment in situations where the pre-test prevalence is likely to be low, such as seroprevalence studies, outpatient assessment or pre-admission screening for operations, these assays will require further evaluation with known SARS-CoV-2 asymptomatic and ambulatory cases, alongside an extended set of pre-pandemic samples. Taking into account the reactivity of negative control samples in this ELISA, 100% specificity could be reached using a cut-off where IgG against N or S both have OD values at least 4-fold above the wells containing secondary antibody only (Fig 1B, S1 Table) . keywords: antibodies; assays; cov-2; days; detection; elisa; house; igg; igm; samples; sars; tests cache: cord-351952-lhhjax3s.txt plain text: cord-351952-lhhjax3s.txt item: #142 of 143 id: cord-353190-7qcoxl81 author: Nicklas, Werner title: Viral Infections of Laboratory Mice date: 2012-05-17 words: 27792 flesch: 37 summary: The term murine hepatitis virus (MHV; commonly referred to as 'mouse hepatitis virus') A model for the study of viral infection, pathogenesis, and clearance Histopathological characterization of the naturally occurring hepatotropic virus infections of nude mice Detection methods for the identification of rodent viral and mycoplasmal infections Reverse transcriptionpolymerase chain reaction detection and nucleic acid sequence confirmation of reovirus infection in laboratory mice with discordant serologic indirect immunofluorescence assay and enzyme-linked immunosorbent assay results Diagnosis of murine infections in relation to test methods employed Reovirus 3 not detected by reverse transcriptase-mediated polymerase chain reaction analysis of preserved tissue from infants with cholestatic liver disease Detection of reovirus type 3 by use of fluorogenic nuclease reverse transcriptase polymerase chain reaction Detection of reovirus by reverse transcription-polymerase chain reaction using primers corresponding to conserved regions of the viral L1 genome segment Isolation of a non-pathogenic tumour-destroying virus from mouse ascites An oncolytic virus recovered from Swiss mice during passage of an ascites tumour Mouse hepatitis virus Enterotropic mouse hepatitis virus Effects of air temperature and relative humidity on coronavirus survival on surfaces Asymptomatic infection of mouse hepatitis virus in the rat Effects of experimental infection of the deer mouse (Peromyscus maniculatus) with mouse hepatitis virus Isolation of a latent murine hepatitis virus from cultured mouse liver cells Induction of lytic plaques by murine leukemia virus in murine sarcoma virus-transformed nonproducer mouse cells persistently infected with mouse hepatitis virus MHV-S Mouse hepatitis virus biology and epizootiology The cellular and molecular pathogenesis of coronaviruses Enterotropic coronavirus (mouse hepatitis virus) in mice: influence of host age and strain on infection and disease Response of genetically susceptible and resistant mice to intranasal inoculation with mouse hepatitis virus JHM Duration of mouse hepatitis virus infection: studies in immunocompetent and chemically immunosuppressed mice Effective clearance of mouse hepatitis virus from the central nervous system requires both CD4þ and CD8þ T cells Role of CD4þ and CD8þ T cells in mouse hepatitis virus infection in mice Antibody prevents virus reactivation within the central nervous system Mouse hepatitis virus Enterotropic mouse hepatitis virus infection in nude mice Persistent transmission of mouse hepatitis virus by transgenic mice Duration of challenge immunity to coronavirus JHM in mice Virus strain specificity of challenge immunity to coronavirus Duration and strain-specificity of immunity to enterotropic mouse hepatitis virus Passively acquired challenge immunity to enterotropic coronavirus in mice Epizootic coronaviral typhlocolitis in suckling mice Isolation of mouse hepatitis virus from infant mice with fatal diarrhea Thymus involution induced by mouse hepatitis virus A59 in BALB/c mice Adverse effects of mouse hepatitis virus on ascites myeloma passage in the BALB/eJ mouse Murine hepatitis virus strain 1 produces a clinically relevant model of severe acute respiratory syndrome in A/J mice Tolllike receptor 4 deficiency increases disease and mortality after mouse hepatitis virus type 1 infection of susceptible C3H mice Granulomatous peritonitis and pleuritis in interferon-gamma gene knockout mice naturally infected with mouse hepatitis virus Pathogenesis of enterotropic mouse hepatitis virus in immunocompetent and immunodeficient mice Vertical transmission of mouse hepatitis virus infection in mice Tissue distribution and duration of mouse hepatitis virus in naturally infected immunocompetent ICR (CD-1) and immunodeficient athymic nudenu mouse strains used for ovarian transplantation and in vitro fertilization Rederivation of inbred strains of mice by means of embryo transfer Risk assessment of mouse hepatitis virus infection via in vitro fertilization and embryo transfer by the use of zona-intact and laser-microdissected oocytes Mouse hepatitis virus immunofluorescence in formalin-or Bouin's-fixed tissues using trypsin digestion Comparison of isolation in cell culture with conventional and modified mouse antibody production tests for detection of murine viruses Monoclonal antibody solution hybridization assay for detection of mouse hepatitis virus infection Detection of rodent coronaviruses in tissues and cell cultures by using polymerase chain reaction Sequence analysis and molecular detection of mouse hepatitis virus using the polymerase chain reaction Detection of mouse hepatitis virus by the polymerase chain reaction and its application to the rapid diagnosis of infection Detection of rodent coronaviruses by use of fluorogenic reverse transcriptase-polymerase chain reaction analysis An immunofluorescence test for detection of serum antibody to rodent coronaviruses Simultaneous detection of antibodies to mouse hepatitis virus recombinant structural proteins by a microsphere-based multiplex fluorescence immunoassay Differences in antibody production against mouse hepatitis virus (MHV) among mouse strains Maternally-derived passive immunity to enterotropic mouse hepatitis virus Mouse hepatitis virus: molecular biology and implications for pathogenesis Maintenance of pluripotency in mouse embryonic stem cells persistently infected with murine coronavirus Replication of murine coronaviruses in mouse embryonic stem cell lines. keywords: age; animals; antibodies; antibody; cells; choriomeningitis; clinical; colonies; days; detection; disease; experimental; hepatitis; hepatitis virus; host; immune; infection; inoculation; laboratory; laboratory mice; lesions; mhv; mice; mouse; mousepox; murine; parvovirus; pcr; research; results; strains; testing; transmission; virus; virus infection; viruses; weeks cache: cord-353190-7qcoxl81.txt plain text: cord-353190-7qcoxl81.txt item: #143 of 143 id: cord-353614-z4fpy607 author: Kusano, Nario title: Immunochromatographic assay for simple and rapid detection of Satsuma dwarf virus and related viruses using monoclonal antibodies date: 2007-02-16 words: 2979 flesch: 47 summary: Survey on the extension of Satsuma dwarf virus disease and effect of root isolation or soil fumigation China laurestine: a symptomless carrier of Satsuma dwarf virus which accelerates natural transmission in the fi elds Improvement of enzyme-linked immunosorbent assay (ELISA) for detection of Citrus tatter leaf virus Simplifying of rapid immunofi lter paper assay for faster detection of plant viruses: simplifi ed RIPA Evaluation of commercially available immunogloblin M capture enzyme-linked immunosorbent assay kit for diagnosing acute dengue infection Host range, seed transmission and detection by ELISA and lateral fl ow of an Italian isolate of Pepino mosaic virus Reliability of detection of Citrus tristeza virus an immunochromatographic fl ow assay in comparison with ELISA Evaluation of immunochromatographic assay systems for rapid detection of hepatitis B surface antigen and antibody, dainascreen HbsAg and dainascreen Ausab Changes in fruit character and quality in Satsuma mandarin infected with Satsuma dwarf virus A novel detection and identifi cation technique for plant viruses: rapid immunofi lter paper assay Evaluation for a rapid immunochromatographic test for diagnosis of dengue virus infection Evaluation of three immunoassay kits for rapid detection of infl uenza virus A and B Studies on the dwarf disease of Satsuma orange Acknowledgments Anti-SDV monoclonal antibody was added to the colloidal gold solution for a fi nal concentration of 7.3 µg/ml. keywords: antibody; elisa; gold; ica; sdv; virus cache: cord-353614-z4fpy607.txt plain text: cord-353614-z4fpy607.txt